Citrus Sinensis ID: 006231

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-----
MAGIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGDGIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIAPPRSSLSVDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKETRTSTSVSSESGHRRKGGASASRENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAVTQSSSSSWFQWIKGPYSRPSSTAVGSSSRIENIQDPFAIPQDYTWITAEAKKKKMQDKNKSKKSRSQNQ
ccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccEEEEEcccccccccccEEEcccEEEEEcccccccccccccEEEEEcccHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccEEEEccccccccccEEEEccEEEEEEEEEcEEEEEEEEccccccccHHHHccccccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccc
cccccHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccEHEEEcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEEEEEEEcccHHHHHHccccccEEEEEcccEEEEEEEEEcccccEEEEccEEEEEEccccccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHccccEEcccccccEEEEEEEccccccEccccEEEEcccEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEEEEcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEEEEccEEcccccccHccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEcccccEEEcHHHHHHHHHHHHHccccccccc
magidvskyahspvhkaiamrdYPSLRRLLAglprlsnpaEIRTEMASLAEEEKADAISAAidrrdvpnrdtplHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNfessvipfisriapsdtyKIWKRGAnlradmtlagfdgfriqrsdqsiiflgdgsedgkipsgslcmishKDKEVMNaldgagapamEEEIRQEVAAMSQtnifrpgidvtqavllpqltwrrqeKTEMVGAWKAKVYDMHNVVVSIksrrvpgamsddeffsscnenetesedlnDILTEDERRQLEVALKLDssemsnengdgiiahrhscyehreipveevngrrngetkqekkgwfggwrkkdskpegpkkiapprsslsvdekvsdllgdspsgnqikpgrhsveivarddhrrgketrtstsvssesghrrkggasasreneykkglrpilwlspnfplqteelLPLLDILANKVKAIRRLRELLTtklpmgtfpvkvaipvvpTIRVLVTFtkfeelqpvddefatppssptaagrespavtqssssswfqwikgpysrpsstavgsssrieniqdpfaipqdyTWITAEAKKKKmqdknkskksrsqnq
magidvskyahspvhkaiamrDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAIsaaidrrdvpnrdTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRhyqplawakwcrrLPRLVGTMRRMRDFYMEITFnfessvipfisriapSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLlpqltwrrqEKTEMvgawkakvydmHNVVVSIKsrrvpgamsdDEFFsscnenetesedlndilTEDERRQLEVALkldssemsneNGDGIIAHRHSCYEHreipveevngrrngetkqekkgwfggwrkkdskpegpkkiapprsslsvdEKVSDLLgdspsgnqikpgrhsveivarddhrrgketrtstsvssesghrrkggasasreneyKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELlttklpmgtfpvkvaipvVPTIRVLVTFTkfeelqpvddEFATPPSSPTAAGRESPAVTQSSSSSWFQWIKGPYSRPSSTAVGsssrieniqdpfaipqDYTWITAEAKkkkmqdknkskksrsqnq
MAGIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKadaisaaidrrdVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGDGIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIAPPRSSLSVDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKEtrtstsvssesghrrKGGASASRENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAVTQSSSSSWFQWIKGPYSRPSSTAVGSSSRIENIQDPFAIPQDYTWITAEAkkkkmqdknkskksrsqnq
***************KAIAMRDYPSLRRLLAG*****************************************LHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGD***********LCM******************************MSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKS********************************************************IIAHRHSCYE********************************************************************************************************************GLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEEL*******************************WFQWIK********************QDPFAIPQDYTWIT**********************
****DVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMN************************NIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSI**********************************************************************************************GWRK******************************************************************************************ILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFAT************************************************QDPFAIPQDYTWI***********************
MAGIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGDGIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWR***********************KVSDLLGDSPSGNQIKPGRHSVEIVARD*********************************YKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDE*************************WFQWIKGP*************RIENIQDPFAIPQDYTWITAEA*******************
**GIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNEN******LNDILTEDER*QLEVALKLD**********************************************************************************************************************************RENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFAT**********************************************NIQDPFAIPQDYTWITAEAKKKK***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGDGIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIAPPRSSLSVDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKETRTSTSVSSESGHRRKGGASASRENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAVTQSSSSSWFQWIKGPYSRPSSTAVGSSSRIENIQDPFAIPQDYTWITAEAKKKKMQDKNKSKKSRSQNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query655 2.2.26 [Sep-21-2011]
Q5F259626 Ankyrin repeat domain-con yes no 0.381 0.399 0.332 2e-32
Q86YJ7626 Ankyrin repeat domain-con yes no 0.381 0.399 0.332 3e-32
Q7ZYD9513 Ankyrin repeat domain-con N/A no 0.367 0.469 0.312 4e-26
Q6NRD0510 Ankyrin repeat domain-con N/A no 0.366 0.470 0.316 8e-26
Q8N6S4541 Ankyrin repeat domain-con no no 0.369 0.447 0.317 9e-26
Q3UX43541 Ankyrin repeat domain-con no no 0.369 0.447 0.317 9e-26
Q7ZUV0488 Ankyrin repeat domain-con yes no 0.360 0.483 0.318 4e-25
Q28C34509 Ankyrin repeat domain-con no no 0.349 0.449 0.319 5e-25
Q8IZ07590 Ankyrin repeat domain-con no no 0.396 0.440 0.270 4e-21
Q80UP5588 Ankyrin repeat domain-con no no 0.372 0.414 0.292 2e-20
>sp|Q5F259|AN13B_MOUSE Ankyrin repeat domain-containing protein 13B OS=Mus musculus GN=Ankrd13b PE=2 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 141/265 (53%), Gaps = 15/265 (5%)

Query: 52  EEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAI 111
           E++  A    I++ D P   TPLHLA  LG      +L+  GAD   +N  GW+ LQEA+
Sbjct: 31  EKEVRAGQVDIEQLD-PRGRTPLHLATTLGHLECARVLLAHGADVGRENRSGWTVLQEAV 89

Query: 112 CSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIA 171
            +R+  +  +++R+       K    +P L+  +R+ +DFY+E+ + F +S +P +S+I 
Sbjct: 90  STRDLELVQLVLRYRDYQRVVKRLAGIPMLLEKLRKAQDFYVEMKWEF-TSWVPLVSKIC 148

Query: 172 PSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGS--------EDGKIPSGSL 223
           PSDTYK+WK G NLR D TL GFD    QR ++S +F G  +         D ++     
Sbjct: 149 PSDTYKVWKSGQNLRVDTTLLGFDHMTWQRGNRSFVFRGQDTSAVVMEIDHDRRVVYMET 208

Query: 224 CMISHKDKEVMNALDGAGAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQE 283
             ++ +D+E++ A   A  P+ E+ + +  A +  T +    I   +      L W R E
Sbjct: 209 LALAGQDRELLLA---AAQPSEEQVLSRLTAPVVTTQLDTKNISFERNK-TGILGW-RSE 263

Query: 284 KTEMVGAWKAKVYDMHNVVVSIKSR 308
           KTEMV  ++AKVY   NV +  ++R
Sbjct: 264 KTEMVNGYEAKVYGASNVELITRTR 288

Mus musculus (taxid: 10090)
>sp|Q86YJ7|AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens GN=ANKRD13B PE=2 SV=4 Back     alignment and function description
>sp|Q7ZYD9|A13CB_XENLA Ankyrin repeat domain-containing protein 13C-B OS=Xenopus laevis GN=ankrd13c-b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRD0|A13CA_XENLA Ankyrin repeat domain-containing protein 13C-A OS=Xenopus laevis GN=ankrd13c-a PE=2 SV=1 Back     alignment and function description
>sp|Q8N6S4|AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens GN=ANKRD13C PE=2 SV=2 Back     alignment and function description
>sp|Q3UX43|AN13C_MOUSE Ankyrin repeat domain-containing protein 13C OS=Mus musculus GN=Ankrd13c PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUV0|AN13C_DANRE Ankyrin repeat domain-containing protein 13C OS=Danio rerio GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q28C34|AN13C_XENTR Ankyrin repeat domain-containing protein 13C OS=Xenopus tropicalis GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q8IZ07|AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens GN=ANKRD13A PE=1 SV=3 Back     alignment and function description
>sp|Q80UP5|AN13A_MOUSE Ankyrin repeat domain-containing protein 13A OS=Mus musculus GN=Ankrd13a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query655
255554182652 protein binding protein, putative [Ricin 0.990 0.995 0.875 0.0
224057590627 predicted protein [Populus trichocarpa] 0.957 1.0 0.853 0.0
147857536653 hypothetical protein VITISV_015320 [Viti 0.992 0.995 0.868 0.0
225462775652 PREDICTED: ankyrin repeat domain-contain 0.990 0.995 0.864 0.0
449432446651 PREDICTED: ankyrin repeat domain-contain 0.986 0.992 0.835 0.0
356575162649 PREDICTED: ankyrin repeat domain-contain 0.990 1.0 0.818 0.0
356534834649 PREDICTED: uncharacterized protein LOC10 0.990 1.0 0.811 0.0
357122986654 PREDICTED: ankyrin repeat domain-contain 0.983 0.984 0.718 0.0
326490537655 predicted protein [Hordeum vulgare subsp 0.984 0.984 0.704 0.0
226503745657 hypothetical protein [Zea mays] gi|21988 0.984 0.981 0.716 0.0
>gi|255554182|ref|XP_002518131.1| protein binding protein, putative [Ricinus communis] gi|223542727|gb|EEF44264.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/657 (87%), Positives = 617/657 (93%), Gaps = 8/657 (1%)

Query: 1   MAGIDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISA 60
           MAGID+SKYAHSPVHKAIA RD+ SLR++LA LPRL +PAEIRTE  S+AEEEKADAISA
Sbjct: 1   MAGIDISKYAHSPVHKAIATRDFASLRKILAALPRLCDPAEIRTEAVSMAEEEKADAISA 60

Query: 61  AIDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAM 120
            +DRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAM
Sbjct: 61  VVDRRDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAM 120

Query: 121 IIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWK 180
           IIVRHYQPLAWAKWCRRLPRLV TMRRMRDFYMEITF+FESSVIPFISRIAPSDTYKIWK
Sbjct: 121 IIVRHYQPLAWAKWCRRLPRLVATMRRMRDFYMEITFHFESSVIPFISRIAPSDTYKIWK 180

Query: 181 RGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGA 240
           RGANLRADMTLAGFDGFRIQRSDQSI+FLGDGSEDGK+P+GSLCMISHKDKEVMNALDGA
Sbjct: 181 RGANLRADMTLAGFDGFRIQRSDQSILFLGDGSEDGKVPAGSLCMISHKDKEVMNALDGA 240

Query: 241 GAPAMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHN 300
           GAPA EEE+RQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTE+VG WKAKVYDMHN
Sbjct: 241 GAPATEEEVRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTELVGPWKAKVYDMHN 300

Query: 301 VVVSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNEN 360
           VVVSIKSRRVPGAM+DDEFFSSCNENETESE+L+DILTE+ERRQLEVALKLDS E++NEN
Sbjct: 301 VVVSIKSRRVPGAMTDDEFFSSCNENETESEELSDILTEEERRQLEVALKLDSLELANEN 360

Query: 361 GDGIIAHRHSCYEH--REIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIAPPR 418
           GDGIIAHRHSCY+   R+IP+E+ NG RNGETKQEKKGWFGGWRK+D+K EG KKI PPR
Sbjct: 361 GDGIIAHRHSCYDQRDRDIPIEDGNGYRNGETKQEKKGWFGGWRKRDAKVEGQKKIVPPR 420

Query: 419 SSLSVDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKETRTSTSVSSESGHRRKGG 478
           SSL VDEKVSDLLGDSPS +QIKPGRHSVEIV RD+HR+G++T+TSTS+SSES +RRK G
Sbjct: 421 SSLCVDEKVSDLLGDSPSESQIKPGRHSVEIVVRDEHRKGRDTKTSTSMSSESNNRRKEG 480

Query: 479 ASASRENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTF 538
              SRENEYKKGLRP LWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTF
Sbjct: 481 ---SRENEYKKGLRPTLWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTF 537

Query: 539 PVKVAIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAVTQSSSSSWFQWI 598
           PVKVAIPVVPTIRVLVTFTK EELQP+ DEFATPPSSPT AGRESP V+QSSSSSWFQWI
Sbjct: 538 PVKVAIPVVPTIRVLVTFTKLEELQPL-DEFATPPSSPT-AGRESPTVSQSSSSSWFQWI 595

Query: 599 KGPYSRPSSTAVGSSSRIENIQDPFAIPQDYTWITAEAKKKKMQDKNKSKKSRSQNQ 655
           K PY RP S+  GSSSRIEN+QDPF +P DY+WI+AEAKKKKMQ+KNKSKK+RSQN 
Sbjct: 596 KAPY-RPISSTNGSSSRIENVQDPFVVPPDYSWISAEAKKKKMQEKNKSKKARSQNH 651

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224057590|ref|XP_002299280.1| predicted protein [Populus trichocarpa] gi|222846538|gb|EEE84085.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147857536|emb|CAN80381.1| hypothetical protein VITISV_015320 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462775|ref|XP_002263910.1| PREDICTED: ankyrin repeat domain-containing protein 13C [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432446|ref|XP_004134010.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Cucumis sativus] gi|449487530|ref|XP_004157672.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356575162|ref|XP_003555711.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Glycine max] Back     alignment and taxonomy information
>gi|356534834|ref|XP_003535956.1| PREDICTED: uncharacterized protein LOC100780762 [Glycine max] Back     alignment and taxonomy information
>gi|357122986|ref|XP_003563194.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326490537|dbj|BAJ84932.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326494104|dbj|BAJ85514.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326528297|dbj|BAJ93330.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|226503745|ref|NP_001146744.1| hypothetical protein [Zea mays] gi|219888581|gb|ACL54665.1| unknown [Zea mays] gi|414589157|tpg|DAA39728.1| TPA: hypothetical protein ZEAMMB73_827159 [Zea mays] gi|414589158|tpg|DAA39729.1| TPA: hypothetical protein ZEAMMB73_827159 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query655
TAIR|locus:2010597664 AT1G04780 "AT1G04780" [Arabido 0.948 0.935 0.714 4.7e-238
TAIR|locus:2093741607 AT3G24210 [Arabidopsis thalian 0.586 0.632 0.63 4e-188
TAIR|locus:2100900640 AT3G04470 "AT3G04470" [Arabido 0.664 0.679 0.536 8e-124
TAIR|locus:2036863624 AT1G62050 "AT1G62050" [Arabido 0.642 0.674 0.417 3e-85
MGI|MGI:2144501626 Ankrd13b "ankyrin repeat domai 0.358 0.375 0.345 1.3e-40
UNIPROTKB|F1P6U9398 ANKRD13C "Uncharacterized prot 0.348 0.572 0.330 6e-40
UNIPROTKB|F1NWB4432 ANKRD13C "Uncharacterized prot 0.398 0.604 0.311 1.4e-37
ZFIN|ZDB-GENE-030131-3892488 ankrd13c "ankyrin repeat domai 0.348 0.467 0.322 2.2e-37
RGD|1595074540 Ankrd13c "ankyrin repeat domai 0.398 0.483 0.311 4.1e-36
MGI|MGI:2139746541 Ankrd13c "ankyrin repeat domai 0.398 0.482 0.311 7.1e-36
TAIR|locus:2010597 AT1G04780 "AT1G04780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2295 (812.9 bits), Expect = 4.7e-238, P = 4.7e-238
 Identities = 464/649 (71%), Positives = 525/649 (80%)

Query:     4 IDVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKXXXXXXXXX 63
             IDV+KY HSPVH A+  RDY  L++LL+ LP++ +P+E++ E AS+AEE K         
Sbjct:     6 IDVTKYGHSPVHHAVVTRDYAGLKKLLSALPKMRDPSEVQNEAASVAEETKADSIAAVID 65

Query:    64 XXXVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIV 123
                V NRDT LHLAVKLGDET+ EMLM AGADWSLQNE GWSALQEAIC REE IAMIIV
Sbjct:    66 RRDVVNRDTALHLAVKLGDETSAEMLMAAGADWSLQNEHGWSALQEAICGREERIAMIIV 125

Query:   124 RHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIAPSDTYKIWKRGA 183
             RHYQPLAWAKWCRRLPRLV TM RMRDFYMEITF+FESSVIPFISR+APSDTYKIWKRGA
Sbjct:   126 RHYQPLAWAKWCRRLPRLVATMHRMRDFYMEITFHFESSVIPFISRVAPSDTYKIWKRGA 185

Query:   184 NLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAP 243
             NLRADMTLAGFDGFRIQRSDQ+I+FLGDGSEDGK+PSGSL MISHKDKE+MNALDGAGA 
Sbjct:   186 NLRADMTLAGFDGFRIQRSDQTILFLGDGSEDGKVPSGSLLMISHKDKEIMNALDGAGAA 245

Query:   244 AMEEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGAWKAKVYDMHNVVV 303
             A EEE+RQEVAAMS+T+IFRPGIDVTQAVL PQLTWRRQEKTEMVG WKAKVYDMHNVVV
Sbjct:   246 ASEEEVRQEVAAMSKTSIFRPGIDVTQAVLFPQLTWRRQEKTEMVGQWKAKVYDMHNVVV 305

Query:   304 SIKSRRVPGAMSDDEFFSSCN-ENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGD 362
             SIKSRRVPGAM+D+E FS+ N EN+TESEDL DILTEDE+RQLE+ALKLDS E S+ NG+
Sbjct:   306 SIKSRRVPGAMTDEELFSNTNQENDTESEDLGDILTEDEKRQLELALKLDSPEESS-NGE 364

Query:   363 G--IIAHRHSC-YEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIA-PPR 418
                I   ++SC +E REIPV +  G  NG  KQEKKGWF GWRK++   EG ++ + PPR
Sbjct:   365 SSRISQKQNSCSFEDREIPVTD--G--NGYCKQEKKGWFSGWRKRE---EGHRRSSVPPR 417

Query:   419 SSLSVDEKVSDLLGD--SPS--GNQIKPGRHS-VEIVARDDHRRGKEXXXXXXXXXXXXX 473
             +SL VDEKVSDLLGD  SPS  G QIKPGRHS VE V R+++R  ++             
Sbjct:   418 NSLCVDEKVSDLLGDDDSPSRGGRQIKPGRHSTVETVVRNENRGLRDSSKASTSEGSGSS 477

Query:   474 XXKGGASASRENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKL 533
               K G   ++ENEYKKGLRP+LWLS  FPLQT+ELLPLLDILANKVKAIRRLREL+TTKL
Sbjct:   478 KRKEG---NKENEYKKGLRPVLWLSERFPLQTKELLPLLDILANKVKAIRRLRELMTTKL 534

Query:   534 PMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAV-TQSSS- 591
             P GTFPVKVAIPV+PTIRVLVTFTKFEEL+ ++DEF TPPSSPT++ + SP   TQSSS 
Sbjct:   535 PSGTFPVKVAIPVIPTIRVLVTFTKFEELEAIEDEFVTPPSSPTSSVKNSPREETQSSSN 594

Query:   592 --SSWFQWIKGPYSRPSSTAVGSSSRI---ENIQDPFAIPQDYTWITAE 635
               SSWFQWIK P  RPS+++      I   EN QDPFAIP+ Y WITAE
Sbjct:   595 PSSSWFQWIKTPSQRPSTSSSSGGFNIGKAENDQDPFAIPRGYNWITAE 643
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2093741 AT3G24210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100900 AT3G04470 "AT3G04470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036863 AT1G62050 "AT1G62050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2144501 Ankrd13b "ankyrin repeat domain 13b" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6U9 ANKRD13C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWB4 ANKRD13C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3892 ankrd13c "ankyrin repeat domain 13C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1595074 Ankrd13c "ankyrin repeat domain 13C" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2139746 Ankrd13c "ankyrin repeat domain 13c" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query655
pfam11904290 pfam11904, GPCR_chapero_1, GPCR-chaperone 1e-86
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.003
>gnl|CDD|221304 pfam11904, GPCR_chapero_1, GPCR-chaperone Back     alignment and domain information 
 Score =  272 bits (697), Expect = 1e-86
 Identities = 131/449 (29%), Positives = 177/449 (39%), Gaps = 162/449 (36%)

Query: 186 RADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAM 245
           R D TLAGFDG + QR D+S +F G+ S+ G     SL  + H DKEV NAL+       
Sbjct: 1   RVDTTLAGFDGMKWQRGDRSFLFKGEESDAG-----SLIEVDHDDKEVYNALEELS---- 51

Query: 246 EEEIRQEVAAMSQTNIFRPGIDVTQAVLLPQ---LTWRRQEKTEMVGAWKAKVYDMHNVV 302
           + E  +EVAA+  + I   G+D TQ         L WRR EKTE VG ++AKVYD  NV 
Sbjct: 52  DAEEDEEVAALLTSPIVSTGLDTTQIGFERSKSILGWRRSEKTETVGGYEAKVYDASNVE 111

Query: 303 VSIKSRRVPGAMSDDEFFSSCNENETESEDLNDILTEDERRQLEVALKLDSSEMSNENGD 362
           +  K+R                          + L+E+++++L+       S +  E   
Sbjct: 112 LITKTRS-------------------------EHLSEEDQQKLKSGKTSLGSGLGAEQ-- 144

Query: 363 GIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEGPKKIAPPRSSLS 422
                                   +G     +             P      AP  ++L+
Sbjct: 145 ------------------------DGGPTSRQ------------GPVEQSATAPNPTALT 168

Query: 423 VDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKETRTSTSVSSESGHRRKGGASAS 482
            +E             ++K GR                             R K      
Sbjct: 169 PEEYFKP-------EFKLKKGRD--------------------------IGRPK------ 189

Query: 483 RENEYKKGLRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKV 542
            E+E KK  +  LWLS +FPL  E+LLP+LD+LANK K  RRLRE +TTKLP G FPVK+
Sbjct: 190 EESEKKKKFKATLWLSEDFPLSLEQLLPILDLLANKNKHFRRLREFVTTKLPPG-FPVKI 248

Query: 543 AIPVVPTIRVLVTFTKFEELQPVDDEFATPPSSPTAAGRESPAVTQSSSSSWFQWIKGPY 602
            IP+ PTI  +VTFT FEEL   ++E                                  
Sbjct: 249 EIPLFPTINAVVTFTNFEELDAAEEE---------------------------------- 274

Query: 603 SRPSSTAVGSSSRIENIQDPFAIPQDYTW 631
                         E  +DPF IP  Y W
Sbjct: 275 -------------CEIDEDPFDIPSGYRW 290

This domain, and the associated ANK family repeat pfam00023 domain, together act as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2. Length = 290
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 655
KOG0522560 consensus Ankyrin repeat protein [General function 100.0
PF11904307 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR02183 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.81
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.75
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.74
PHA02741169 hypothetical protein; Provisional 99.67
PHA02859209 ankyrin repeat protein; Provisional 99.66
PHA02791284 ankyrin-like protein; Provisional 99.64
PHA02791284 ankyrin-like protein; Provisional 99.63
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.63
PHA02875413 ankyrin repeat protein; Provisional 99.63
KOG0514452 consensus Ankyrin repeat protein [General function 99.62
PHA02878477 ankyrin repeat protein; Provisional 99.62
PHA02874434 ankyrin repeat protein; Provisional 99.6
PHA02875413 ankyrin repeat protein; Provisional 99.6
PHA02878477 ankyrin repeat protein; Provisional 99.59
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.59
PHA02736154 Viral ankyrin protein; Provisional 99.58
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.58
PHA02874434 ankyrin repeat protein; Provisional 99.58
PHA02743166 Viral ankyrin protein; Provisional 99.57
PHA02884300 ankyrin repeat protein; Provisional 99.57
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.57
PHA03095471 ankyrin-like protein; Provisional 99.56
PHA02743166 Viral ankyrin protein; Provisional 99.56
PHA03100480 ankyrin repeat protein; Provisional 99.55
PHA03095471 ankyrin-like protein; Provisional 99.54
PHA02859209 ankyrin repeat protein; Provisional 99.54
PHA02946446 ankyin-like protein; Provisional 99.53
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.53
KOG0508615 consensus Ankyrin repeat protein [General function 99.52
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.51
PHA02946446 ankyin-like protein; Provisional 99.51
PHA02798489 ankyrin-like protein; Provisional 99.51
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.51
PHA02736154 Viral ankyrin protein; Provisional 99.5
PHA03100480 ankyrin repeat protein; Provisional 99.5
PLN03192823 Voltage-dependent potassium channel; Provisional 99.5
PHA02989494 ankyrin repeat protein; Provisional 99.49
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.48
PHA02798489 ankyrin-like protein; Provisional 99.48
PHA02795437 ankyrin-like protein; Provisional 99.48
PLN03192823 Voltage-dependent potassium channel; Provisional 99.48
PHA02741169 hypothetical protein; Provisional 99.47
PHA02876682 ankyrin repeat protein; Provisional 99.47
PHA02989494 ankyrin repeat protein; Provisional 99.47
PHA02876682 ankyrin repeat protein; Provisional 99.46
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.45
KOG0510929 consensus Ankyrin repeat protein [General function 99.44
PHA02884300 ankyrin repeat protein; Provisional 99.42
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.41
KOG0508615 consensus Ankyrin repeat protein [General function 99.41
KOG0510929 consensus Ankyrin repeat protein [General function 99.4
TIGR00870743 trp transient-receptor-potential calcium channel p 99.39
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.38
PHA02917661 ankyrin-like protein; Provisional 99.38
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.37
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.37
PHA02730672 ankyrin-like protein; Provisional 99.36
PHA02917661 ankyrin-like protein; Provisional 99.35
PHA02795437 ankyrin-like protein; Provisional 99.35
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.34
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
KOG0514452 consensus Ankyrin repeat protein [General function 99.28
TIGR00870743 trp transient-receptor-potential calcium channel p 99.28
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.28
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.27
PHA02730672 ankyrin-like protein; Provisional 99.26
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.22
PHA02792631 ankyrin-like protein; Provisional 99.21
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.21
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.19
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.19
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.19
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.14
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.07
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.07
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.04
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.04
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.04
PHA02792631 ankyrin-like protein; Provisional 99.02
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.02
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.96
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 98.94
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 98.94
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.91
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.75
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.69
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.67
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.63
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.6
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.49
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.46
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.44
PF1360630 Ank_3: Ankyrin repeat 98.42
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.36
KOG2384223 consensus Major histocompatibility complex protein 98.19
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.17
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.15
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.94
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.81
PF1360630 Ank_3: Ankyrin repeat 97.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.59
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.39
KOG0818669 consensus GTPase-activating proteins of the GIT fa 97.37
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.26
KOG0511516 consensus Ankyrin repeat protein [General function 97.26
KOG0522560 consensus Ankyrin repeat protein [General function 97.2
KOG0511516 consensus Ankyrin repeat protein [General function 97.16
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 96.97
KOG0520975 consensus Uncharacterized conserved protein, conta 96.94
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.47
KOG2384223 consensus Major histocompatibility complex protein 96.45
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.35
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 95.94
KOG0520975 consensus Uncharacterized conserved protein, conta 95.8
KOG2505591 consensus Ankyrin repeat protein [General function 94.98
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 93.84
KOG2505591 consensus Ankyrin repeat protein [General function 92.35
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-119  Score=968.11  Aligned_cols=502  Identities=40%  Similarity=0.636  Sum_probs=416.9

Q ss_pred             hHHHHHHHcCCHHHHHHHHhcCCCCCCchhhhhhhhHhHHHHhhhhccccccccCCCCCCcHHHHHHHcCChhHHHHHHh
Q 006231           12 SPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLMV   91 (655)
Q Consensus        12 TPLH~Aa~~Gd~~~Lk~LL~~~p~l~dp~~i~te~~saa~e~~~~~igA~In~kD~p~G~TPLHlAv~~G~le~VklLL~   91 (655)
                      .|||++++..+.+.+..+|...                        ++..|+.+|. .|+||||+||++||.++++.||.
T Consensus        22 ~~lh~~~~~~~~~sl~~el~~~------------------------~~~~id~~D~-~g~TpLhlAV~Lg~~~~a~~Ll~   76 (560)
T KOG0522|consen   22 KPLHWAVVTTDSDSLEQELLAK------------------------VSLVIDRRDP-PGRTPLHLAVRLGHVEAARILLS   76 (560)
T ss_pred             cccchhhhccchhhHHHHHhhh------------------------hhceeccccC-CCCccHHHHHHhcCHHHHHHHHh
Confidence            5699999999998888776541                        2456999996 99999999999999999999999


Q ss_pred             cCCCCcccCCCCCChHHHHHHcCCHHHHHHHHHhcCChhHhhhcCCcchHHHHHhhcchhhhhhcccccccchhhhhccC
Q 006231           92 AGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRRMRDFYMEITFNFESSVIPFISRIA  171 (655)
Q Consensus        92 ~GADvn~~n~~G~TpLh~A~~~G~~eIV~lLL~~ga~~~~~d~~g~tPl~lAaL~~~~DFy~Elkwef~SswvPlvSri~  171 (655)
                      +|||+.++|++||+|||+|+++|+.+++..+++++....+..+..+.|.+++++.+++||||||+|+|+| |||||||+|
T Consensus        77 a~Adv~~kN~~gWs~L~EAv~~g~~q~i~~vlr~~~~q~~~~~~~~~p~ll~~l~~~~DFYmE~~wdF~S-WvPlvSrI~  155 (560)
T KOG0522|consen   77 AGADVSIKNNEGWSPLHEAVSTGNEQIITEVLRHLKYQAWEKWERRLPRLLAKLSEMPDFYMEMKWDFQS-WIPLLSRIL  155 (560)
T ss_pred             cCCCccccccccccHHHHHHHcCCHHHHHHHHHHhHHHHHHHHHhcchHHHHHHHhCccceEEEEeccee-ehhhhhccC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999997 999999999


Q ss_pred             CCchhhhhccCcccccccccccccCcccccccceEEEecCCCCCCCCCCCCeeEEecCCceeeeecccCCCCCCHHHHHH
Q 006231          172 PSDTYKIWKRGANLRADMTLAGFDGFRIQRSDQSIIFLGDGSEDGKIPSGSLCMISHKDKEVMNALDGAGAPAMEEEIRQ  251 (655)
Q Consensus       172 PsDt~rI~K~G~~lR~DtTLvgF~~~~~~Rg~~S~IF~g~~~~~~~~~~~~l~~ldh~~k~v~~~l~~~~~~~~e~~v~~  251 (655)
                      |||+|+|||+|++||+||||+||++|+|+|||+||||+|++     . ++++|+||||+|+|++.+++++.+++|.++++
T Consensus       156 PSD~~kIyK~G~~lR~DTTL~gF~~m~wqRGd~SFlF~gd~-----~-~~e~lvl~hdek~v~~~~~r~~~e~se~~~~~  229 (560)
T KOG0522|consen  156 PSDTCKIYKRGSSLRADTTLAGFEGMKWQRGDQSFLFRGDA-----N-PAELLVLDHDEKVVTNAFQRLRDEESEAEMEE  229 (560)
T ss_pred             chhhHHHhhcccceeeeeeeecCCCceEEecceEEEEecCC-----C-cceeEEEeccchhhHHHHHhcccccchhhhHH
Confidence            99999999999999999999999999999999999999996     2 58999999999999999999999999999999


Q ss_pred             HHHhhccCcccccceeeeeeee-cccccccccccccccCCeeeEEEEeeccEEEEEEeeCCCCCCchhhhcccCCCcccc
Q 006231          252 EVAAMSQTNIFRPGIDVTQAVL-LPQLTWRRQEKTEMVGAWKAKVYDMHNVVVSIKSRRVPGAMSDDEFFSSCNENETES  330 (655)
Q Consensus       252 ~v~~~~~t~i~~~~i~~~~~~~-~~~~gW~r~~k~E~Vg~~~akvy~~~~v~~~~r~R~~~~~l~~e~~~~~~~~~~~~~  330 (655)
                      +|+.+|+++|+++++|++.+.| .+++||+|++|+|+||||+||||+|+||+|+||+|||  |||+|++.++..      
T Consensus       230 eVd~~ls~~i~~t~l~tktiaF~~~~~gWrr~ek~E~Vg~y~akvY~v~nv~l~tk~Rre--HLs~ed~~r~~~------  301 (560)
T KOG0522|consen  230 EVDVRLSQDILYTPLDTKTIAFERGFLGWRRQEKTETVGGYKAKVYDVSNVHLSTKKRRE--HLSEEDEKRVIE------  301 (560)
T ss_pred             HHHHHhcCcceeccccchhHHHHHhhhhhhhhchhhhccCeeeeEEeecceEEEEeeccc--ccchHHHhhhhh------
Confidence            9999999999999999887654 6899999899999999999999999999999999999  888887765221      


Q ss_pred             ccccccccHHHHHHHHHHhhhccccCCCCCCCCcccccccCcccccccccccccCCCCccccccccccCCCccCCCCCCC
Q 006231          331 EDLNDILTEDERRQLEVALKLDSSEMSNENGDGIIAHRHSCYEHREIPVEEVNGRRNGETKQEKKGWFGGWRKKDSKPEG  410 (655)
Q Consensus       331 ~~~~~~L~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  410 (655)
                         ...++..|++ +-++..++...           ....|              .++...++                 
T Consensus       302 ---~~~~~~~es~-~~~~~~~~~~~-----------~~~~~--------------~~r~l~~~-----------------  335 (560)
T KOG0522|consen  302 ---EAQLTPLESN-LLSIKETMFGP-----------KTAEC--------------ANRDLYTS-----------------  335 (560)
T ss_pred             ---hccCChhhhh-hhhhhhhcCCC-----------ccccc--------------cccchhhc-----------------
Confidence               1123333332 22222211110           00000              11111111                 


Q ss_pred             CCCCCCCCCCCccchhhccccCCCCCCCCCCCCCCccccccccccccCCccccccccccCCCCccCCCCCcccchhhccc
Q 006231          411 PKKIAPPRSSLSVDEKVSDLLGDSPSGNQIKPGRHSVEIVARDDHRRGKETRTSTSVSSESGHRRKGGASASRENEYKKG  490 (655)
Q Consensus       411 ~~~~~p~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~ey~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~  490 (655)
                               +++          ++|.  .++    +.+|+.+.....|++.||+++                 +++++|+
T Consensus       336 ---------sls----------~~pt--~i~----p~~~~~~~~a~~g~~~GR~~~-----------------~k~~~k~  373 (560)
T KOG0522|consen  336 ---------SLS----------APPT--AIT----PPEYENYEGALIGKDPGRPKE-----------------EKEKKKK  373 (560)
T ss_pred             ---------ccC----------CCcc--cCC----CCcccccccccccCCCCCchh-----------------hhhhhhh
Confidence                     010          0010  011    234455566778888877653                 3467899


Q ss_pred             ccceeeecCCCCcccccchhhHHHhhhchHHHHHHHhHhhhcCCCCCCceEEEccceeeEEEEEEeccccccCCCCCCCc
Q 006231          491 LRPILWLSPNFPLQTEELLPLLDILANKVKAIRRLRELLTTKLPMGTFPVKVAIPVVPTIRVLVTFTKFEELQPVDDEFA  570 (655)
Q Consensus       491 ~ra~lwls~~fPL~~e~llpildi~a~~~k~~~kLrefit~klP~G~FPVKi~IPl~pti~a~iTF~~f~~~~~~~~~f~  570 (655)
                      |||+|||||||||++|||||||||||+.+|||+||||||||||||| |||||||||||||+|+|||+||++++|++++|+
T Consensus       374 fkA~lwmseefPLsldqllpildlmA~~~khf~rLReFitlkLPpG-FPVKieIPi~~tv~a~vTFqkf~~~~~i~~~~~  452 (560)
T KOG0522|consen  374 FKATLWMSEEFPLSLDQLLPILDLMANPSKHFARLREFITLKLPPG-FPVKIEIPIFPTVTAVVTFQKFESLDPIDDENV  452 (560)
T ss_pred             hhhheeecccCCccHHHHHHHHHHHcccHHHHHHHHHHHhhcCCCC-CceeEeecccceEEEEEEeeccccCCCCccccc
Confidence            9999999999999999999999999998999999999999999999 999999999999999999999999999999999


Q ss_pred             CCCCCC-CccCCC-CC-CCCCCCCccchhhhcCCCCCCCCCCcCCCCcccccCCCcccCCCCeeeehHHHHHhhhhh
Q 006231          571 TPPSSP-TAAGRE-SP-AVTQSSSSSWFQWIKGPYSRPSSTAVGSSSRIENIQDPFAIPQDYTWITAEAKKKKMQDK  644 (655)
Q Consensus       571 ~p~~~~-~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  644 (655)
                      ||+||+ ....+- .. ...+.++-||.+|++.-  ++.+.+.....+|+..+|||+||++|+|.+-.+++.|++.|
T Consensus       453 tipss~~~E~~~d~~r~~d~~~~s~s~~~~~~~~--~~~~n~~~~~~~yq~~~d~sl~ps~~~~~~~~~~~~r~~s~  527 (560)
T KOG0522|consen  453 TIPSSYGYEIDDDVRRFQDLDRSSRSNRSWVRSA--RGLGNSYSDDMLYQYAIDPSLLPSTYKWPSSAQSYVRISSK  527 (560)
T ss_pred             cCCccccccccccccccccccccccccHhhhccc--ccCCCCCCchhhhhhhcCcccCCCcccCCCchhhccccccc
Confidence            999999 332221 11 14455566999999933  44444445667899999999999999999999887777653

>PF11904 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR021832 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query655
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-04
2rfa_A232 Transient receptor potential cation channel subfa 6e-04
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
 Score = 49.6 bits (118), Expect = 1e-06
 Identities = 20/107 (18%), Positives = 42/107 (39%), Gaps = 1/107 (0%)

Query: 5   DVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDR 64
             +KY    +   I  +    ++          N      + + L   +    I+  ++ 
Sbjct: 219 AAAKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNA 278

Query: 65  RDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAI 111
           +D  N DT L++A +LG+ +  + L+  GAD  + N+ G   +    
Sbjct: 279 QDS-NGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 324
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query655
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.8
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.8
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.8
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.78
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.78
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.77
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.77
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.76
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.76
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.76
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.76
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.75
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.75
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.75
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.75
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.75
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.75
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.75
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.75
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.74
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.74
2etb_A256 Transient receptor potential cation channel subfam 99.74
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.74
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.74
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.73
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.73
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.73
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.73
2rfa_A232 Transient receptor potential cation channel subfa 99.73
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.73
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.72
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.72
3hra_A201 Ankyrin repeat family protein; structural protein; 99.72
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.72
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.72
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.72
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.72
2etb_A256 Transient receptor potential cation channel subfam 99.71
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.71
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.71
2rfa_A232 Transient receptor potential cation channel subfa 99.71
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.71
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.71
2pnn_A273 Transient receptor potential cation channel subfa 99.71
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.7
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.7
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.7
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.7
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.7
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.7
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.7
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.69
2pnn_A273 Transient receptor potential cation channel subfa 99.69
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.69
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.69
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.69
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.68
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.68
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.68
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.68
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.68
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.68
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.68
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.68
3hra_A201 Ankyrin repeat family protein; structural protein; 99.68
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.68
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.67
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.67
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.67
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.67
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.66
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.66
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.66
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.65
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.65
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.65
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.65
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.64
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.64
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.63
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.62
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.62
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.62
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.62
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.61
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.61
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.61
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.61
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.61
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.61
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.59
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.59
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.59
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.59
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.58
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.56
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.55
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.55
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.54
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.53
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.52
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.44
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.44
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.41
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.4
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.3
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.84  E-value=1.3e-20  Score=180.60  Aligned_cols=113  Identities=19%  Similarity=0.299  Sum_probs=98.5

Q ss_pred             CCCChHHHHHHHcCCHHHHHHHHhcCCCCCCchhhhhhhhHhHHHHhhhhccccccccCCCCCCcHHHHHHHcCChhHHH
Q 006231            8 KYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATE   87 (655)
Q Consensus         8 k~G~TPLH~Aa~~Gd~~~Lk~LL~~~p~l~dp~~i~te~~saa~e~~~~~igA~In~kD~p~G~TPLHlAv~~G~le~Vk   87 (655)
                      ..|.||||+|+..++.++++.||+.                          |++++.+|. .|+||||+||..|+.++|+
T Consensus        35 ~~g~t~l~~a~~~~~~~~~~~ll~~--------------------------gad~~~~d~-~g~TpLh~A~~~g~~~~v~   87 (169)
T 4gpm_A           35 SDGRTPLHHAAENGHKEVVKLLISK--------------------------GADVNAKDS-DGRTPLHHAAENGHKEVVK   87 (169)
T ss_dssp             TTSCCHHHHHHHTTCHHHHHHHHHT--------------------------TCCTTCCCT-TSCCHHHHHHHTTCHHHHH
T ss_pred             CCCCCHHHHHHHcCCHHHHHHHHhc--------------------------ccchhhhcc-CCCCHHHHHHHcCCHHHHH
Confidence            4456666666666666666666554                          577999997 9999999999999999999


Q ss_pred             HHHhcCCCCcccCCCCCChHHHHHHcCCHHHHHHHHHhcCChhHhhhcCCcchHHHHHhh
Q 006231           88 MLMVAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGTMRR  147 (655)
Q Consensus        88 lLL~~GADvn~~n~~G~TpLh~A~~~G~~eIV~lLL~~ga~~~~~d~~g~tPl~lAaL~~  147 (655)
                      +||++|+|+|.+|..|+||||+|+..|+.+++++|++++++++..+..|+||+++|+...
T Consensus        88 ~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g  147 (169)
T 4gpm_A           88 LLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHG  147 (169)
T ss_dssp             HHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTT
T ss_pred             HHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcC
Confidence            999999999999999999999999999999999999999999999999999999998543
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 655
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.003
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Swi6 ankyrin-repeat fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 53.9 bits (128), Expect = 2e-08
 Identities = 20/107 (18%), Positives = 42/107 (39%), Gaps = 1/107 (0%)

Query: 5   DVSKYAHSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDR 64
             +KY    +   I  +    ++          N      + + L   +    I+  ++ 
Sbjct: 195 AAAKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNA 254

Query: 65  RDVPNRDTPLHLAVKLGDETATEMLMVAGADWSLQNEQGWSALQEAI 111
           +D  N DT L++A +LG+ +  + L+  GAD  + N+ G   +    
Sbjct: 255 QDS-NGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 300
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query655
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.72
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.7
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.69
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.69
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.69
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.67
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.66
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.66
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.64
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.63
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.63
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.62
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.61
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.6
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.6
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.59
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.59
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.57
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.57
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.56
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.56
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.55
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.54
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.52
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.51
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.49
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.47
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.42
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.41
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.34
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.08
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.80  E-value=1.6e-20  Score=167.13  Aligned_cols=107  Identities=15%  Similarity=0.137  Sum_probs=101.9

Q ss_pred             ChHHHHHHHcCCHHHHHHHHhcCCCCCCchhhhhhhhHhHHHHhhhhccccccccCCCCCCcHHHHHHHcCChhHHHHHH
Q 006231           11 HSPVHKAIAMRDYPSLRRLLAGLPRLSNPAEIRTEMASLAEEEKADAISAAIDRRDVPNRDTPLHLAVKLGDETATEMLM   90 (655)
Q Consensus        11 ~TPLH~Aa~~Gd~~~Lk~LL~~~p~l~dp~~i~te~~saa~e~~~~~igA~In~kD~p~G~TPLHlAv~~G~le~VklLL   90 (655)
                      .|||++||.+|+.++++.||+.                          |++++.+|. .|+||||+|+..|+.+++++|+
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~--------------------------g~d~n~~~~-~g~t~lh~A~~~~~~~~~~~ll   55 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAK--------------------------GEDVNRTLE-GGRKPLHYAADCGQLEILEFLL   55 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTT--------------------------TCCCCCCSS-SSCCTTHHHHHHSTTTHHHHHH
T ss_pred             ChHHHHHHHCCCHHHHHHHHHh--------------------------hhccccccc-cccccccccccccccccccccc
Confidence            4899999999999999999987                          456899997 9999999999999999999999


Q ss_pred             hcCCCCcccCCCCCChHHHHHHcCCHHHHHHHHHhcCChhHhhhcCCcchHHHH
Q 006231           91 VAGADWSLQNEQGWSALQEAICSREEGIAMIIVRHYQPLAWAKWCRRLPRLVGT  144 (655)
Q Consensus        91 ~~GADvn~~n~~G~TpLh~A~~~G~~eIV~lLL~~ga~~~~~d~~g~tPl~lAa  144 (655)
                      .+|++++.+|..|+||||+|+..|+.+++++|+++|++++..+..|.||+++|.
T Consensus        56 ~~g~din~~d~~g~tpLh~A~~~~~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~  109 (118)
T d1myoa_          56 LKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATD  109 (118)
T ss_dssp             HSSCTTTCCSSSCSCHHHHHHTTTCCHHHHHHHTTCCCSSSSSSSTCCCCCTCS
T ss_pred             cccceeeecccccccchhhhhhcCchhhhhhhhcccccceeeCCCCCCHHHHHh
Confidence            999999999999999999999999999999999999999999999999999874
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure