Citrus Sinensis ID: 006254

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650---
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCGEEW
cccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEcccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEcccccccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHHccccccccEEEccccHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHc
cccccccccHHcccccccccccccccccccccccccHHHccccccccccccccccccEEEEEEEEEEEEEccccccEccccccccccccccccEEEEEcHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccEEEccccccccccccHHccHHHHHHHHccccccccEEEEEccEEEEccccccccEEEEEcHHHHHHccccEEcccHHHHHcccEEEEEHHHHcHHHHHHHHHHHHHccccEEEEccEEEEcccEEEEEEcccccccccHHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccccEEcccccccccccEEEHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccc
MAFSSTITTTVSSAASTSLSHLQQSCSvvsslklhpllfsyspppffkfrtrpkhhrffhvrasssnatldsangavaaasedqdsygrqffplaAVVGQDAIKTALLLGAIDReiggiaisgrrgtAKTVMARglhailppieVVVGsianadptcpdewedgldekaeydtagnlktqiarspfvqiplgvtedrligsvdveesvktgttvfqpgllaeahrgvlyideINLLDEGISNLLLNVLTEGVniveregisfkhpckplliatynpeegvvREHLLDRIAInlsadlpmtfEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVIlprsiinetppeqqnqqpppppppqnqdsgeeeqneeedqedendeENEQQQeqlpeefifdaegglvdeKLLFFAQQAQRRrgkagraknvifsedrgryikpmlpkgpikrlAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESytcrdqvsiipfrgdsaevllppsrSIAMARKRLerlpcgggsplahglsmgwakcgeew
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVrasssnatlDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDreiggiaisgrrgTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNlktqiarspfvqiplgvtEDRLIGSVDVEESVKtgttvfqpgllaeaHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVERegisfkhpckPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALegrekvnvddlkKAVELVILPRSIINEtppeqqnqqpppPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAqrrrgkagraknvifsedrgryikpmlpkgpikrlavdATLRaaapyqklrrerdtqktrkvfvektdmrakrmarkagaLVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIpfrgdsaevllpPSRSIAMARKRLERLPCgggsplahglsmgwAKCGEEW
MAFsstitttvssaastslshlqqsCSVVSSLKLHpllfsyspppffkfrtrpkHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETppeqqnqqpppppppqnqdsgeeeqneeedqedendeeneqqqeqlpeeFIFDAEGGLVDEKLLFFaqqaqrrrgkagrakNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDmrakrmarkaGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCGEEW
*************************CSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHV*************************YGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSII****************************************************FIFDAEGGLVDEKLLFFAQQA*********AKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAA****************************MARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLL*****************C******AHGLSMGW*******
*******************************************************************************************FPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAE**T*****TQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVIL********************************************************************************************************************ATLRAAAPYQKL************FVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCGEEW
**************************SVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLD************QDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET********************************************QLPEEFIFDAEGGLVDEKLLFFAQQ**********AKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCGEEW
*******************************LKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGA***********GRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSI************************************************************GLVDEKLLFFAQQAQRR*******KNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNR*QNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSxxxxxxxxxxxxxxxxxxxxxxxxxLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMGWAKCGEEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query653 2.2.26 [Sep-21-2011]
O22437 754 Magnesium-chelatase subun N/A no 0.950 0.823 0.791 0.0
Q9SJE1 760 Magnesium-chelatase subun yes no 0.903 0.776 0.814 0.0
O24133 758 Magnesium-chelatase subun N/A no 0.940 0.810 0.753 0.0
Q6ATS0 754 Magnesium-chelatase subun yes no 0.898 0.778 0.824 0.0
B8AMB8 754 Magnesium-chelatase subun N/A no 0.898 0.778 0.824 0.0
P72772 676 Magnesium-chelatase subun N/A no 0.836 0.807 0.611 0.0
O07345 677 Magnesium-chelatase subun yes no 0.834 0.805 0.609 1e-179
Q9ZGE6 666 Magnesium-chelatase 67 kD N/A no 0.833 0.816 0.451 1e-120
Q93SW0620 Magnesium-chelatase 67 kD yes no 0.747 0.787 0.366 2e-81
O50313619 Magnesium-chelatase 67 kD yes no 0.761 0.802 0.367 5e-78
>sp|O22437|CHLD_PEA Magnesium-chelatase subunit ChlD, chloroplastic OS=Pisum sativum GN=CHLD PE=2 SV=1 Back     alignment and function desciption
 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/633 (79%), Positives = 549/633 (86%), Gaps = 12/633 (1%)

Query: 18  SLSHLQQSCSVVS-SLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGA 76
           SL+H   + +  +  L+ H LL     PP F  +     H  F  + +       S NGA
Sbjct: 4   SLTHTPHTTASPNLQLRFHSLL-----PPSFTSQPFLSLHSTFPPKRTVPKLRAQSENGA 58

Query: 77  VAAASE---DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMA 133
           V  ASE   D  +YGRQ+FPLAAV+GQDAIKTALLLGA D  IGGIAISGRRGTAKT+MA
Sbjct: 59  VLQASEEKLDASNYGRQYFPLAAVIGQDAIKTALLLGATDPRIGGIAISGRRGTAKTIMA 118

Query: 134 RGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGV 193
           RG+HAILPPIEVV GSIANADP+CP+EWEDGL ++ EYD+ GN+KT I +SPFVQIPLGV
Sbjct: 119 RGMHAILPPIEVVQGSIANADPSCPEEWEDGLYKRVEYDSDGNVKTHIIKSPFVQIPLGV 178

Query: 194 TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVN 253
           TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLY+DEINLLDEGISNLLLNVLTEGVN
Sbjct: 179 TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTEGVN 238

Query: 254 IVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQ 313
           IVEREGISF+HPC+PLLIATYNP+EG VREHLLDRIAINLSADLPM+FE+RV AVGIAT+
Sbjct: 239 IVEREGISFRHPCRPLLIATYNPDEGSVREHLLDRIAINLSADLPMSFENRVEAVGIATE 298

Query: 314 FQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELY 373
           FQ+   +VFKMV+E+TD AKTQIILAREYLKDV I +EQLKYLV+EALRGG QGHRAELY
Sbjct: 299 FQDNCGQVFKMVDEDTDNAKTQIILAREYLKDVTISKEQLKYLVIEALRGGVQGHRAELY 358

Query: 374 AARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET---PPEQQNQQPPPPPPPQNQ 430
           AARVAKCLAALEGREKV VDDLKKAVELVILPRSII +T      Q    PPPP   ++ 
Sbjct: 359 AARVAKCLAALEGREKVYVDDLKKAVELVILPRSIITDTPPEQQNQPPPPPPPPQNQESN 418

Query: 431 DSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG 490
           +   EE+ +EE++ED+NDEENEQQQ+QLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG
Sbjct: 419 EEQNEEEEQEEEEEDDNDEENEQQQDQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG 478

Query: 491 RAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTD 550
           RAKNVIFSEDRGRYIKPMLPKGP+KRLAVDATLRAAAPYQKLRRE+DT+  RKV+VEKTD
Sbjct: 479 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDTENRRKVYVEKTD 538

Query: 551 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSA 610
           MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYT RDQVSIIPFRGDSA
Sbjct: 539 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDSA 598

Query: 611 EVLLPPSRSIAMARKRLERLPCGGGSPLAHGLS 643
           EVLLPPSRSIAMARKRLERLPCGGGSPLAHGL+
Sbjct: 599 EVLLPPSRSIAMARKRLERLPCGGGSPLAHGLT 631
Involved in chlorophyll biosynthesis; introduces a magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX.
Pisum sativum (taxid: 3888)
EC: 6EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q9SJE1|CHLD_ARATH Magnesium-chelatase subunit ChlD, chloroplastic OS=Arabidopsis thaliana GN=CHLD PE=2 SV=3 Back     alignment and function description
>sp|O24133|CHLD_TOBAC Magnesium-chelatase subunit ChlD, chloroplastic OS=Nicotiana tabacum GN=CHLD PE=2 SV=1 Back     alignment and function description
>sp|Q6ATS0|CHLD_ORYSJ Magnesium-chelatase subunit ChlD, chloroplastic OS=Oryza sativa subsp. japonica GN=CHLD PE=1 SV=1 Back     alignment and function description
>sp|B8AMB8|CHLD_ORYSI Magnesium-chelatase subunit ChlD, chloroplastic OS=Oryza sativa subsp. indica GN=CHLD PE=3 SV=1 Back     alignment and function description
>sp|P72772|CHLD_SYNY3 Magnesium-chelatase subunit ChlD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=chlD PE=3 SV=1 Back     alignment and function description
>sp|O07345|CHLD_SYNE7 Magnesium-chelatase subunit ChlD OS=Synechococcus elongatus (strain PCC 7942) GN=chlD PE=3 SV=2 Back     alignment and function description
>sp|Q9ZGE6|BCHD_HELMO Magnesium-chelatase 67 kDa subunit OS=Heliobacillus mobilis GN=bchD PE=3 SV=1 Back     alignment and function description
>sp|Q93SW0|BCHD_CHLTE Magnesium-chelatase 67 kDa subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=bchD PE=3 SV=1 Back     alignment and function description
>sp|O50313|BCHD_CHLP8 Magnesium-chelatase 67 kDa subunit OS=Chlorobaculum parvum (strain NCIB 8327) GN=bchD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
255544946 760 Magnesium-chelatase subunit chlD, chloro 0.970 0.834 0.836 0.0
224106223 786 predicted protein [Populus trichocarpa] 0.940 0.781 0.827 0.0
449444887748 PREDICTED: magnesium-chelatase subunit C 0.937 0.818 0.819 0.0
3913218 754 RecName: Full=Magnesium-chelatase subuni 0.950 0.823 0.791 0.0
30680676 760 magnesium-chelatase subunit chlD [Arabid 0.903 0.776 0.814 0.0
6664313 778 T27G7.20 [Arabidopsis thaliana] 0.903 0.758 0.807 0.0
413932686 755 hypothetical protein ZEAMMB73_644992 [Ze 0.908 0.785 0.811 0.0
242037661 755 hypothetical protein SORBIDRAFT_01g00386 0.880 0.761 0.835 0.0
413932685692 hypothetical protein ZEAMMB73_644992 [Ze 0.908 0.856 0.811 0.0
3913240 758 RecName: Full=Magnesium-chelatase subuni 0.940 0.810 0.753 0.0
>gi|255544946|ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] gi|223547442|gb|EEF48937.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/648 (83%), Positives = 581/648 (89%), Gaps = 14/648 (2%)

Query: 1   MAFSSTITT--TVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRF 58
           MAFS T  T  T+     TSLS LQ S   +   K H    S+  P     + RP  +R 
Sbjct: 1   MAFSPTAGTKFTLPYGVPTSLSQLQSSVLSIPCFKSHS--HSFKSP-----KRRPYSYRR 53

Query: 59  FHVRASSS-NATLDSANGAVAAASEDQD--SYGRQFFPLAAVVGQDAIKTALLLGAIDRE 115
           F V  SSS   TL S NGAV + S++ D  SYGRQ+FPLAAVVGQDAIKTALLLGAIDRE
Sbjct: 54  FGVIVSSSATPTLQSTNGAVVSPSQNPDSSSYGRQYFPLAAVVGQDAIKTALLLGAIDRE 113

Query: 116 IGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAG 175
           IGGIAISG+RGTAKTVMARGLHAILPPI+VVVGSIANADP+CP+EWEDGL E+ EYD+ G
Sbjct: 114 IGGIAISGKRGTAKTVMARGLHAILPPIDVVVGSIANADPSCPEEWEDGLAERVEYDSDG 173

Query: 176 NLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINL 235
           N+KT++ RSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLY+DEINL
Sbjct: 174 NIKTEVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINL 233

Query: 236 LDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSA 295
           LDEGISNLLLNVLTEGVNIVEREGISF+HPCKPLLIATYNPEEG VREHLLDRIAINLSA
Sbjct: 234 LDEGISNLLLNVLTEGVNIVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRIAINLSA 293

Query: 296 DLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKY 355
           DLPM FEDRVAAVGIATQFQE   EVFKMVEEET+ AKTQIILAREYLKDV + R+QLKY
Sbjct: 294 DLPMNFEDRVAAVGIATQFQEHCTEVFKMVEEETEFAKTQIILAREYLKDVTVSRDQLKY 353

Query: 356 LVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPE 415
           LV+EALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINE+PPE
Sbjct: 354 LVLEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINESPPE 413

Query: 416 QQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKL 475
           QQNQQPPPPPPPQNQD G+E+  EE   +++NDE+NEQQQ+Q+PEEFIFDAEGG VDEKL
Sbjct: 414 QQNQQPPPPPPPQNQDPGDEQNEEE--DQEDNDEDNEQQQDQIPEEFIFDAEGGFVDEKL 471

Query: 476 LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRE 535
           LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGP+KRLAVDATLRAAAPYQKLRRE
Sbjct: 472 LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRRE 531

Query: 536 RDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYT 595
           +DTQK+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAA+KLLAESYT
Sbjct: 532 KDTQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAIKLLAESYT 591

Query: 596 CRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLS 643
            RDQV+IIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGL+
Sbjct: 592 SRDQVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLT 639

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106223|ref|XP_002314091.1| predicted protein [Populus trichocarpa] gi|222850499|gb|EEE88046.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444887|ref|XP_004140205.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3913218|sp|O22437.1|CHLD_PEA RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; Flags: Precursor gi|2318117|gb|AAB72194.1| Mg-chelatase subunit D [Pisum sativum] Back     alignment and taxonomy information
>gi|30680676|ref|NP_563821.2| magnesium-chelatase subunit chlD [Arabidopsis thaliana] gi|148886934|sp|Q9SJE1.3|CHLD_ARATH RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; AltName: Full=Protein ALBINA 1; Flags: Precursor gi|17380694|gb|AAL36177.1| putative Mg-chelatase [Arabidopsis thaliana] gi|20259647|gb|AAM14341.1| putative Mg-chelatase [Arabidopsis thaliana] gi|110741163|dbj|BAE98674.1| Mg-chelatase like protein [Arabidopsis thaliana] gi|332190180|gb|AEE28301.1| magnesium-chelatase subunit chlD [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6664313|gb|AAF22895.1|AC006932_12 T27G7.20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413932686|gb|AFW67237.1| hypothetical protein ZEAMMB73_644992 [Zea mays] Back     alignment and taxonomy information
>gi|242037661|ref|XP_002466225.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor] gi|241920079|gb|EER93223.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|413932685|gb|AFW67236.1| hypothetical protein ZEAMMB73_644992 [Zea mays] Back     alignment and taxonomy information
>gi|3913240|sp|O24133.1|CHLD_TOBAC RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; Flags: Precursor gi|2239151|emb|CAA71128.1| CHLD magnesium chelatase subunit [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query653
TAIR|locus:2201796 760 ALB1 "ALBINA 1" [Arabidopsis t 0.540 0.464 0.830 2.9e-229
TAIR|locus:2005500424 CHLI1 [Arabidopsis thaliana (t 0.514 0.792 0.365 8e-53
TAIR|locus:2152405418 CHLI2 "magnesium chelatase i2" 0.505 0.789 0.380 5.6e-52
UNIPROTKB|Q4KAH8335 bchI "Magnesium chelatase, sub 0.385 0.752 0.322 1.2e-42
UNIPROTKB|P38022461 rocR "Arginine utilization reg 0.258 0.366 0.286 2.2e-06
UNIPROTKB|O69660358 moxR2 "Probable methanol dehyd 0.321 0.586 0.280 1.6e-05
UNIPROTKB|Q4K3V3497 PFL_6022 "Mg-chelatase subunit 0.105 0.138 0.364 2.4e-05
UNIPROTKB|Q605Y3485 MCA2139 "Mg chelatase-related 0.093 0.125 0.311 5.7e-05
TIGR_CMR|SPO_0402504 SPO_0402 "competence protein C 0.093 0.121 0.327 7.5e-05
UNIPROTKB|P71552459 Rv0958 "POSSIBLE MAGNESIUM CHE 0.292 0.416 0.268 0.00022
TAIR|locus:2201796 ALB1 "ALBINA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1507 (535.5 bits), Expect = 2.9e-229, Sum P(2) = 2.9e-229
 Identities = 298/359 (83%), Positives = 326/359 (90%)

Query:    59 FHVRASSSNATLDSANGAVAAASE-----DQDSYGRQFFPLAAVVGQDAIKTALLLGAID 113
             F VRAS+ NAT++S NG  A+ S+     D  SYGRQFFPLAAVVGQ+ IKTALLLGA+D
Sbjct:    46 FTVRASA-NATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIKTALLLGAVD 104

Query:   114 REIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDT 173
             REIGGIAISGRRGTAKTVMARGLH ILPPIEVVVGSI+NADP CPDEWED LDE+ EY+ 
Sbjct:   105 REIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDDLDERIEYNA 164

Query:   174 AGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEI 233
                +KT+I +SPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLAEAHRGVLY+DEI
Sbjct:   165 DNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLAEAHRGVLYVDEI 224

Query:   234 NLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINL 293
             NLLDEGISNLLLNVLT+GVNIVEREGISF+HPCKPLLIATYNPEEG VREHLLDR+AINL
Sbjct:   225 NLLDEGISNLLLNVLTDGVNIVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRVAINL 284

Query:   294 SADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQL 353
             SADLPM+FEDRVAAVGIATQFQER NEVF+MV EET+ AKTQIILAREYLKDV I REQL
Sbjct:   285 SADLPMSFEDRVAAVGIATQFQERCNEVFRMVNEETETAKTQIILAREYLKDVKISREQL 344

Query:   354 KYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET 412
             KYLV+EA+RGG QGHRAELYAARVAKCLAA+EGREKV +DDL+KAVELVILPRS ++ET
Sbjct:   345 KYLVLEAVRGGVQGHRAELYAARVAKCLAAIEGREKVTIDDLRKAVELVILPRSSLDET 403
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015979 "photosynthesis" evidence=IEA
GO:0015995 "chlorophyll biosynthetic process" evidence=IEA;TAS
GO:0016851 "magnesium chelatase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0010007 "magnesium chelatase complex" evidence=TAS
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009690 "cytokinin metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
TAIR|locus:2005500 CHLI1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152405 CHLI2 "magnesium chelatase i2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KAH8 bchI "Magnesium chelatase, subunit BchI" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|P38022 rocR "Arginine utilization regulatory protein RocR" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|O69660 moxR2 "Probable methanol dehydrogenase transcriptional regulatory protein MoxR2" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K3V3 PFL_6022 "Mg-chelatase subunits D/I family, ComM subfamily protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q605Y3 MCA2139 "Mg chelatase-related protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0402 SPO_0402 "competence protein ComM" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P71552 Rv0958 "POSSIBLE MAGNESIUM CHELATASE" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ATS0CHLD_ORYSJ6, ., 6, ., 1, ., 10.82490.89890.7785yesno
B8AMB8CHLD_ORYSI6, ., 6, ., 1, ., 10.82490.89890.7785N/Ano
O07345CHLD_SYNE76, ., 6, ., 1, ., 10.60930.83460.8050yesno
O22437CHLD_PEA6, ., 6, ., 1, ., 10.79140.95090.8236N/Ano
P72772CHLD_SYNY36, ., 6, ., 1, ., 10.61190.83610.8076N/Ano
Q9SJE1CHLD_ARATH6, ., 6, ., 1, ., 10.81450.90350.7763yesno
O24133CHLD_TOBAC6, ., 6, ., 1, ., 10.75330.94020.8100N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.6.1.10.991
3rd Layer6.6.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.0
TIGR02442633 TIGR02442, Cob-chelat-sub, cobaltochelatase subuni 0.0
COG1239423 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme 1e-111
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 2e-83
CHL00081350 CHL00081, chlI, Mg-protoporyphyrin IX chelatase 3e-70
TIGR02030337 TIGR02030, BchI-ChlI, magnesium chelatase ATPase s 1e-68
PRK13407334 PRK13407, bchI, magnesium chelatase subunit I; Pro 1e-61
COG1240261 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme 9e-48
cd01451178 cd01451, vWA_Magnesium_chelatase, Magnesium chelat 1e-40
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 4e-15
smart00327175 smart00327, VWA, von Willebrand factor (vWF) type 6e-12
pfam13519172 pfam13519, VWA_2, von Willebrand factor type A dom 6e-08
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) 8e-08
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 1e-07
cd01465170 cd01465, vWA_subgroup, VWA subgroup: Von Willebran 5e-07
cd01461171 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_int 5e-07
COG0606490 COG0606, COG0606, Predicted ATPase with chaperone 2e-06
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-06
COG1067647 COG1067, LonB, Predicted ATP-dependent protease [P 2e-05
TIGR00368499 TIGR00368, TIGR00368, Mg chelatase-related protein 3e-04
cd01466155 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Wille 6e-04
TIGR03788 596 TIGR03788, marine_srt_targ, marine proteobacterial 0.001
COG1221403 COG1221, PspF, Transcriptional regulators containi 0.001
PRK09862506 PRK09862, PRK09862, putative ATP-dependent proteas 0.002
TIGR03436 296 TIGR03436, acidobact_VWFA, VWFA-related Acidobacte 0.002
TIGR02903615 TIGR02903, spore_lon_C, ATP-dependent protease, Lo 0.002
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 0.004
PRK13765637 PRK13765, PRK13765, ATP-dependent protease Lon; Pr 0.004
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information 
 Score =  631 bits (1629), Expect = 0.0
 Identities = 257/549 (46%), Positives = 327/549 (59%), Gaps = 60/549 (10%)

Query: 101 DAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDE 160
           +  K AL L A+D  +GG+AI  R GT KT +AR L  ILPPI                 
Sbjct: 1   ERAKLALTLLAVDPSLGGVAIRARAGTGKTALARALAEILPPIM---------------- 44

Query: 161 WEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLL 220
                                   PFV++PLGVTEDRLIG +DVEES+  G  V QPGLL
Sbjct: 45  ------------------------PFVELPLGVTEDRLIGGIDVEESLAGGQRVTQPGLL 80

Query: 221 AEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGV 280
            EA RGVLY+D  NLLD+G+SN LL  L EGV IVEREGIS  HP K  LIATY+P EG 
Sbjct: 81  DEAPRGVLYVDMANLLDDGLSNRLLQALDEGVVIVEREGISVVHPAKFALIATYDPAEGG 140

Query: 281 --VREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIIL 338
             + +HLLDR+A+++S +   + + RV  V                + +E +L + QI  
Sbjct: 141 GGLPDHLLDRLALHVSLEDVASQDLRVEIVRRER------CNEVFRMNDELELLRGQIEA 194

Query: 339 AREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKA 398
           ARE L  V I  EQ+K LV+ A   G  GHRA+L+A R AK  AAL GR +V  +DLK A
Sbjct: 195 ARELLPQVTISAEQVKELVLTAASLGISGHRADLFAVRAAKAHAALHGRTEVTEEDLKLA 254

Query: 399 VELVILPRSIINETPPEQQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQL 458
           VELV+LPR+     P  Q    PPPPPP   +   EEE +E     D+ D ++ ++ +Q+
Sbjct: 255 VELVLLPRATRLPEPEPQP--PPPPPPPEPPE--PEEEPDEP----DQTDPDDGEETDQI 306

Query: 459 PEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPK-GPIKRL 517
           PEE +FDA    + + +L   Q  QRRRG   RA     S  RGR ++  L K G   R+
Sbjct: 307 PEELMFDAVEADLPDNILATLQTVQRRRG---RAGGEQKSNHRGRPLRSRLGKPGSGARV 363

Query: 518 AVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALN 577
            + ATLRAAAP+Q+LRRE +   TR + VE +D+R KR  RK+G L+IFVVDASGS A+ 
Sbjct: 364 DLVATLRAAAPWQRLRREENPAGTRGLIVEASDIRIKRYRRKSGRLLIFVVDASGSAAVA 423

Query: 578 RMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSP 637
           RM  AKGA   LL E+Y  RDQVS+I FRG +AEVLLPPSRS+  A++RL+ LP GGG+P
Sbjct: 424 RMSEAKGAVELLLGEAYVHRDQVSLIAFRGTAAEVLLPPSRSVEQAKRRLDVLPGGGGTP 483

Query: 638 LAHGLSMGW 646
           LA GL+  +
Sbjct: 484 LAAGLAAAF 492

This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria. Unlike subunit I (TIGR02030), this subunit is not found in archaea [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]. Length = 589
>gnl|CDD|233870 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|224160 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|177020 CHL00081, chlI, Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>gnl|CDD|131085 TIGR02030, BchI-ChlI, magnesium chelatase ATPase subunit I Back     alignment and domain information
>gnl|CDD|184036 PRK13407, bchI, magnesium chelatase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|224161 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238728 cd01451, vWA_Magnesium_chelatase, Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|222192 pfam13519, VWA_2, von Willebrand factor type A domain Back     alignment and domain information
>gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|238742 cd01465, vWA_subgroup, VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|238738 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>gnl|CDD|223679 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223994 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein Back     alignment and domain information
>gnl|CDD|238743 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|234353 TIGR03788, marine_srt_targ, marine proteobacterial sortase target protein Back     alignment and domain information
>gnl|CDD|224142 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional Back     alignment and domain information
>gnl|CDD|234208 TIGR03436, acidobact_VWFA, VWFA-related Acidobacterial domain Back     alignment and domain information
>gnl|CDD|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|237495 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 653
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 100.0
PRK13406584 bchD magnesium chelatase subunit D; Provisional 100.0
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 100.0
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 100.0
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 100.0
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 100.0
PRK13407334 bchI magnesium chelatase subunit I; Provisional 100.0
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.98
PRK09862506 putative ATP-dependent protease; Provisional 99.97
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 99.97
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.97
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.97
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.97
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.96
COG2204464 AtoC Response regulator containing CheY-like recei 99.96
smart00350509 MCM minichromosome maintenance proteins. 99.96
PRK13531498 regulatory ATPase RavA; Provisional 99.96
COG0714329 MoxR-like ATPases [General function prediction onl 99.92
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.91
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.9
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.9
PRK15424538 propionate catabolism operon regulatory protein Pr 99.9
COG1221403 PspF Transcriptional regulators containing an AAA- 99.9
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.9
PRK11608326 pspF phage shock protein operon transcriptional ac 99.89
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 99.89
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.88
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.87
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.87
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.87
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.86
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.86
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.85
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.84
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.84
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.83
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.83
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.83
COG1241682 MCM2 Predicted ATPase involved in replication cont 99.83
KOG0480764 consensus DNA replication licensing factor, MCM6 c 99.82
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.82
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.82
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.81
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.81
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.8
PRK13765637 ATP-dependent protease Lon; Provisional 99.78
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.78
PRK15115444 response regulator GlrR; Provisional 99.78
KOG0482721 consensus DNA replication licensing factor, MCM7 c 99.78
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.78
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.77
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.77
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.77
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.77
KOG0478804 consensus DNA replication licensing factor, MCM4 c 99.76
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.76
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.76
PF07726131 AAA_3: ATPase family associated with various cellu 99.75
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.74
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.73
KOG2028554 consensus ATPase related to the helicase subunit o 99.72
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.71
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.71
PRK03992389 proteasome-activating nucleotidase; Provisional 99.71
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.69
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.69
KOG0479818 consensus DNA replication licensing factor, MCM3 c 99.68
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.68
CHL00195489 ycf46 Ycf46; Provisional 99.68
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.67
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.67
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.66
KOG0477854 consensus DNA replication licensing factor, MCM2 c 99.66
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.66
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.66
CHL00176638 ftsH cell division protein; Validated 99.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.65
PHA02244383 ATPase-like protein 99.64
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.64
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.64
PRK13342413 recombination factor protein RarA; Reviewed 99.64
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.63
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.63
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.63
CHL00181287 cbbX CbbX; Provisional 99.62
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.62
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.62
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.61
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.6
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.6
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.6
PRK13341 725 recombination factor protein RarA/unknown domain f 99.59
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.59
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.59
KOG0481729 consensus DNA replication licensing factor, MCM5 c 99.58
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.58
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.58
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.58
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.57
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.57
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.57
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.55
PLN03025319 replication factor C subunit; Provisional 99.55
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.55
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.55
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.54
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.52
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.51
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.51
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.51
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.51
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.5
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.5
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.49
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.49
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.49
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.48
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.48
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.48
CHL00206 2281 ycf2 Ycf2; Provisional 99.48
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.47
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.47
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.47
PRK12402337 replication factor C small subunit 2; Reviewed 99.47
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.46
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.46
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.46
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.46
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.45
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.45
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 99.45
PTZ001121164 origin recognition complex 1 protein; Provisional 99.44
PRK10865857 protein disaggregation chaperone; Provisional 99.44
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.43
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.43
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.43
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.42
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.41
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.41
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.41
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.41
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.41
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.41
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.4
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.4
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.4
PRK00440319 rfc replication factor C small subunit; Reviewed 99.39
PRK08084235 DNA replication initiation factor; Provisional 99.39
PHA02544316 44 clamp loader, small subunit; Provisional 99.38
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.37
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.37
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.36
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.35
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.35
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.35
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.34
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.34
CHL00095 821 clpC Clp protease ATP binding subunit 99.34
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.34
PRK06893229 DNA replication initiation factor; Validated 99.33
PRK04195482 replication factor C large subunit; Provisional 99.33
CHL00095821 clpC Clp protease ATP binding subunit 99.33
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.32
PRK06620214 hypothetical protein; Validated 99.31
PRK08727233 hypothetical protein; Validated 99.3
PRK10865 857 protein disaggregation chaperone; Provisional 99.3
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.29
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.29
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.28
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.28
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 99.27
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.26
PF00004132 AAA: ATPase family associated with various cellula 99.26
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.25
PRK07940394 DNA polymerase III subunit delta'; Validated 99.24
PRK00149450 dnaA chromosomal replication initiation protein; R 99.23
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.23
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 99.21
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.21
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.2
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.2
PRK09087226 hypothetical protein; Validated 99.2
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.19
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.19
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.18
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 99.16
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.14
PRK13685 326 hypothetical protein; Provisional 99.14
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 99.14
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 99.13
PRK12422445 chromosomal replication initiation protein; Provis 99.13
PRK14086617 dnaA chromosomal replication initiation protein; P 99.12
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 99.11
COG1067647 LonB Predicted ATP-dependent protease [Posttransla 99.09
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 99.09
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.09
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.09
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.08
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.08
PRK14088440 dnaA chromosomal replication initiation protein; P 99.07
PRK09112351 DNA polymerase III subunit delta'; Validated 99.07
PRK14087450 dnaA chromosomal replication initiation protein; P 99.06
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 99.06
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 99.06
PRK05642234 DNA replication initiation factor; Validated 99.05
PRK07471365 DNA polymerase III subunit delta'; Validated 99.01
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 99.0
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 99.0
cd01470198 vWA_complement_factors Complement factors B and C2 99.0
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.99
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.98
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.97
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 98.96
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 98.96
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.95
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.95
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 98.94
PRK15455644 PrkA family serine protein kinase; Provisional 98.94
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 98.93
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.92
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 98.9
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 98.87
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 98.87
TIGR03436 296 acidobact_VWFA VWFA-related Acidobacterial domain. 98.86
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 98.84
COG0593408 DnaA ATPase involved in DNA replication initiation 98.83
PRK08058329 DNA polymerase III subunit delta'; Validated 98.8
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 98.8
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.78
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 98.77
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.75
COG4245 207 TerY Uncharacterized protein encoded in toxicity p 98.75
TIGR03788 596 marine_srt_targ marine proteobacterial sortase tar 98.75
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 98.73
PRK07399314 DNA polymerase III subunit delta'; Validated 98.73
PRK05564313 DNA polymerase III subunit delta'; Validated 98.71
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 98.68
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.67
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 98.66
PF13768155 VWA_3: von Willebrand factor type A domain 98.66
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.64
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.64
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.63
PRK04132846 replication factor C small subunit; Provisional 98.62
smart00382148 AAA ATPases associated with a variety of cellular 98.61
PRK10997487 yieM hypothetical protein; Provisional 98.61
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.61
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 98.58
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.56
PRK05707328 DNA polymerase III subunit delta'; Validated 98.55
PRK06964342 DNA polymerase III subunit delta'; Validated 98.55
cd01475 224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 98.55
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 98.51
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 98.5
COG2425437 Uncharacterized protein containing a von Willebran 98.5
PRK06871325 DNA polymerase III subunit delta'; Validated 98.5
PF05762222 VWA_CoxE: VWA domain containing CoxE-like protein; 98.48
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.45
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 98.43
PF00092178 VWA: von Willebrand factor type A domain; InterPro 98.42
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.4
PRK08699325 DNA polymerase III subunit delta'; Validated 98.4
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 98.37
PRK08769319 DNA polymerase III subunit delta'; Validated 98.35
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.3
PRK06090319 DNA polymerase III subunit delta'; Validated 98.29
PRK07993334 DNA polymerase III subunit delta'; Validated 98.26
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.24
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 98.23
PRK08116268 hypothetical protein; Validated 98.22
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.2
cd01460 266 vWA_midasin VWA_Midasin: Midasin is a member of th 98.19
COG1721416 Uncharacterized conserved protein (some members co 98.18
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.16
PRK12377248 putative replication protein; Provisional 98.15
PRK06526254 transposase; Provisional 98.1
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.06
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 98.04
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 98.04
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 97.94
KOG0736953 consensus Peroxisome assembly factor 2 containing 97.92
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.91
PRK08181269 transposase; Validated 97.9
PF13337457 Lon_2: Putative ATP-dependent Lon protease 97.88
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.85
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.83
TIGR02653675 Lon_rel_chp conserved hypothetical protein. This m 97.78
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.76
PRK07276290 DNA polymerase III subunit delta'; Validated 97.75
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.75
TIGR02877371 spore_yhbH sporulation protein YhbH. This protein 97.73
PF13173128 AAA_14: AAA domain 97.71
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.71
PRK09183259 transposase/IS protein; Provisional 97.68
PRK07952244 DNA replication protein DnaC; Validated 97.63
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.63
PRK10536262 hypothetical protein; Provisional 97.6
PRK06835329 DNA replication protein DnaC; Validated 97.59
PRK06921266 hypothetical protein; Provisional 97.59
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.58
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.56
COG2766649 PrkA Putative Ser protein kinase [Signal transduct 97.55
COG4867 652 Uncharacterized protein with a von Willebrand fact 97.52
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 97.52
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.49
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 97.47
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.46
PHA01747425 putative ATP-dependent protease 97.46
PF0188286 DUF58: Protein of unknown function DUF58; InterPro 97.44
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.34
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 97.3
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.28
PRK05325401 hypothetical protein; Provisional 97.27
PRK05917290 DNA polymerase III subunit delta'; Validated 97.26
PRK08939306 primosomal protein DnaI; Reviewed 97.22
PRK13695174 putative NTPase; Provisional 97.15
PRK05818261 DNA polymerase III subunit delta'; Validated 97.13
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.11
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.11
PF05729166 NACHT: NACHT domain 97.02
PRK14700300 recombination factor protein RarA; Provisional 96.99
PF09967126 DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 96.96
PF04285421 DUF444: Protein of unknown function (DUF444); Inte 96.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.81
COG3552395 CoxE Protein containing von Willebrand factor type 96.79
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.74
PHA02624647 large T antigen; Provisional 96.74
PF06707205 DUF1194: Protein of unknown function (DUF1194); In 96.71
PRK04296190 thymidine kinase; Provisional 96.69
KOG2353 1104 consensus L-type voltage-dependent Ca2+ channel, a 96.67
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 96.62
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.51
PRK07132299 DNA polymerase III subunit delta'; Validated 96.46
PHA02774613 E1; Provisional 96.42
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.41
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.39
PF04056193 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro 96.37
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.33
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.27
KOG2170344 consensus ATPase of the AAA+ superfamily [General 96.24
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.24
COG4930683 Predicted ATP-dependent Lon-type protease [Posttra 96.21
COG4088261 Predicted nucleotide kinase [Nucleotide transport 96.19
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.18
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 96.18
PRK05480209 uridine/cytidine kinase; Provisional 96.14
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 96.1
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.06
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.05
PRK08118167 topology modulation protein; Reviewed 96.04
PF13148378 DUF3987: Protein of unknown function (DUF3987) 96.04
COG1485367 Predicted ATPase [General function prediction only 95.98
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 95.97
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.94
COG4178604 ABC-type uncharacterized transport system, permeas 95.89
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.82
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.81
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.81
PTZ00301210 uridine kinase; Provisional 95.8
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.76
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.75
PF10138200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 95.75
PRK03839180 putative kinase; Provisional 95.72
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 95.69
KOG2807 378 consensus RNA polymerase II transcription initiati 95.68
PRK00131175 aroK shikimate kinase; Reviewed 95.64
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 95.64
COG2718423 Uncharacterized conserved protein [Function unknow 95.58
PF1324576 AAA_19: Part of AAA domain 95.55
PHA00729226 NTP-binding motif containing protein 95.52
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.49
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.49
PRK13947171 shikimate kinase; Provisional 95.46
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.46
PRK13889 988 conjugal transfer relaxase TraA; Provisional 95.45
PF11775 219 CobT_C: Cobalamin biosynthesis protein CobT VWA do 95.39
PRK13764602 ATPase; Provisional 95.38
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.38
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.37
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.31
PRK07261171 topology modulation protein; Provisional 95.31
PRK06217183 hypothetical protein; Validated 95.28
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.26
PRK08233182 hypothetical protein; Provisional 95.19
PRK00625173 shikimate kinase; Provisional 95.18
PRK06762166 hypothetical protein; Provisional 95.18
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.16
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.14
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.14
PRK14532188 adenylate kinase; Provisional 95.13
KOG2884 259 consensus 26S proteasome regulatory complex, subun 95.11
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.09
PRK13949169 shikimate kinase; Provisional 95.07
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.07
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 95.0
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.96
PLN02318656 phosphoribulokinase/uridine kinase 94.93
COG2304 399 Uncharacterized protein containing a von Willebran 94.93
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.88
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.87
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.83
PRK14530215 adenylate kinase; Provisional 94.78
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.76
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 94.75
PF11265226 Med25_VWA: Mediator complex subunit 25 von Willebr 94.71
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.7
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 94.68
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.67
PRK14531183 adenylate kinase; Provisional 94.66
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.56
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.56
COG0703172 AroK Shikimate kinase [Amino acid transport and me 94.52
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 94.48
PRK05057172 aroK shikimate kinase I; Reviewed 94.36
PRK02496184 adk adenylate kinase; Provisional 94.36
PRK13948182 shikimate kinase; Provisional 94.34
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 94.33
KOG3768 888 consensus DEAD box RNA helicase [General function 94.29
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.26
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 94.24
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.22
PRK06547172 hypothetical protein; Provisional 94.19
PRK04040188 adenylate kinase; Provisional 94.18
COG1084346 Predicted GTPase [General function prediction only 94.16
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.12
COG1855604 ATPase (PilT family) [General function prediction 94.09
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.05
PRK04132 846 replication factor C small subunit; Provisional 94.02
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.01
PRK00279215 adk adenylate kinase; Reviewed 94.01
PRK05541176 adenylylsulfate kinase; Provisional 93.98
PRK14527191 adenylate kinase; Provisional 93.97
PRK03731171 aroL shikimate kinase II; Reviewed 93.97
PLN02200234 adenylate kinase family protein 93.95
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 93.91
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.89
PTZ00088229 adenylate kinase 1; Provisional 93.86
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.86
PHA02530300 pseT polynucleotide kinase; Provisional 93.82
PLN02165334 adenylate isopentenyltransferase 93.76
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.76
PRK14528186 adenylate kinase; Provisional 93.75
COG4619223 ABC-type uncharacterized transport system, ATPase 93.74
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.74
PTZ00202550 tuzin; Provisional 93.7
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.7
PRK00300205 gmk guanylate kinase; Provisional 93.67
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.67
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.63
PRK13851344 type IV secretion system protein VirB11; Provision 93.61
PF03731 224 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte 93.53
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.52
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.49
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.42
KOG1968871 consensus Replication factor C, subunit RFC1 (larg 93.34
PRK04182180 cytidylate kinase; Provisional 93.34
PRK00889175 adenylylsulfate kinase; Provisional 93.3
PRK13946184 shikimate kinase; Provisional 93.28
PRK06696223 uridine kinase; Validated 93.27
PRK09825176 idnK D-gluconate kinase; Provisional 93.27
COG5148 243 RPN10 26S proteasome regulatory complex, subunit R 93.2
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 93.19
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 93.17
PRK14526211 adenylate kinase; Provisional 93.15
cd01478 267 Sec23-like Sec23-like: Protein and membrane traffi 93.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.08
PRK10436462 hypothetical protein; Provisional 93.05
PF1355562 AAA_29: P-loop containing region of AAA domain 93.05
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 93.05
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 93.02
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.0
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.98
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.97
PRK13833323 conjugal transfer protein TrbB; Provisional 92.89
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 92.85
KOG2383467 consensus Predicted ATPase [General function predi 92.82
PRK13975196 thymidylate kinase; Provisional 92.8
PRK12339197 2-phosphoglycerate kinase; Provisional 92.78
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.77
PRK06851367 hypothetical protein; Provisional 92.68
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.59
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 92.57
PRK01184184 hypothetical protein; Provisional 92.57
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 92.5
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 92.49
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 92.48
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 92.43
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 92.39
PRK12338319 hypothetical protein; Provisional 92.35
PLN02674244 adenylate kinase 92.34
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 92.18
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information 
Probab=100.00  E-value=2.1e-83  Score=735.70  Aligned_cols=541  Identities=43%  Similarity=0.687  Sum_probs=451.7

Q ss_pred             CCCCceechHHHHHHHHHhcccCCCceEEEECCCCCHHHHHHHHHHhhCCCCeeeccccccCCCCCCCcccccccccccc
Q 006254           92 FPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEY  171 (653)
Q Consensus        92 ~~f~~IvGq~~~k~aL~~~av~p~~~gVLL~GppGTGKT~lArala~~l~~~~~v~~~~~nc~p~~~~~~~~~~~~~~~~  171 (653)
                      |||++||||+.++++|++++++|..+||||+|++|||||++||+|+.++|+++++.+|.|||+|+.+..||..|......
T Consensus         1 ~pf~~ivGq~~~~~al~~~av~~~~g~vli~G~~GtgKs~lar~l~~~lp~~~~~~~~~~~c~p~~~~~~~~~~~~~~~~   80 (633)
T TIGR02442         1 FPFTAIVGQEDLKLALLLNAVDPRIGGVLIRGEKGTAKSTAARGLAALLPPIDVVAGCPFSCDPDDPEEWCEECRRKYRP   80 (633)
T ss_pred             CCcchhcChHHHHHHHHHHhhCCCCCeEEEEcCCCCcHHHHHHHHHHhCCCceeccCCcCCCCCCCccccChhhhhcccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999884321


Q ss_pred             cccccccccccCCCeEeCCCCCcccceeeecchhhhhccCCccccccccccccCceEEecccccCCHHHHHHHHHHHHcC
Q 006254          172 DTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEG  251 (653)
Q Consensus       172 ~~~~~~~~~~~~~~fv~l~~~~~~~~l~G~~d~~~~~~~g~~~~~~Gll~~A~~giL~IDEi~~l~~~~~~~Ll~~l~~g  251 (653)
                             ......||+.+|.++++++|+|++|+++++..|...+++|+|.+|++||||||||++|++.+|+.|+.+|++|
T Consensus        81 -------~~~~~~pfv~~p~~~t~~~l~G~~d~~~~l~~g~~~~~~G~L~~A~~GiL~lDEi~~l~~~~q~~Ll~~le~g  153 (633)
T TIGR02442        81 -------SEQRPVPFVNLPLGATEDRVVGSLDIERALREGEKAFQPGLLAEAHRGILYIDEVNLLDDHLVDVLLDAAAMG  153 (633)
T ss_pred             -------cccCCCCeeeCCCCCcHHHcCCcccHHHHhhcCCeeecCcceeecCCCeEEeChhhhCCHHHHHHHHHHHhcC
Confidence                   1124689999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEeeCCeeEEeecCcEEEEEecCCCCcccHHHHhhhcccccccCCCCHhhHHHHHHHHHHHHhhhhHHhhhhhhhhhH
Q 006254          252 VNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDL  331 (653)
Q Consensus       252 ~~~v~r~G~s~~~p~~~~lIattNp~eg~l~~aLldRf~~~v~l~~p~~~~~r~~I~~~~~~~~~~~~~~~~~~~~~~~~  331 (653)
                      .+.|+|+|.+..+|++|+||+|+||+++.|+++|+|||+++|.+..+.+.+++.+|+.+...|..++..|...|......
T Consensus       154 ~~~v~r~g~~~~~~~~~~lIat~np~eg~l~~~L~dR~~l~i~v~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~  233 (633)
T TIGR02442       154 VNRVEREGLSVSHPARFVLIGTMNPEEGDLRPQLLDRFGLCVDVAAPRDPEERVEIIRRRLAFDADPEAFAARWAAEQEE  233 (633)
T ss_pred             CEEEEECCceeeecCCeEEEEecCCCCCCCCHHHHhhcceEEEccCCCchHHHHHHHHHHHhhccCcHHHHHHhhhhHHH
Confidence            99999999999999999999999999999999999999999999987788889999998888888888888888887778


Q ss_pred             HHHHHHHHHhhhcccCCCHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHHcCCCCccHHHHHHHHHHHcCCCcccCC
Q 006254          332 AKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINE  411 (653)
Q Consensus       332 l~~~i~~ar~~l~~v~is~~~l~~l~~~~~~~~i~s~R~~i~llr~Ara~Aal~gr~~Vt~eDv~~A~~lvl~hR~~~~~  411 (653)
                      +...|..++.+++.|.++++++++|+++|..+|+.|+|+.+.++++|+++|+|+|+++|+.+||.+|+++||.||+++.|
T Consensus       234 l~~~i~~ar~~~~~V~is~~~~~~l~~~~~~~~i~s~Ra~i~~~r~Ara~AaL~gr~~V~~~Dv~~A~~lvL~hR~~~~p  313 (633)
T TIGR02442       234 LRNRIARARSLLPSVRISDSLIRFISELCIEFGVDGHRADIVMARAARALAALDGRRRVTAEDVREAAELVLPHRRRRKP  313 (633)
T ss_pred             HHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhCCCCccHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHHHHhhhhccCCC
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999998665


Q ss_pred             CCCCC---CCC---C-CCCCCCCCCCCCCCcccCccc-ccc-CC-Cccchhhcc---cCCCcccccccCCCCcchhhhHH
Q 006254          412 TPPEQ---QNQ---Q-PPPPPPPQNQDSGEEEQNEEE-DQE-DE-NDEENEQQQ---EQLPEEFIFDAEGGLVDEKLLFF  478 (653)
Q Consensus       412 ~~~~~---~~~---~-~~~~~~~~~~~~~~~~~~~~~-~~~-~~-~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  478 (653)
                      .+.++   +++   . +++++++..+++++++++++. ++. ++ .+++++.+.   .+...+.+++++.. +.++++.+
T Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  392 (633)
T TIGR02442       314 FEQPQGKDEKDLEEKPEEPGPDPEKPDEGEDDAEQSGPRGHPTPGNDDEKEPDPQEEADGQGSSTDPAGDI-FRIRVLAP  392 (633)
T ss_pred             cccCCCCCccccccccCCCCCCCCCCCccccccccccccccccccccccccccccCCCCCCcccccCcccc-cCcchhcc
Confidence            32111   110   0 111111100111111000000 000 00 000000000   00011234666553 44566654


Q ss_pred             HHHHhhhcCCCCCcccccccCCCCcccccCCCCCCCCCcChhHhHHhhCCcchhhhccccccccceeeecCcchhhhhhc
Q 006254          479 AQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMAR  558 (653)
Q Consensus       479 ~~~~~~~~~~~g~~~~~~~~~~~Gr~~~~~~~~~~~~~i~~~aTl~~aap~q~~r~~~~~~~~~~~~i~~~dl~~~~~~~  558 (653)
                      ... + .++++||++. ..+..||||+++.++++..++|||++|||+|+|||+.|      .+ .+.|+++||+++++++
T Consensus       393 ~~~-~-~~~~~g~~~~-~~~~~rGr~~~~~~~~~~~~~i~~~aTlr~aa~~q~~r------~~-~~~i~~~dl~~~~~~~  462 (633)
T TIGR02442       393 PQA-R-ARGASGRRSR-TRSDSRGRYVRARRNRGPPDDLAVDATLRAAAPHQRAR------PG-AVAVEPEDLREKIRAG  462 (633)
T ss_pred             ccc-c-ccCCCCCCcc-cccCCCCeeeeccCCCCCCCccCHHHHHHHhccccccc------CC-cceechhhhhHHHhcC
Confidence            432 2 2234666553 33458999999998775567899999999999999776      12 6999999999999999


Q ss_pred             cCCceEEEEEeCCCCCCh-hHHHHHHHHHHHHHHhHcCCCCeEEEEEeecCCcEEEcCCCcCHHHHHHHHhcCCCCCCCc
Q 006254          559 KAGALVIFVVDASGSMAL-NRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSP  637 (653)
Q Consensus       559 ~~~~~v~~vvD~SgSM~~-~r~~~ak~a~~~ll~~ay~~rd~v~li~F~~~~a~~~lp~t~~~~~~~~~L~~l~~gG~Tp  637 (653)
                      +++..|+||||+||||++ +||..+|+++..|+.++|..+|+||||+|+|..+++++|+|++...+...|..+++||+||
T Consensus       463 r~~~~vv~vvD~SgSM~~~~rl~~ak~a~~~ll~~a~~~~D~v~lI~F~g~~a~~~~p~t~~~~~~~~~L~~l~~gG~Tp  542 (633)
T TIGR02442       463 RAGNLVIFVVDASGSMAARGRMAAAKGAVLSLLRDAYQKRDKVALITFRGEEAEVLLPPTSSVELAARRLEELPTGGRTP  542 (633)
T ss_pred             CCCceEEEEEECCccCCCccHHHHHHHHHHHHHHHhhcCCCEEEEEEECCCCceEEcCCCCCHHHHHHHHHhCCCCCCCC
Confidence            999999999999999987 6999999999999999999999999999988789999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHh
Q 006254          638 LAHGLSMGWAKCG  650 (653)
Q Consensus       638 l~~gl~~a~~~l~  650 (653)
                      |++||..|++++.
T Consensus       543 l~~aL~~A~~~l~  555 (633)
T TIGR02442       543 LAAGLLKAAEVLS  555 (633)
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999999887

A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR02877 spore_yhbH sporulation protein YhbH Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG2766 PrkA Putative Ser protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PF01882 DUF58: Protein of unknown function DUF58; InterPro: IPR002881 This domain is found in a family of prokaryotic proteins that have no known function Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05325 hypothetical protein; Provisional Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function Back     alignment and domain information
>PF04285 DUF444: Protein of unknown function (DUF444); InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56 Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13148 DUF3987: Protein of unknown function (DUF3987) Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>COG2718 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>KOG3768 consensus DEAD box RNA helicase [General function prediction only] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
1g8p_A350 Crystal Structure Of Bchi Subunit Of Magnesium Chel 2e-51
2x31_A189 Modelling Of The Complex Between Subunits Bchi And 1e-11
>pdb|1G8P|A Chain A, Crystal Structure Of Bchi Subunit Of Magnesium Chelatase Length = 350 Back     alignment and structure 
Iteration: 1

 Score =  200 bits (509), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 173/317 (54%), Gaps = 13/317 (4%)
Query: 89  RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVG 148
           R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+   R L A+LP IE V G
Sbjct: 18  RPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEG 77
Query: 149 SIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIAR--SPFVQIPLGVTEDRLIGSVDVEE 206
                   CP       + +   D A  L T + R  +P V +PLGV+EDR++G++D+E 
Sbjct: 78  --------CP---VSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIER 126
Query: 207 SVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPC 266
           ++  G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G N+VER+G+S +HP 
Sbjct: 127 AISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPA 186
Query: 267 KPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVE 326
           + +L+ + NPEEG +R  LLDR  +++    P   E RV  +     +        +   
Sbjct: 187 RFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWR 246
Query: 327 EETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEG 386
            +    + QI+ ARE L  V      L       +  G  G R EL   R A+ LAALEG
Sbjct: 247 PKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEG 306
Query: 387 REKVNVDDLKKAVELVI 403
              V  D LK+   + +
Sbjct: 307 ATAVGRDHLKRVATMAL 323
>pdb|2X31|A Chain A, Modelling Of The Complex Between Subunits Bchi And Bchd Of Magnesium Chelatase Based On Single-Particle Cryo-Em Reconstruction At 7.5 Ang Length = 189 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query653
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 1e-109
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 5e-30
3rag_A242 Uncharacterized protein; structural genomics, PSI- 1e-18
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 3e-10
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 5e-09
4fx5_A 464 VON willebrand factor type A; structural genomics, 1e-08
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 4e-07
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-04
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
 Score =  332 bits (853), Expect = e-109
 Identities = 116/334 (34%), Positives = 168/334 (50%), Gaps = 9/334 (2%)

Query: 73  ANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVM 132
                        +  R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+  
Sbjct: 2   TTAVARLQPSASGAKTRPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTA 61

Query: 133 ARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLG 192
            R L A+LP IE V G   ++           +                  +P V +PLG
Sbjct: 62  VRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLST---------NVIRKPTPVVDLPLG 112

Query: 193 VTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGV 252
           V+EDR++G++D+E ++  G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G 
Sbjct: 113 VSEDRVVGALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGE 172

Query: 253 NIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIAT 312
           N+VER+G+S +HP + +L+ + NPEEG +R  LLDR  +++    P   E RV  +    
Sbjct: 173 NVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRD 232

Query: 313 QFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAEL 372
            +        +    +    + QI+ ARE L  V      L       +  G  G R EL
Sbjct: 233 TYDADPKAFLEEWRPKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGEL 292

Query: 373 YAARVAKCLAALEGREKVNVDDLKKAVELVILPR 406
              R A+ LAALEG   V  D LK+   + +  R
Sbjct: 293 TLLRSARALAALEGATAVGRDHLKRVATMALSHR 326
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Length = 242 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Length = 368 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Length = 464 Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 100.0
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.96
3f8t_A506 Predicted ATPase involved in replication control, 99.95
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.94
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.94
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.9
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.9
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.9
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.88
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 99.87
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.84
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.83
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.83
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.83
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.81
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.8
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.8
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.79
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.79
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.78
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.77
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.76
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.76
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.76
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.76
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.76
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.75
3pvs_A447 Replication-associated recombination protein A; ma 99.74
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.74
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.74
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.74
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.74
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.73
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.73
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.73
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.71
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 99.71
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.71
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.69
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.69
3co5_A143 Putative two-component system transcriptional RES 99.69
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.68
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.68
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.64
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.64
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.64
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.63
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.62
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.61
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.61
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.61
3bos_A242 Putative DNA replication factor; P-loop containing 99.6
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.59
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.58
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.57
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.56
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.55
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.55
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.54
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.53
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.53
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.53
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.52
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.5
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.5
3rag_A242 Uncharacterized protein; structural genomics, PSI- 99.49
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.47
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.47
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.46
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.45
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.45
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.44
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 99.44
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.42
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.39
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.39
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.38
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.35
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.35
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.33
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.31
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.3
4b4t_W 268 RPN10, 26S proteasome regulatory subunit RPN10; hy 99.29
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 99.25
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.15
1atz_A189 VON willebrand factor; collagen-binding, hemostasi 99.13
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 99.09
3ibs_A 218 Conserved hypothetical protein BATB; structural ge 99.06
4fx5_A 464 VON willebrand factor type A; structural genomics, 99.04
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.04
1q0p_A 223 Complement factor B; VON willebrand factor, MAC-1, 99.02
3n2n_F185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 99.0
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.99
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold 98.99
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, 98.95
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 98.94
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.92
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 98.88
4hqo_A 266 Sporozoite surface protein 2; malaria, gliding mot 98.87
3zqk_A199 VON willebrand factor; blood clotting, adamts-13, 98.84
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.83
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.83
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 98.83
3hrz_D 741 Complement factor B; serine protease, glycosilated 98.82
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1. 98.81
4hqf_A 281 Thrombospondin-related anonymous protein, trap; ma 98.81
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, anta 98.76
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell a 98.71
2b2x_A 223 Integrin alpha-1; computational design, antibody-a 98.66
1pt6_A 213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 98.65
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.64
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.63
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 98.51
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.47
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.44
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.32
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 98.28
1jey_B 565 KU80; double-strand DNA break repair, non-homologo 98.21
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 98.18
2qgz_A308 Helicase loader, putative primosome component; str 98.14
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.9
1tue_A212 Replication protein E1; helicase, replication, E1E 97.89
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.75
2nvo_A535 RO sixty-related protein, RSR; alpha helical repea 97.73
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.67
2fna_A357 Conserved hypothetical protein; structural genomic 97.66
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.57
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.55
1jey_A 609 KU70; double-strand DNA break repair, non-homologo 97.52
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.32
2iue_A 212 Pactolus I-domain; membrane protein, CD, ITC, limb 97.15
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.98
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.96
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.65
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.6
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.39
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.38
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 96.09
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.88
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.65
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.57
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.56
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.5
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.45
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.29
1via_A175 Shikimate kinase; structural genomics, transferase 95.22
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 95.21
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.11
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.0
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.95
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.91
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 94.89
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.84
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.81
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.78
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.77
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.75
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.74
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.71
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.68
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.66
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.66
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.61
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.57
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 94.54
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.54
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.53
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.53
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.52
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.43
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.39
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.39
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.38
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 94.36
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.36
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.35
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.33
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.31
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.31
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 94.23
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.22
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 94.21
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 94.19
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.08
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.08
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.05
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.05
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.02
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.01
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.9
2nut_A 769 Protein transport protein SEC23A; human copii SEC2 93.87
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.86
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 93.81
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 93.75
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.72
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.71
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 93.7
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.7
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.7
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.69
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.69
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.68
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.65
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 93.62
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.59
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.57
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.56
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.54
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.52
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.41
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 93.39
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 93.37
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.37
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.36
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 93.36
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.34
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.22
3t3p_B 472 Integrin beta-3; integrin, cell adhesion, blood cl 93.13
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.09
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 93.07
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.05
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.01
3vi3_B 454 Integrin beta-1; beta propeller fold, rossman fold 92.98
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 92.96
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.93
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 92.85
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.85
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.82
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 92.8
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.74
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.73
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.72
3v4v_B 503 Integrin beta-7; cell adhesion, madcam-1, membrane 92.71
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.68
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 92.63
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.63
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 92.59
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.56
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.55
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 92.53
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.38
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.38
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.27
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.26
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.21
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.18
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.14
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.13
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.13
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.98
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.92
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 91.91
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.77
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.52
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.51
2cvh_A220 DNA repair and recombination protein RADB; filamen 91.46
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.39
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 91.37
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.35
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.34
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 91.34
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 91.29
3kta_A182 Chromosome segregation protein SMC; structural mai 91.17
1p9r_A418 General secretion pathway protein E; bacterial typ 91.17
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 91.16
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.15
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.11
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.09
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 91.0
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.91
1sgw_A214 Putative ABC transporter; structural genomics, P p 90.8
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.73
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.67
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 90.67
1m2o_A 768 SEC23, protein transport protein SEC23, SEC23P; zi 90.66
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.65
1g6h_A257 High-affinity branched-chain amino acid transport 90.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.49
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 90.43
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.4
1ji0_A240 ABC transporter; ATP binding protein, structural g 90.36
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 90.36
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 90.3
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.25
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.21
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 90.18
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 90.14
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 90.1
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 90.06
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.05
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.04
2oap_1511 GSPE-2, type II secretion system protein; hexameri 89.96
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 89.94
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 89.76
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 89.76
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 89.73
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.63
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 89.62
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.56
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 89.51
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 89.4
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.33
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.28
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 89.25
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 89.23
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 89.19
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.15
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 89.15
2ewv_A372 Twitching motility protein PILT; pilus retraction 89.14
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 89.08
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 89.04
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 88.95
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 88.89
2ghi_A260 Transport protein; multidrug resistance protein, M 88.86
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 88.85
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 88.82
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 88.78
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 88.77
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 88.61
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 88.57
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.56
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.34
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 88.29
3h1t_A590 Type I site-specific restriction-modification syst 88.2
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 88.18
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 88.17
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 88.13
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 88.12
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 88.1
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.06
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 87.99
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 87.96
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 87.94
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 87.94
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 87.9
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 87.84
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 87.84
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.83
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 87.79
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.75
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 87.69
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 87.59
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 87.59
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 87.53
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 87.41
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 87.38
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 87.31
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 87.31
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.24
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 87.19
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 87.13
2wji_A165 Ferrous iron transport protein B homolog; membrane 87.13
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 87.08
1vma_A306 Cell division protein FTSY; TM0570, structural gen 86.99
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 86.96
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 86.95
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 86.69
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 86.65
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 86.59
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 86.59
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 86.53
3t1o_A198 Gliding protein MGLA; G domain containing protein, 86.52
2og2_A359 Putative signal recognition particle receptor; nuc 86.46
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 86.42
2krk_A86 26S protease regulatory subunit 8; structural geno 86.4
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 86.31
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 86.22
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 86.18
1nrj_B218 SR-beta, signal recognition particle receptor beta 86.12
2ged_A193 SR-beta, signal recognition particle receptor beta 86.11
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.05
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 85.98
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 85.96
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 85.95
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 85.94
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 85.9
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 85.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 85.82
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.75
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 85.72
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 85.71
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 85.7
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 85.61
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 85.61
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 85.58
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 85.58
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 85.56
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 85.56
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 85.54
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 85.5
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 85.44
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 85.44
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 85.38
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 85.29
2z43_A324 DNA repair and recombination protein RADA; archaea 85.28
1taf_A68 TFIID TBP associated factor 42; transcription init 85.27
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 85.24
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 85.2
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 85.05
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 85.02
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 85.0
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 84.96
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 84.95
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 84.88
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 84.87
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 84.84
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 84.83
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 84.82
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 84.81
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 84.79
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 84.75
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 84.71
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 84.7
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 84.69
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 84.66
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 84.51
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.49
3kw6_A78 26S protease regulatory subunit 8; structural geno 84.4
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 84.39
1u94_A356 RECA protein, recombinase A; homologous recombinat 84.34
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 84.31
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 84.29
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 84.12
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 84.12
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 84.09
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 84.08
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 84.01
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.93
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 83.8
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 83.7
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 83.66
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 83.64
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 83.6
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 83.6
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 83.58
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 83.56
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 83.42
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 83.41
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 83.41
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 83.4
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 83.39
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 83.37
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 83.35
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 83.26
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 83.14
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 83.12
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 83.09
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 83.09
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 83.07
2hf9_A226 Probable hydrogenase nickel incorporation protein 82.92
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 82.85
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 82.84
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 82.83
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 82.82
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 82.76
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 82.76
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 82.62
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 82.61
3ice_A422 Transcription termination factor RHO; transcriptio 82.53
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 82.5
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 82.44
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 82.44
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 82.43
3lxx_A239 GTPase IMAP family member 4; structural genomics c 82.38
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 82.37
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 82.31
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 82.3
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 82.3
3io5_A333 Recombination and repair protein; storage dimer, i 82.22
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 82.1
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 82.06
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 81.99
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 81.97
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 81.91
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 81.88
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 81.88
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 81.87
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 81.82
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 81.79
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 81.57
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 81.57
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 81.55
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 81.55
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 81.51
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 81.41
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 81.21
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 81.21
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 81.21
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 81.19
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 81.14
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 81.13
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 81.09
2r6a_A454 DNAB helicase, replicative helicase; replication, 81.08
2fh5_B214 SR-beta, signal recognition particle receptor beta 81.07
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 81.06
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 80.99
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 80.98
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 80.96
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
Probab=100.00  E-value=8.5e-38  Score=332.74  Aligned_cols=313  Identities=37%  Similarity=0.571  Sum_probs=276.8

Q ss_pred             CCCCCCCceechHHHHHHHHHhcccCCCceEEEECCCCCHHHHHHHHHHhhCCCCeeeccccccCCCCCCCccccccccc
Q 006254           89 RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEK  168 (653)
Q Consensus        89 ~~~~~f~~IvGq~~~k~aL~~~av~p~~~gVLL~GppGTGKT~lArala~~l~~~~~v~~~~~nc~p~~~~~~~~~~~~~  168 (653)
                      .++++|++|+|++.+++++..+++.+..++|||+||||||||++|++++..+++.....+++|||....++..|..|.. 
T Consensus        18 ~~~~~f~~i~G~~~~~~~l~~~~~~~~~~~vLl~G~~GtGKT~la~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-   96 (350)
T 1g8p_A           18 RPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLS-   96 (350)
T ss_dssp             CCCCCGGGSCSCHHHHHHHHHHHHCGGGCCEEEECCGGGCTTHHHHHHHHHSCCEEEETTCTTCCSSGGGSCTTCCCSC-
T ss_pred             CCCCCchhccChHHHHHHHHHHhhCCCCceEEEECCCCccHHHHHHHHHHhCccccccccccccccccccccchhhhhc-
Confidence            4578999999999999998887777777899999999999999999999999877777778899987766666655541 


Q ss_pred             ccccccccccccccCCCeEeCCCCCcccceeeecchhhhhccCCccccccccccccCceEEecccccCCHHHHHHHHHHH
Q 006254          169 AEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVL  248 (653)
Q Consensus       169 ~~~~~~~~~~~~~~~~~fv~l~~~~~~~~l~G~~d~~~~~~~g~~~~~~Gll~~A~~giL~IDEi~~l~~~~~~~Ll~~l  248 (653)
                      +        .......+|+.++.+.+.+.++|.+++.+.+..+...+.+|++..+++||||||||+.++.+.++.|+.++
T Consensus        97 ~--------~~~~~~~~~~~~~~~~~~~~l~g~~~~~~~~~~~~~~~~~g~~~~a~~~vl~iDEi~~l~~~~~~~Ll~~l  168 (350)
T 1g8p_A           97 T--------NVIRKPTPVVDLPLGVSEDRVVGALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVA  168 (350)
T ss_dssp             C--------CEEEECCCEEEECTTCCHHHHHCEECHHHHHHHCGGGEECCHHHHHTTEEEEETTGGGSCHHHHHHHHHHH
T ss_pred             c--------ccccCCCcccccCCCcchhhheeechhhhhhcCCceeecCceeeecCCCEEEEeChhhCCHHHHHHHHHHH
Confidence            1        11123568899999999999999988888777787888999999999999999999999999999999999


Q ss_pred             HcCceEEeeCCeeEEeecCcEEEEEecCCCCcccHHHHhhhcccccccCCCCHhhHHHHHHHHHHHHhhhhHHhhhhhhh
Q 006254          249 TEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEE  328 (653)
Q Consensus       249 ~~g~~~v~r~G~s~~~p~~~~lIattNp~eg~l~~aLldRf~~~v~l~~p~~~~~r~~I~~~~~~~~~~~~~~~~~~~~~  328 (653)
                      +++...+.+.|.....+.+|++|+|+|+.++.++++|++||++++.+..|.+.+.+.+|+.....+..++..|...|...
T Consensus       169 e~~~~~~~~~g~~~~~~~~~~li~~~n~~~~~l~~~L~~R~~~~~~l~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~  248 (350)
T 1g8p_A          169 QSGENVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRPK  248 (350)
T ss_dssp             HHSEEEECCTTCCEEEECCEEEEEEECSCSCCCCHHHHTTCSEEEECCCCCSHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             hcCceEEEecceEEeeCCceEEEEEeCCCCCCCCHHHHhhcceEEEcCCCCcHHHHHHHHHHHHhcccCchhhccccccc
Confidence            99998899999999999999999999998889999999999998899977688889899998877777777777778888


Q ss_pred             hhHHHHHHHHHHhhhcccCCCHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHHcCCCCccHHHHHHHHHHHcCCCcc
Q 006254          329 TDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSI  408 (653)
Q Consensus       329 ~~~l~~~i~~ar~~l~~v~is~~~l~~l~~~~~~~~i~s~R~~i~llr~Ara~Aal~gr~~Vt~eDv~~A~~lvl~hR~~  408 (653)
                      ...+...|..++.....+.++++++++|+++++..++.+.|..+.+++.|.++|.+.|+..|+.+||.+|+.+++.||.+
T Consensus       249 ~~~~~~~i~~~~~~~~~~~ls~~~~~~l~~~~~~~~~~~~R~~~~ll~~a~~~A~~~~~~~v~~~~v~~a~~~~l~~r~~  328 (350)
T 1g8p_A          249 DMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEGATAVGRDHLKRVATMALSHRLR  328 (350)
T ss_dssp             HHHHHHHHHHHHHHGGGCBCCHHHHHHHHHHHHHSSSCSHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHGGGCC
T ss_pred             hHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhCCCCccHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHHHHHhhccc
Confidence            88889999999888888999999999999999999988899999999999999999999999999999999999999987


Q ss_pred             cC
Q 006254          409 IN  410 (653)
Q Consensus       409 ~~  410 (653)
                      ..
T Consensus       329 ~~  330 (350)
T 1g8p_A          329 RD  330 (350)
T ss_dssp             --
T ss_pred             cC
Confidence            43
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 653
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 3e-59
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-08
d1shux_181 c.62.1.1 (X:) Capillary morphogenesis protein 2 do 8e-06
d1q0pa_ 209 c.62.1.1 (A:) Complement factor B domain {Human (H 2e-05
d1mf7a_194 c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, M 2e-04
d1n3ya_189 c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo 6e-04
d1jeya2 220 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain 6e-04
d1yvra2174 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprot 0.001
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

 Score =  199 bits (507), Expect = 3e-59
 Identities = 117/318 (36%), Positives = 170/318 (53%), Gaps = 9/318 (2%)

Query: 89  RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVG 148
           R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+   R L A+LP IE V G
Sbjct: 1   RPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEG 60

Query: 149 SIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESV 208
              ++                ++ T  +       +P V +PLGV+EDR++G++D+E ++
Sbjct: 61  CPVSSPNVEMI---------PDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIERAI 111

Query: 209 KTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKP 268
             G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G N+VER+G+S +HP + 
Sbjct: 112 SKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPARF 171

Query: 269 LLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEE 328
           +L+ + NPEEG +R  LLDR  +++    P   E RV  +     +        +    +
Sbjct: 172 VLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRPK 231

Query: 329 TDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGRE 388
               + QI+ ARE L  V      L       +  G  G R EL   R A+ LAALEG  
Sbjct: 232 DMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEGAT 291

Query: 389 KVNVDDLKKAVELVILPR 406
            V  D LK+   + +  R
Sbjct: 292 AVGRDHLKRVATMALSHR 309
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query653
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 100.0
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.89
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.81
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.8
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.79
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.7
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.67
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.64
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.64
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.63
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.62
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.6
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.59
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.59
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.58
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.57
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.48
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.42
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.39
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.37
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.34
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.31
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.24
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.23
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.21
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.98
d1q0pa_ 209 Complement factor B domain {Human (Homo sapiens) [ 98.76
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 98.75
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 98.63
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated 98.45
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 98.43
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.42
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 98.41
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 98.41
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.39
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 98.37
d1jeyb2 236 Ku80 subunit N-terminal domain {Human (Homo sapien 98.3
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 98.27
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 98.19
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 97.96
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.78
d1tyeb2 248 Integrin beta A domain {Human (Homo sapiens) [TaxI 97.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.43
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.42
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.16
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.09
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.03
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.01
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.86
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.75
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.75
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.73
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.69
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.62
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.61
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.36
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.35
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.32
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.3
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.29
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.26
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.26
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.19
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.01
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.96
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.8
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.75
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.74
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.69
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.68
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.63
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.56
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.53
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.44
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.42
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.4
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.38
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.26
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.23
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.97
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.92
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.79
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.72
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.65
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.57
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.54
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.8
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.71
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.63
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.05
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.87
d2qtva3 271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 92.63
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 92.39
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.35
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.31
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.13
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.07
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.06
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.48
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 91.47
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.28
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.28
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.13
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.05
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.97
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.84
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.82
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.79
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.64
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.61
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.53
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.32
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.31
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.13
d1okkd2207 GTPase domain of the signal recognition particle r 90.12
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.03
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.99
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.95
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.85
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.77
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.68
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.63
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.57
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.53
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.53
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.43
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.41
d1pd0a3 252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 89.17
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 88.77
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 88.74
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.66
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.47
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.38
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.37
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.12
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.11
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.05
d1vmaa2213 GTPase domain of the signal recognition particle r 87.95
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.9
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.71
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.7
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 87.68
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.66
d2qy9a2211 GTPase domain of the signal recognition particle r 87.64
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.63
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 87.52
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.31
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.15
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.97
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.95
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 86.75
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.71
d2hyda1255 Putative multidrug export ATP-binding/permease pro 86.69
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.65
d1nrjb_209 Signal recognition particle receptor beta-subunit 86.44
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.39
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 86.37
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.34
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.32
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.3
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.2
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 86.17
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.14
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.13
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.02
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.98
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.97
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.82
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.59
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.59
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 85.54
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 85.52
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 85.52
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.5
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 85.49
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 85.42
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 85.14
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 85.04
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.97
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.82
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.41
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 84.39
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 84.31
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.3
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.28
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.13
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 84.04
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 84.03
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 84.02
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 83.92
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.71
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.69
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 83.56
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.56
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 83.53
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.23
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 82.98
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 82.85
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.69
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 82.68
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.59
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.41
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.29
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 82.16
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 82.07
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.04
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 81.74
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 81.68
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 81.54
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 80.76
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 80.76
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 80.58
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 80.38
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 80.23
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

Probab=100.00  E-value=4.6e-48  Score=409.24  Aligned_cols=310  Identities=37%  Similarity=0.574  Sum_probs=284.2

Q ss_pred             CCCCCCceechHHHHHHHHHhcccCCCceEEEECCCCCHHHHHHHHHHhhCCCCeeeccccccCCCCCC--Ccccccccc
Q 006254           90 QFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCP--DEWEDGLDE  167 (653)
Q Consensus        90 ~~~~f~~IvGq~~~k~aL~~~av~p~~~gVLL~GppGTGKT~lArala~~l~~~~~v~~~~~nc~p~~~--~~~~~~~~~  167 (653)
                      +.|+|++|+||+.+|++|+++++.++.+||||.|+||||||++||+++.+||++++++.|.++|.+...  +..+..+  
T Consensus         2 ~~~~f~~I~Gq~~~kral~laa~~~~~h~vLl~G~pG~GKT~lar~~~~iLp~~~~~~~~~~~~~~~~~~~~~~~~~~--   79 (333)
T d1g8pa_           2 PVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLS--   79 (333)
T ss_dssp             CCCCGGGSCSCHHHHHHHHHHHHCGGGCCEEEECCGGGCTTHHHHHHHHHSCCEEEETTCTTCCSSGGGSCTTCCCSC--
T ss_pred             CCCChhhccCcHHHHHHHHHHHhccCCCeEEEECCCCccHHHHHHHHHHhCCCchhhccCccccCccccccchhhccc--
Confidence            578999999999999999999998888899999999999999999999999999999999999865421  1111000  


Q ss_pred             cccccccccccccccCCCeEeCCCCCcccceeeecchhhhhccCCccccccccccccCceEEecccccCCHHHHHHHHHH
Q 006254          168 KAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNV  247 (653)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~fv~l~~~~~~~~l~G~~d~~~~~~~g~~~~~~Gll~~A~~giL~IDEi~~l~~~~~~~Ll~~  247 (653)
                               ........+|+..+.+++.+.++|++|+.+.+..|...+++|.+..||+||||||||+++++++++.|+++
T Consensus        80 ---------~~~~~~~~~~~~~~~~~~~~~l~G~~d~~~~~~~g~~~~~~G~l~~A~~gvl~iDEi~~~~~~~~~aLl~~  150 (333)
T d1g8pa_          80 ---------TNVIRKPTPVVDLPLGVSEDRVVGALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDV  150 (333)
T ss_dssp             ---------CCEEEECCCEEEECTTCCHHHHHCEECHHHHHHHCGGGEECCHHHHHTTEEEEETTGGGSCHHHHHHHHHH
T ss_pred             ---------cCcccccCceeeccCCCCcccccCcchhhhccccCcceeeccccccccccEeecccHHHHHHHHHHHHhhh
Confidence                     01123467899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHcCceEEeeCCeeEEeecCcEEEEEecCCCCcccHHHHhhhcccccccCCCCHhhHHHHHHHHHHHHhhhhHHhhhhhh
Q 006254          248 LTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEE  327 (653)
Q Consensus       248 l~~g~~~v~r~G~s~~~p~~~~lIattNp~eg~l~~aLldRf~~~v~l~~p~~~~~r~~I~~~~~~~~~~~~~~~~~~~~  327 (653)
                      |+++.+++.|.|.++.+|++|++|+|+||+++.++++++|||+++|.+..|.+.+.+.+++.........+..+...+..
T Consensus       151 me~~~v~i~r~g~~~~~p~~f~liaa~Np~~~~l~~~llDRf~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  230 (333)
T d1g8pa_         151 AQSGENVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRP  230 (333)
T ss_dssp             HHHSEEEECCTTCCEEEECCEEEEEEECSCSCCCCHHHHTTCSEEEECCCCCSHHHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred             hcCCeEEecccCceecCCCCEEEEEecCccccccccchhhhhcceeeccCcchhhHHHHHHHhhhhcccChHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999998889999999999888888899999999999


Q ss_pred             hhhHHHHHHHHHHhhhcccCCCHHHHHHHHHHHHhcCCCCcchHHHHHHHHHHHHHHcCCCCccHHHHHHHHHHHcCCCc
Q 006254          328 ETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRS  407 (653)
Q Consensus       328 ~~~~l~~~i~~ar~~l~~v~is~~~l~~l~~~~~~~~i~s~R~~i~llr~Ara~Aal~gr~~Vt~eDv~~A~~lvl~hR~  407 (653)
                      ....+..++..++.++..+.++++....++.++...+..|+|+.+.++|+|+++|+|+|+++|+.+||.+|+.+||.||.
T Consensus       231 ~~~~~~~~~~~~~~~l~~v~~~~~~~~~~~~~~~~~~~~S~R~~~~llrvArtiA~L~gr~~V~~~di~~a~~lvL~hR~  310 (333)
T d1g8pa_         231 KDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEGATAVGRDHLKRVATMALSHRL  310 (333)
T ss_dssp             HHHHHHHHHHHHHHHGGGCBCCHHHHHHHHHHHHHSSSCSHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHGGGC
T ss_pred             HHHHHHHHHHHHhhcccceecCHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccC
Q 006254          408 IIN  410 (653)
Q Consensus       408 ~~~  410 (653)
                      +..
T Consensus       311 ~~~  313 (333)
T d1g8pa_         311 RRD  313 (333)
T ss_dssp             C--
T ss_pred             cCC
Confidence            753
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure