Citrus Sinensis ID: 006375

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------65
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVGSEQS
cHHHHHHccccccccccEEEccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccEEEEEccccccccccEEEEEEEEcccccEEEEEEEccccEEEEEEEEEccccccccccccccEEEEEEEccccEEEEEEccccccccEEEEEccccccccEEEEEEcccccEEEEEEEccccEEEEEEccccccEEEEEEcccccccEEEEccccccEEEEEEEccEEEEEEccccccccEEEEEccccccccEEEEccccccEEEEEEEEccEEEEEEEcccEEEEEEEEcccccccccccccccEEEEcccEEEEccccccccccEEEEEEEcccccccEEEEEcccccEEEEEEccccccccccccEEEEEEEEcccccEEcEEEEEEcccccccccccEEEEEccccccccccccccccHHHHccccEEEEEEccccccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEcccccccccccHHHHHHHHHccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccc
cHHHHHHHccccccccccccccEEEEEEEcccccccEEEEcccccccccccccccccccccccccEEEEcccHHHccccEEEEEEEEEcccccEEEEEEEccccEEEEEEEEEcccccccccccccccccEEEEccccEEEEEEcccccccEEEEEEccccccccEEEEEcccccEEEEEEEEccccEEEEEEcccccEEEEEEEcccccccEEEEEccccEEEEEcccccEEEEEEcccccccEEEEEcccccHHccEEEcccccccEEccHHHHHHHEEEEEHcccccEEEEEEccccccccccccccEEEEcccccEEEccccccccccEEEEEEccccccccEEEEccccccEEEEEEccccccccHHHcEEEEEEEEcccccEEEEEEEEEcccccccccccEEEEEcccccccccccccHHHHHHHHcccEEEEEccccccccHHHHHHcccHHHcHHHHHHHHHHHHHHHHcccccHHHEEEEEEcHHHHHHHHHHHHcHHHccEEEEEcccccccHccccccccccccccccccccccHHHHHHHHHccccHcccccccccEEEEEccccccEEEEcHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccc
MFAELkgrikqedvsapfrqgsyYYYTRTLEGKEYVQHCRRlihnneappsvhdtmetgpdappehlildenvkaegrgfysvgcfqvspdnklvayaedtkgdeiYTVYVIDietgtpvgkplvGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEadqsndiclyhekddiyslglqaseskKFLFIASESKITRFVFYLdvskpeelrvltprvvgvdtaashrgnhffitrrsdelfnsellacpvdntsettvliphresvklqDIQLFIDHLAVYEregglqkittyrlpavgeplkslqggksvefidpvysidpsesvfssRILRFhysslrtppsvydydmDMGISVLKKIETVLggfdtnnyfterkwasasdgtqipiCIVYRknlvkldgsdplllygygsyeicndpafnssrlslldRGFIFAIAQIRGGGELGRQWYENGkflkkkntFTDFIACAEYLIKNcyctkeklciegrsaggLLIGAVLNMRPDLFKAAVAAVPFVDVLttmldptiplttaeweewgdpwKEEFYFYMKsyspvdnvkaqnyphilvtaglndprvmysePAKFVAKLREMKTDDNILLFKCelgaghfsksgRFERLREAAFTYTFLMRALSmlpsvgseqs
mfaelkgrikqedvsapfrqgSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDvskpeelrvltprvvgvdtaashrgnhFFITRRSDELFNSELLACPVDNTSETTVLIphresvklqdIQLFIDHLAVYEREGGLQKITTYRLPAVgeplkslqggksvEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTErkwasasdgtqipICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIplttaeweewgdPWKEEFYFYMKSYSPVDNVKAQNYPHILVTaglndprvmYSEPAKFVAKLREMKTDDNILLFKCELGAghfsksgrfeRLREAAFTYTFLMRALSmlpsvgseqs
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVGSEQS
*****************FRQGSYYYYTRTLEGKEYVQHCRRLIH**********************LILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSM*********
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALS**********
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSML********
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLP*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPEELRVLTPRVVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVGSEQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query648 2.2.26 [Sep-21-2011]
Q59536690 Protease 2 OS=Moraxella l N/A no 0.950 0.892 0.383 1e-128
P24555686 Protease 2 OS=Escherichia N/A no 0.950 0.897 0.400 1e-118
P55656705 Uncharacterized peptidase no no 0.945 0.869 0.3 4e-71
P55627754 Uncharacterized peptidase no no 0.935 0.803 0.302 1e-68
P27028705 Prolyl endopeptidase OS=F N/A no 0.887 0.815 0.280 2e-60
Q06903690 Prolyl endopeptidase OS=A no no 0.884 0.830 0.285 7e-58
P27195705 Prolyl endopeptidase OS=E N/A no 0.918 0.843 0.279 1e-55
Q32N48707 Prolyl endopeptidase-like N/A no 0.807 0.739 0.286 1e-51
Q5ZKL5732 Prolyl endopeptidase-like yes no 0.766 0.678 0.287 1e-51
Q8C167725 Prolyl endopeptidase-like yes no 0.763 0.682 0.292 3e-45
>sp|Q59536|PTRB_MORLA Protease 2 OS=Moraxella lacunata GN=ptrB PE=3 SV=1 Back     alignment and function desciption
 Score =  457 bits (1177), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 247/644 (38%), Positives = 377/644 (58%), Gaps = 28/644 (4%)

Query: 1   MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 60
           ++  +  R+   ++  P + G ++YY+R  + K+Y  + R+      +   + D  E   
Sbjct: 60  IYESMVDRVPDSEMKVPVQHGQFFYYSRLDKNKQYPIYARK---QAASRALLQDATE--- 113

Query: 61  DAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPV 120
                 ++LD N  AE   + SV   +++ D+  +AY E+  G + YT+Y+ D+ TG  +
Sbjct: 114 -----EVVLDLNELAEEDDYLSVTVQRMTTDHSRLAYLENRDGTDRYTIYIKDLNTGELL 168

Query: 121 GK--PLVGVTASVEWAG-NEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYS 177
               P V +  S+EW    + + Y T+DE  RP + W H+L +D  +D  ++ EKDD ++
Sbjct: 169 SDRVPNVYIYGSMEWCRCGDYIFYTTVDEHQRPCQLWRHRLGSDVESDELIFEEKDDTFT 228

Query: 178 LGLQASESKKFLFIASESKITRFVFYLDVSKP-EELRVLTPRVVGVDTAASHRGNHFFIT 236
           L +  S+S KF+F+ S SK T  +  +D   P   L+++  R  G+     H  +   I 
Sbjct: 229 LFISKSQSGKFIFVYSSSKTTSEIHMIDTDSPLSPLQLVDERRDGILYDVEHWEDDLLIL 288

Query: 237 RRSDELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYR 296
                L N +LL CP+++ S    ++ + E   LQ++  F D L +  RE GL +I    
Sbjct: 289 TNEGAL-NFQLLRCPLNDLSSKVNVVEYNEERYLQEMYPFRDKLLIAGRENGLTQIWVVH 347

Query: 297 LPAVGEPLKSLQGGKSVEFIDPVYSIDP-SESVFSSRILRFHYSSLRTPPSVYDYDMDMG 355
              +          + + + +P+Y++   SE  + +  +   Y SL TP + +  ++  G
Sbjct: 348 DGEL----------QQISWDEPLYTVAVLSEQSYDTNEVLIQYESLLTPKTTFGLNLQTG 397

Query: 356 ISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGS 415
                ++  V G +D + +  E+ WA+   G ++P+  VY +  +  +G  PL+LYGYGS
Sbjct: 398 EKQCLQVAPVSGEYDRSQFRQEQLWATGRSGVKVPMTAVYLEGALD-NGPAPLILYGYGS 456

Query: 416 YEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEY 475
           Y   +DP F+  RL LL++G +F  AQ+RGG E+GR WYE+GK   K+NTFTDFIA A++
Sbjct: 457 YGSNSDPRFDPYRLPLLEKGIVFVTAQVRGGSEMGRGWYEDGKMQNKRNTFTDFIAAAKH 516

Query: 476 LIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTT 535
           LI   Y +  K+   G SAGGLL+GAV NM  +LFK  V AVPFVDV+TTMLD +IPLTT
Sbjct: 517 LIDQNYTSPTKMAARGGSAGGLLVGAVANMAGELFKVIVPAVPFVDVVTTMLDTSIPLTT 576

Query: 536 AEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLRE 595
            EW+EWGDP K+E YFYMKSYSP DNV+A++YPH+ +T G+NDPRV Y EPAK+VA+LR 
Sbjct: 577 LEWDEWGDPRKQEDYFYMKSYSPYDNVEAKDYPHMYITTGINDPRVGYFEPAKWVARLRA 636

Query: 596 MKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSM 639
           +KTD+N L+ K  +GAGHF KSGRF  L+EAA +Y F++  L +
Sbjct: 637 VKTDNNTLVMKTNMGAGHFGKSGRFNHLKEAAESYAFILDKLGV 680
Cleaves peptide bonds on the C-terminal side of lysyl and argininyl residues.
Moraxella lacunata (taxid: 477)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 8EC: 3
>sp|P24555|PTRB_ECOLI Protease 2 OS=Escherichia coli (strain K12) GN=ptrB PE=1 SV=2 Back     alignment and function description
>sp|P55656|Y4SO_RHISN Uncharacterized peptidase y4sO OS=Rhizobium sp. (strain NGR234) GN=NGR_a01580 PE=3 SV=1 Back     alignment and function description
>sp|P55627|Y4QF_RHISN Uncharacterized peptidase y4qF OS=Rhizobium sp. (strain NGR234) GN=NGR_a01920 PE=3 SV=1 Back     alignment and function description
>sp|P27028|PPCE_FLAME Prolyl endopeptidase OS=Flavobacterium meningosepticum GN=f1pep1 PE=1 SV=1 Back     alignment and function description
>sp|Q06903|PPCE_AERHY Prolyl endopeptidase OS=Aeromonas hydrophila PE=1 SV=2 Back     alignment and function description
>sp|P27195|PPCF_ELIMR Prolyl endopeptidase OS=Elizabethkingia miricola PE=1 SV=1 Back     alignment and function description
>sp|Q32N48|PPCEL_XENLA Prolyl endopeptidase-like OS=Xenopus laevis GN=prepl PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKL5|PPCEL_CHICK Prolyl endopeptidase-like OS=Gallus gallus GN=PREPL PE=2 SV=1 Back     alignment and function description
>sp|Q8C167|PPCEL_MOUSE Prolyl endopeptidase-like OS=Mus musculus GN=Prepl PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
359484112719 PREDICTED: protease 2-like isoform 2 [Vi 1.0 0.901 0.771 0.0
297742722698 unnamed protein product [Vitis vinifera] 1.0 0.928 0.771 0.0
297742723 755 unnamed protein product [Vitis vinifera] 0.993 0.852 0.778 0.0
449458732 757 PREDICTED: protease 2-like [Cucumis sati 0.995 0.852 0.752 0.0
224095196711 predicted protein [Populus trichocarpa] 0.995 0.907 0.761 0.0
356575387 766 PREDICTED: protease 2-like [Glycine max] 0.986 0.834 0.781 0.0
297847380710 prolyl oligopeptidase family protein [Ar 0.993 0.907 0.753 0.0
18403046710 oligopeptidase B [Arabidopsis thaliana] 0.993 0.907 0.750 0.0
242097176710 hypothetical protein SORBIDRAFT_10g03118 0.993 0.907 0.739 0.0
225463781694 PREDICTED: protease 2-like [Vitis vinife 0.955 0.891 0.788 0.0
>gi|359484112|ref|XP_003633066.1| PREDICTED: protease 2-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/649 (77%), Positives = 576/649 (88%), Gaps = 1/649 (0%)

Query: 1   MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 60
           ++AE++GRIK++D+S P R+G YYYY RTLEGKEYVQ+CRRL+ N E PPSV++TM TGP
Sbjct: 71  IYAEIRGRIKEDDISVPLRKGPYYYYQRTLEGKEYVQYCRRLVPNVEVPPSVYETMPTGP 130

Query: 61  DAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPV 120
            APPEH+ILDEN+KA+   +YS+G F++SP++KLVAYAEDTKGDEIYTVYVID ET  PV
Sbjct: 131 SAPPEHVILDENIKAQEHAYYSIGAFKISPNSKLVAYAEDTKGDEIYTVYVIDAETRAPV 190

Query: 121 GKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGL 180
           GKP+VGVT  +EW G+EAL+YITMDE LRPDK WLHKLE DQS+D CLYHEKD+++S+ L
Sbjct: 191 GKPIVGVTPYLEWVGDEALLYITMDETLRPDKVWLHKLETDQSSDSCLYHEKDNMFSVDL 250

Query: 181 QASESKKFLFIASESKITRFVFYLDVSKPEE-LRVLTPRVVGVDTAASHRGNHFFITRRS 239
           +ASESKKF+F+ SESK TRF+F LDVSKPE  L VLTPR+ G+DT+ASHRGNHFFI RRS
Sbjct: 251 EASESKKFVFVGSESKTTRFIFNLDVSKPEGGLMVLTPRLDGIDTSASHRGNHFFIKRRS 310

Query: 240 DELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPA 299
           DE FNSE+LACP++N SETTVL+PHRESVK+QDIQLF  HL VYERE GL K+T YRLPA
Sbjct: 311 DEFFNSEVLACPLNNISETTVLLPHRESVKIQDIQLFSGHLVVYERENGLPKVTFYRLPA 370

Query: 300 VGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVL 359
           VGEPL SLQGG++V+F+DP+YS+DPSES FSS ILRF YSSLRTP SVYDYDM+ G+SVL
Sbjct: 371 VGEPLGSLQGGRTVDFLDPIYSVDPSESQFSSSILRFSYSSLRTPDSVYDYDMNTGVSVL 430

Query: 360 KKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEIC 419
           KKI+TVLG FD + Y TERKWA+A DGTQIPI IVYRK+LVKLDGSDPLLLYGYGSYEIC
Sbjct: 431 KKIQTVLGNFDASKYITERKWANAQDGTQIPISIVYRKDLVKLDGSDPLLLYGYGSYEIC 490

Query: 420 NDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKN 479
            +  F  SRLSLLDRGFIFAIA IRGGGE+GRQWYENGK LKKKNTFTDFI CAEYLI+ 
Sbjct: 491 VEAHFQESRLSLLDRGFIFAIAHIRGGGEMGRQWYENGKLLKKKNTFTDFIVCAEYLIEI 550

Query: 480 CYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWE 539
            YC+KEKLCIEGRSAGGLLIGAVLNMRPDLF+AA+A VPFVDVLTTMLDPTIPLTT+EWE
Sbjct: 551 KYCSKEKLCIEGRSAGGLLIGAVLNMRPDLFRAAIAGVPFVDVLTTMLDPTIPLTTSEWE 610

Query: 540 EWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTD 599
           EWGDP KEEFYFYMKSYSPVDN+KAQNYP+ILVTAGLNDPRV+YSEPAK VAKLR+ KTD
Sbjct: 611 EWGDPRKEEFYFYMKSYSPVDNIKAQNYPNILVTAGLNDPRVLYSEPAKLVAKLRDTKTD 670

Query: 600 DNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVGSEQS 648
           DNILLFKCE+ AGH SKSGRFE+L+E AFTYTF++++L M P +GS Q+
Sbjct: 671 DNILLFKCEMAAGHSSKSGRFEKLQEYAFTYTFIIKSLDMAPPLGSGQN 719

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742722|emb|CBI35356.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742723|emb|CBI35357.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458732|ref|XP_004147101.1| PREDICTED: protease 2-like [Cucumis sativus] gi|449517064|ref|XP_004165566.1| PREDICTED: protease 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224095196|ref|XP_002310359.1| predicted protein [Populus trichocarpa] gi|222853262|gb|EEE90809.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356575387|ref|XP_003555823.1| PREDICTED: protease 2-like [Glycine max] Back     alignment and taxonomy information
>gi|297847380|ref|XP_002891571.1| prolyl oligopeptidase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337413|gb|EFH67830.1| prolyl oligopeptidase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18403046|ref|NP_564567.1| oligopeptidase B [Arabidopsis thaliana] gi|5734786|gb|AAD50051.1|AC007980_16 Similar to oligopeptidases [Arabidopsis thaliana] gi|19310465|gb|AAL84967.1| At1g50380/F14I3_27 [Arabidopsis thaliana] gi|332194421|gb|AEE32542.1| oligopeptidase B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242097176|ref|XP_002439078.1| hypothetical protein SORBIDRAFT_10g031180 [Sorghum bicolor] gi|241917301|gb|EER90445.1| hypothetical protein SORBIDRAFT_10g031180 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|225463781|ref|XP_002267891.1| PREDICTED: protease 2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
TAIR|locus:2011997710 AT1G50380 [Arabidopsis thalian 0.993 0.907 0.750 1e-274
UNIPROTKB|Q4KGJ9684 ptrB "Protease 2" [Pseudomonas 0.950 0.900 0.408 3.8e-117
TIGR_CMR|CPS_3026704 CPS_3026 "protease II" [Colwel 0.950 0.875 0.382 1.4e-110
TIGR_CMR|CPS_4644719 CPS_4644 "protease II" [Colwel 0.912 0.821 0.399 3.4e-109
UNIPROTKB|P24555686 ptrB "oligopeptidase B" [Esche 0.870 0.822 0.423 1.1e-108
TIGR_CMR|SO_0144711 SO_0144 "protease II" [Shewane 0.868 0.791 0.404 3.5e-107
TAIR|locus:2205415757 AT1G69020 [Arabidopsis thalian 0.410 0.351 0.388 7.5e-81
TIGR_CMR|CPS_0086723 CPS_0086 "prolyl endopeptidase 0.842 0.755 0.324 4.8e-66
TAIR|locus:2158098792 AT5G66960 [Arabidopsis thalian 0.407 0.333 0.365 2.5e-60
DICTYBASE|DDB_G0292866866 DDB_G0292866 "oligopeptidase B 0.679 0.508 0.322 5e-57
TAIR|locus:2011997 AT1G50380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2641 (934.7 bits), Expect = 1.0e-274, P = 1.0e-274
 Identities = 484/645 (75%), Positives = 567/645 (87%)

Query:     1 MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 60
             +FAE++GRIK++D+SAP R+G YYYY + L+GKEY+QHCRRLI +N+A PSV+DTM TGP
Sbjct:    66 LFAEIRGRIKEDDISAPLRKGPYYYYEKNLQGKEYIQHCRRLITDNKAEPSVYDTMPTGP 125

Query:    61 DAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPV 120
             DAPPEH+ILDEN KA+   +Y +G F+ SPD+KLVAYAEDTKGDEIYTV VID E   PV
Sbjct:   126 DAPPEHVILDENTKAQEHDYYRIGAFKASPDHKLVAYAEDTKGDEIYTVNVIDSEALKPV 185

Query:   121 GKPLVGVTASVEWAGNEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLGL 180
             G+ L G+T+ +EWAGN+AL+YITMDEILRPDK WLHKL  +QS+D+CLYHEKDD++SL L
Sbjct:   186 GQQLKGLTSYLEWAGNDALLYITMDEILRPDKVWLHKLGTEQSSDVCLYHEKDDMFSLEL 245

Query:   181 QASESKKFLFIASESKITRFVFYLDVSKPEE-LRVLTPRVVGVDTAASHRGNHFFITRRS 239
              ASES K+LF+ASESK TRFVF LDVSK ++ LRVLTPRV G+D++ SHRGNHFFI RRS
Sbjct:   246 HASESHKYLFVASESKTTRFVFSLDVSKTQDGLRVLTPRVDGIDSSVSHRGNHFFIQRRS 305

Query:   240 DELFNSELLACPVDNTSETTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPA 299
              E +NSEL+ACPVD+TS+TTVL+PHRESVK+Q+IQLF DHLAV+ERE GLQKIT +RLPA
Sbjct:   306 TEFYNSELIACPVDDTSKTTVLLPHRESVKIQEIQLFRDHLAVFERENGLQKITVHRLPA 365

Query:   300 VGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVL 359
              G+PL+ LQGG++V F+DPVYS+D +ES FSSR+LRF Y S++TPPSVYDYDMD G SV+
Sbjct:   366 EGQPLEGLQGGRNVSFVDPVYSVDSTESEFSSRVLRFKYCSMKTPPSVYDYDMDSGTSVV 425

Query:   360 KKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEIC 419
             KKI+TVLGGFD +NY TERKW +ASDGTQIP+ IVY K L KLDGSDPLLLYGYGSYEI 
Sbjct:   426 KKIDTVLGGFDASNYVTERKWVAASDGTQIPMSIVYNKKLAKLDGSDPLLLYGYGSYEIS 485

Query:   420 NDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKN 479
              DP F +SRLSLLDRGF F IA +RGGGE+GRQWYENGK LKKKNTFTDFIACAE LI+ 
Sbjct:   486 VDPYFKASRLSLLDRGFTFVIAHVRGGGEMGRQWYENGKLLKKKNTFTDFIACAERLIEL 545

Query:   480 CYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWE 539
              YC+KEKLC+EGRSAGGLL+GAV+NMRPDLFK  +A VPFVDVLTTMLDPTIPLTT+EWE
Sbjct:   546 KYCSKEKLCMEGRSAGGLLMGAVVNMRPDLFKVVIAGVPFVDVLTTMLDPTIPLTTSEWE 605

Query:   540 EWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTD 599
             EWGDP KEEFYFYMKSYSPVDNV AQNYP++LVTAGLNDPRVMYSEP K+VAKLREMKTD
Sbjct:   606 EWGDPRKEEFYFYMKSYSPVDNVTAQNYPNMLVTAGLNDPRVMYSEPGKWVAKLREMKTD 665

Query:   600 DNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVG 644
             +N+LLFKCELGAGHFSKSGRFE+L+E AFT+ F+M+ L M+P+ G
Sbjct:   666 NNVLLFKCELGAGHFSKSGRFEKLQEDAFTFAFMMKVLDMIPASG 710
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0010048 "vernalization response" evidence=RCA
UNIPROTKB|Q4KGJ9 ptrB "Protease 2" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3026 CPS_3026 "protease II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4644 CPS_4644 "protease II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P24555 ptrB "oligopeptidase B" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0144 SO_0144 "protease II" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TAIR|locus:2205415 AT1G69020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0086 CPS_0086 "prolyl endopeptidase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TAIR|locus:2158098 AT5G66960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292866 DDB_G0292866 "oligopeptidase B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.766
3rd Layer3.4.21.830.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_VII0238
hypothetical protein (712 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.89040001
Predicted protein (206 aa)
•       0.432
gw1.21444.1.1
Phosphoribosylaminoimidazole-succinocarboxamide synthase (285 aa)
•       0.420
gw1.XIV.1527.1
hexaprenyldihydroxybenzoate methyltransferase (EC-2.1.1.114) (250 aa)
      • 0.404

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
COG1770682 COG1770, PtrB, Protease II [Amino acid transport a 0.0
PRK10115686 PRK10115, PRK10115, protease 2; Provisional 1e-158
pfam02897412 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, 1e-89
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 4e-74
COG1505648 COG1505, COG1505, Serine proteases of the peptidas 1e-62
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 8e-18
>gnl|CDD|224684 COG1770, PtrB, Protease II [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  717 bits (1852), Expect = 0.0
 Identities = 308/642 (47%), Positives = 406/642 (63%), Gaps = 32/642 (4%)

Query: 1   MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 60
           +F E+KGRIK++D+S P+R+G Y YY+RT EGKEY  +CR+     E             
Sbjct: 65  IFEEIKGRIKEDDLSVPYRKGPYEYYSRTEEGKEYPIYCRQPDEGGEG------------ 112

Query: 61  DAPPEHLILDENVKAEGRGFYSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPV 120
               E ++LD N +AEG  F+S+G   +SPD+ L+AY+ D  GDE YT+   D+ TG  +
Sbjct: 113 ----EEVLLDVNKEAEGHDFFSLGAASISPDHNLLAYSVDVLGDEQYTLRFKDLATGEEL 168

Query: 121 GKPLVGVTASVEWAG-NEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSLG 179
              +   + S  WA   + L Y  +DE  RPDK W H+L    S+D  +Y EKDD + L 
Sbjct: 169 PDEITNTSGSFAWAADGKTLFYTRLDENHRPDKVWRHRLGTPGSSDELVYEEKDDRFFLS 228

Query: 180 LQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRR 238
           +  S S+ ++ I+  S IT  V  LD   PE E +V+ PR  GV+ +  H G+ F+I   
Sbjct: 229 VGRSRSEAYIVISLGSHITSEVRLLDADDPEAEPKVVLPRENGVEYSVEHGGDRFYI-LS 287

Query: 239 SDELFNSELLACPVDNTSET-TVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRL 297
           + +  N +L+  PV         LIPHRE V+L+ + LF DHL + ER+ GL ++     
Sbjct: 288 NADGKNFKLVRAPVSADKSNWRELIPHREDVRLEGVDLFADHLVLLERQEGLPRVVVRDR 347

Query: 298 PAVGEPLKSLQGGKSVEFIDPVYS--IDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMG 355
               E          + F D  YS  +  +    S R LR+ YSS+ TP +++DYDM  G
Sbjct: 348 KTGEER--------GIAFDDEAYSAGLSGNPEFDSDR-LRYSYSSMTTPATLFDYDMATG 398

Query: 356 ISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGS 415
              L K + V GGFD  +Y + R WA+A DG Q+P+ +VYRK+  KLDGS PLLLYGYG+
Sbjct: 399 ERTLLKQQEVPGGFDPEDYVSRRIWATADDGVQVPVSLVYRKD-TKLDGSAPLLLYGYGA 457

Query: 416 YEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEY 475
           Y I  DP+F+ +RLSLLDRGF++AIA +RGGGELGR WYE+GK L KKNTFTDFIA A +
Sbjct: 458 YGISMDPSFSIARLSLLDRGFVYAIAHVRGGGELGRAWYEDGKLLNKKNTFTDFIAAARH 517

Query: 476 LIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTT 535
           L+K  Y + +++   G SAGG+L+GAV NM PDLF   +A VPFVDVLTTMLDP++PLT 
Sbjct: 518 LVKEGYTSPDRIVAIGGSAGGMLMGAVANMAPDLFAGIIAQVPFVDVLTTMLDPSLPLTV 577

Query: 536 AEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLRE 595
            EW+EWG+P   E+Y Y+KSYSP DNV+AQ YP ILVT GLNDPRV Y EPAK+VAKLRE
Sbjct: 578 TEWDEWGNPLDPEYYDYIKSYSPYDNVEAQPYPAILVTTGLNDPRVQYWEPAKWVAKLRE 637

Query: 596 MKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRAL 637
           +KTD N LL K  + AGH   SGRF+RL E AF Y FL++  
Sbjct: 638 LKTDGNPLLLKTNMDAGHGGASGRFQRLEEIAFEYAFLLKLA 679

Length = 682
>gnl|CDD|182247 PRK10115, PRK10115, protease 2; Provisional Back     alignment and domain information
>gnl|CDD|217275 pfam02897, Peptidase_S9_N, Prolyl oligopeptidase, N-terminal beta-propeller domain Back     alignment and domain information
>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|224422 COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 648
COG1770682 PtrB Protease II [Amino acid transport and metabol 100.0
PRK10115686 protease 2; Provisional 100.0
KOG2237712 consensus Predicted serine protease [Posttranslati 100.0
COG1505648 Serine proteases of the peptidase family S9A [Amin 100.0
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 100.0
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 100.0
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.97
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.97
PRK13604307 luxD acyl transferase; Provisional 99.87
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.86
PRK10566249 esterase; Provisional 99.85
PLN02298330 hydrolase, alpha/beta fold family protein 99.85
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.83
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.83
PLN02442283 S-formylglutathione hydrolase 99.81
PRK04792448 tolB translocation protein TolB; Provisional 99.8
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.8
PRK10162318 acetyl esterase; Provisional 99.79
PRK04043419 tolB translocation protein TolB; Provisional 99.79
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.79
PRK01029428 tolB translocation protein TolB; Provisional 99.78
PLN02385349 hydrolase; alpha/beta fold family protein 99.78
PRK05137435 tolB translocation protein TolB; Provisional 99.78
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.78
COG1647243 Esterase/lipase [General function prediction only] 99.78
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.77
PRK03629429 tolB translocation protein TolB; Provisional 99.76
PRK04043419 tolB translocation protein TolB; Provisional 99.76
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.76
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.75
PRK02889427 tolB translocation protein TolB; Provisional 99.75
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.75
PHA02857276 monoglyceride lipase; Provisional 99.74
PRK00178430 tolB translocation protein TolB; Provisional 99.74
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.73
PRK01029428 tolB translocation protein TolB; Provisional 99.73
PRK05137435 tolB translocation protein TolB; Provisional 99.73
PRK10749330 lysophospholipase L2; Provisional 99.73
PRK04922433 tolB translocation protein TolB; Provisional 99.72
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.7
PLN02652395 hydrolase; alpha/beta fold family protein 99.68
PRK03629429 tolB translocation protein TolB; Provisional 99.67
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.67
PRK11460232 putative hydrolase; Provisional 99.66
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.66
PRK02889427 tolB translocation protein TolB; Provisional 99.66
PRK04792448 tolB translocation protein TolB; Provisional 99.65
PRK01742429 tolB translocation protein TolB; Provisional 99.65
PRK04922433 tolB translocation protein TolB; Provisional 99.65
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.65
PRK00178430 tolB translocation protein TolB; Provisional 99.63
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.62
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.62
PRK10985324 putative hydrolase; Provisional 99.62
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.62
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.61
PLN02511388 hydrolase 99.61
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.57
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.57
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.56
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.56
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.56
PRK00870302 haloalkane dehalogenase; Provisional 99.54
COG4099387 Predicted peptidase [General function prediction o 99.53
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.51
PRK01742429 tolB translocation protein TolB; Provisional 99.51
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.51
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.51
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.5
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.5
PLN02872395 triacylglycerol lipase 99.49
PLN00021313 chlorophyllase 99.49
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.49
PLN02824294 hydrolase, alpha/beta fold family protein 99.47
PRK11071190 esterase YqiA; Provisional 99.47
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.46
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.46
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.45
PLN02965255 Probable pheophorbidase 99.45
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.45
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.44
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.44
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.43
PRK03592295 haloalkane dehalogenase; Provisional 99.43
PRK10673255 acyl-CoA esterase; Provisional 99.42
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.42
PLN02679360 hydrolase, alpha/beta fold family protein 99.42
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.42
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.41
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.41
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.41
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.4
PLN02894402 hydrolase, alpha/beta fold family protein 99.39
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.38
PRK06489360 hypothetical protein; Provisional 99.38
PRK03204286 haloalkane dehalogenase; Provisional 99.38
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.38
COG0400207 Predicted esterase [General function prediction on 99.38
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.37
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.37
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.37
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.35
PLN02211273 methyl indole-3-acetate methyltransferase 99.35
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.34
COG2936 563 Predicted acyl esterases [General function predict 99.34
PRK10349256 carboxylesterase BioH; Provisional 99.34
PRK07581339 hypothetical protein; Validated 99.33
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.29
PLN02578354 hydrolase 99.29
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.28
PRK08775343 homoserine O-acetyltransferase; Provisional 99.28
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.25
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.22
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.18
KOG4667269 consensus Predicted esterase [Lipid transport and 99.18
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.17
KOG3101283 consensus Esterase D [General function prediction 99.17
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.16
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.15
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.12
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.11
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.11
PRK06765389 homoserine O-acetyltransferase; Provisional 99.09
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.04
KOG3043242 consensus Predicted hydrolase related to dienelact 99.02
COG0627316 Predicted esterase [General function prediction on 99.01
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 98.94
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.93
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.93
PRK05855 582 short chain dehydrogenase; Validated 98.93
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.92
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.9
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.88
COG4946668 Uncharacterized protein related to the periplasmic 98.87
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 98.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.81
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.81
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.8
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.78
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.74
PRK07868 994 acyl-CoA synthetase; Validated 98.73
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.72
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.68
KOG0293519 consensus WD40 repeat-containing protein [Function 98.66
COG4946668 Uncharacterized protein related to the periplasmic 98.66
COG4757281 Predicted alpha/beta hydrolase [General function p 98.64
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 98.62
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.62
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 98.61
PRK13616591 lipoprotein LpqB; Provisional 98.61
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.6
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.57
KOG2564343 consensus Predicted acetyltransferases and hydrola 98.54
KOG0293519 consensus WD40 repeat-containing protein [Function 98.51
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.51
COG4188365 Predicted dienelactone hydrolase [General function 98.51
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.51
PRK11028330 6-phosphogluconolactonase; Provisional 98.5
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.49
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.48
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.45
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.44
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.44
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.44
KOG2112206 consensus Lysophospholipase [Lipid transport and m 98.43
KOG2984277 consensus Predicted hydrolase [General function pr 98.42
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.4
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.4
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.39
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.38
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.38
KOG0279315 consensus G protein beta subunit-like protein [Sig 98.37
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.36
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.34
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.32
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.31
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.31
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.26
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 98.23
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.23
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 98.22
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 98.21
PTZ00421493 coronin; Provisional 98.19
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.19
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.19
PRK11028330 6-phosphogluconolactonase; Provisional 98.18
KOG0291893 consensus WD40-repeat-containing subunit of the 18 98.17
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.17
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.16
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.15
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.11
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.1
KOG0266456 consensus WD40 repeat-containing protein [General 98.09
KOG0291893 consensus WD40-repeat-containing subunit of the 18 98.09
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.08
PTZ00420568 coronin; Provisional 98.08
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.06
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.06
PRK10115686 protease 2; Provisional 98.05
KOG2314698 consensus Translation initiation factor 3, subunit 98.04
KOG0315311 consensus G-protein beta subunit-like protein (con 98.04
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.01
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 98.01
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.01
PRK13616591 lipoprotein LpqB; Provisional 98.01
PTZ00420568 coronin; Provisional 98.0
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.99
KOG2139445 consensus WD40 repeat protein [General function pr 97.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.95
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 97.94
KOG1516 545 consensus Carboxylesterase and related proteins [G 97.94
KOG2055514 consensus WD40 repeat protein [General function pr 97.93
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.93
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 97.85
PRK04940180 hypothetical protein; Provisional 97.83
KOG1407313 consensus WD40 repeat protein [Function unknown] 97.83
PTZ00421493 coronin; Provisional 97.79
KOG0772641 consensus Uncharacterized conserved protein, conta 97.78
KOG0266456 consensus WD40 repeat-containing protein [General 97.7
KOG1273405 consensus WD40 repeat protein [General function pr 97.69
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.68
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.67
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.63
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.62
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 97.62
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 97.6
KOG2096420 consensus WD40 repeat protein [General function pr 97.6
KOG2139445 consensus WD40 repeat protein [General function pr 97.57
COG3150191 Predicted esterase [General function prediction on 97.55
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.55
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.54
KOG0973 942 consensus Histone transcription regulator HIRA, WD 97.54
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.53
PLN00181793 protein SPA1-RELATED; Provisional 97.47
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 97.47
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 97.46
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.46
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.4
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 97.4
KOG2055514 consensus WD40 repeat protein [General function pr 97.4
KOG1273405 consensus WD40 repeat protein [General function pr 97.39
KOG0296399 consensus Angio-associated migratory cell protein 97.38
KOG0275508 consensus Conserved WD40 repeat-containing protein 97.32
PRK02888635 nitrous-oxide reductase; Validated 97.31
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.28
KOG0263707 consensus Transcription initiation factor TFIID, s 97.28
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.27
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.25
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 97.24
KOG2314698 consensus Translation initiation factor 3, subunit 97.2
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.19
KOG1407313 consensus WD40 repeat protein [Function unknown] 97.19
KOG4497447 consensus Uncharacterized conserved protein WDR8, 97.18
KOG2315566 consensus Predicted translation initiation factor 97.15
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.14
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.11
KOG0643327 consensus Translation initiation factor 3, subunit 97.11
KOG2048691 consensus WD40 repeat protein [General function pr 97.1
KOG0973 942 consensus Histone transcription regulator HIRA, WD 97.1
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.08
KOG0772641 consensus Uncharacterized conserved protein, conta 97.07
KOG1274 933 consensus WD40 repeat protein [General function pr 97.06
KOG0639705 consensus Transducin-like enhancer of split protei 97.03
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.03
KOG0275508 consensus Conserved WD40 repeat-containing protein 97.01
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.01
KOG2315566 consensus Predicted translation initiation factor 97.01
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.0
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 96.98
KOG0296399 consensus Angio-associated migratory cell protein 96.96
COG1770682 PtrB Protease II [Amino acid transport and metabol 96.95
KOG0289506 consensus mRNA splicing factor [General function p 96.93
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.92
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.91
COG4947227 Uncharacterized protein conserved in bacteria [Fun 96.88
KOG1274 933 consensus WD40 repeat protein [General function pr 96.88
KOG0279315 consensus G protein beta subunit-like protein [Sig 96.88
COG3391381 Uncharacterized conserved protein [Function unknow 96.87
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.86
KOG0286343 consensus G-protein beta subunit [General function 96.85
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 96.84
KOG0645312 consensus WD40 repeat protein [General function pr 96.82
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 96.81
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 96.78
KOG0283712 consensus WD40 repeat-containing protein [Function 96.78
PLN00181793 protein SPA1-RELATED; Provisional 96.73
KOG0286343 consensus G-protein beta subunit [General function 96.65
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 96.64
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.63
KOG0284464 consensus Polyadenylation factor I complex, subuni 96.61
KOG14451012 consensus Tumor-specific antigen (contains WD repe 96.6
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 96.59
KOG14451012 consensus Tumor-specific antigen (contains WD repe 96.58
KOG4840299 consensus Predicted hydrolases or acyltransferases 96.56
KOG0315311 consensus G-protein beta subunit-like protein (con 96.55
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 96.53
KOG0645312 consensus WD40 repeat protein [General function pr 96.52
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 96.45
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 96.44
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 96.44
KOG2237712 consensus Predicted serine protease [Posttranslati 96.43
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 96.42
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.4
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.4
KOG0282503 consensus mRNA splicing factor [Function unknown] 96.39
KOG0263707 consensus Transcription initiation factor TFIID, s 96.34
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.29
KOG0771398 consensus Prolactin regulatory element-binding pro 96.24
KOG0647347 consensus mRNA export protein (contains WD40 repea 96.2
KOG0771398 consensus Prolactin regulatory element-binding pro 96.19
KOG3967297 consensus Uncharacterized conserved protein [Funct 96.15
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.15
KOG0306888 consensus WD40-repeat-containing subunit of the 18 95.99
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 95.95
KOG2048 691 consensus WD40 repeat protein [General function pr 95.94
COG4782377 Uncharacterized protein conserved in bacteria [Fun 95.93
KOG0640430 consensus mRNA cleavage stimulating factor complex 95.92
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 95.89
KOG0282503 consensus mRNA splicing factor [Function unknown] 95.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 95.88
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 95.85
KOG1063764 consensus RNA polymerase II elongator complex, sub 95.77
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 95.73
KOG2110391 consensus Uncharacterized conserved protein, conta 95.71
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.7
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 95.62
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 95.55
KOG0639705 consensus Transducin-like enhancer of split protei 95.51
KOG0641350 consensus WD40 repeat protein [General function pr 95.49
PLN02209437 serine carboxypeptidase 95.48
KOG0640430 consensus mRNA cleavage stimulating factor complex 95.47
KOG1539910 consensus WD repeat protein [General function pred 95.33
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 95.32
KOG0265338 consensus U5 snRNP-specific protein-like factor an 95.32
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.27
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.26
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.21
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 95.2
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 95.15
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.11
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 95.11
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 95.05
COG3319257 Thioesterase domains of type I polyketide synthase 94.94
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 94.87
KOG0278334 consensus Serine/threonine kinase receptor-associa 94.85
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 94.77
KOG0303472 consensus Actin-binding protein Coronin, contains 94.75
KOG0310487 consensus Conserved WD40 repeat-containing protein 94.69
KOG2110391 consensus Uncharacterized conserved protein, conta 94.58
KOG3975301 consensus Uncharacterized conserved protein [Funct 94.54
KOG0643327 consensus Translation initiation factor 3, subunit 94.45
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.28
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 94.28
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 94.14
KOG0265338 consensus U5 snRNP-specific protein-like factor an 94.12
KOG0295406 consensus WD40 repeat-containing protein [Function 93.95
KOG0319775 consensus WD40-repeat-containing subunit of the 18 93.94
KOG0283712 consensus WD40 repeat-containing protein [Function 93.77
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 93.7
KOG0303472 consensus Actin-binding protein Coronin, contains 93.55
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 93.54
PRK102521296 entF enterobactin synthase subunit F; Provisional 93.27
KOG0288459 consensus WD40 repeat protein TipD [General functi 93.27
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.14
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 93.07
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 93.06
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 93.05
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 93.01
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.01
KOG0290364 consensus Conserved WD40 repeat-containing protein 92.85
COG1075336 LipA Predicted acetyltransferases and hydrolases w 92.83
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 92.83
KOG0278334 consensus Serine/threonine kinase receptor-associa 92.82
PRK13613599 lipoprotein LpqB; Provisional 92.79
KOG2106626 consensus Uncharacterized conserved protein, conta 92.77
KOG0290364 consensus Conserved WD40 repeat-containing protein 92.75
KOG0289506 consensus mRNA splicing factor [General function p 92.7
KOG0306888 consensus WD40-repeat-containing subunit of the 18 92.66
KOG0646476 consensus WD40 repeat protein [General function pr 92.61
KOG0284464 consensus Polyadenylation factor I complex, subuni 92.58
KOG2096420 consensus WD40 repeat protein [General function pr 92.56
KOG1539910 consensus WD repeat protein [General function pred 92.55
KOG4328498 consensus WD40 protein [Function unknown] 92.4
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 92.39
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 92.37
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 92.33
KOG0299479 consensus U3 snoRNP-associated protein (contains W 92.29
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 91.78
KOG14081080 consensus WD40 repeat protein [Function unknown] 91.76
KOG0288459 consensus WD40 repeat protein TipD [General functi 91.71
KOG2565469 consensus Predicted hydrolases or acyltransferases 91.37
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 91.3
KOG0316307 consensus Conserved WD40 repeat-containing protein 91.28
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 91.27
KOG4328498 consensus WD40 protein [Function unknown] 91.24
KOG0313423 consensus Microtubule binding protein YTM1 (contai 91.13
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 91.04
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 90.87
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.79
KOG0269 839 consensus WD40 repeat-containing protein [Function 90.78
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 90.57
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.4
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 90.32
KOG0302440 consensus Ribosome Assembly protein [General funct 90.11
KOG0269 839 consensus WD40 repeat-containing protein [Function 90.04
PRK13614573 lipoprotein LpqB; Provisional 89.91
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 89.73
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 89.71
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 89.61
KOG4283397 consensus Transcription-coupled repair protein CSA 89.43
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.33
PRK02888635 nitrous-oxide reductase; Validated 89.28
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 89.02
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 88.98
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 88.74
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 88.66
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 88.47
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 88.46
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 88.31
KOG0310487 consensus Conserved WD40 repeat-containing protein 88.23
COG3391381 Uncharacterized conserved protein [Function unknow 88.03
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 87.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 87.9
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 87.81
KOG0268433 consensus Sof1-like rRNA processing protein (conta 87.69
KOG2041 1189 consensus WD40 repeat protein [General function pr 87.62
COG3490366 Uncharacterized protein conserved in bacteria [Fun 87.51
PF03283361 PAE: Pectinacetylesterase 87.44
KOG0294362 consensus WD40 repeat-containing protein [Function 87.24
PLN02454414 triacylglycerol lipase 87.05
KOG0270463 consensus WD40 repeat-containing protein [Function 86.7
KOG3724 973 consensus Negative regulator of COPII vesicle form 86.55
KOG4283397 consensus Transcription-coupled repair protein CSA 86.44
PRK13615557 lipoprotein LpqB; Provisional 86.4
PLN02408365 phospholipase A1 85.76
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 85.71
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 85.69
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 85.57
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 85.43
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 85.37
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 84.74
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 84.57
PLN02571413 triacylglycerol lipase 84.56
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 84.38
KOG0308735 consensus Conserved WD40 repeat-containing protein 84.24
KOG4227609 consensus WD40 repeat protein [General function pr 83.78
KOG0302440 consensus Ribosome Assembly protein [General funct 83.6
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 83.45
PLN02324415 triacylglycerol lipase 83.41
KOG0294362 consensus WD40 repeat-containing protein [Function 83.22
KOG1963792 consensus WD40 repeat protein [General function pr 83.04
KOG0641350 consensus WD40 repeat protein [General function pr 82.7
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 82.43
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 82.08
PLN02802509 triacylglycerol lipase 81.66
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 81.47
KOG2321703 consensus WD40 repeat protein [General function pr 81.29
PLN02606306 palmitoyl-protein thioesterase 81.16
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 80.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 80.82
KOG0295406 consensus WD40 repeat-containing protein [Function 80.69
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 80.66
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-110  Score=850.95  Aligned_cols=612  Identities=50%  Similarity=0.888  Sum_probs=581.4

Q ss_pred             CHHHHhhccCCCCCCCCeEeCCEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEEecccccCCCCc
Q 006375            1 MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGF   80 (648)
Q Consensus         1 ~~~~~~~r~~~~~~s~p~~~g~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~lld~n~~~~~~~~   80 (648)
                      ||+||++|+++++.|+|.++|.|+||+|...|++|+++||....++                .++|+|||+|++++++++
T Consensus        65 if~Ei~~Rik~dd~Svp~~~~~~~Yy~r~~~g~~y~~~~R~~~~g~----------------~~eevlLD~n~~A~g~~f  128 (682)
T COG1770          65 IFEEIKGRIKEDDLSVPYRKGPYEYYSRTEEGKEYPIYCRQPDEGG----------------EGEEVLLDVNKEAEGHDF  128 (682)
T ss_pred             HHHHHhhhccCcCCCCccccCCeeEEEEecCCCcceeEEeccCCCC----------------CceeEeecchhccCcccc
Confidence            6899999999999999999999999999999999999999765431                258999999999999999


Q ss_pred             EEEeeEEeCCCCCEEEEEEeCCCCeEEEEEEEECCCCCeeeccccCccceeEEecCC-eEEEEEeCCCCCCceEEEEECC
Q 006375           81 YSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGVTASVEWAGNE-ALVYITMDEILRPDKAWLHKLE  159 (648)
Q Consensus        81 ~~~~~~~~SPDG~~la~~~~~~G~e~~~l~v~dl~~g~~~~~~~~~~~~~~~WspDg-~l~y~~~~~~~~~~~l~~~~l~  159 (648)
                      ++++.+++|||+++|||+.|..|+|+++|+++|+++|+..++.+.++..+++|.+|+ ++||++.++..++.+||+|.++
T Consensus       129 ~~Lg~~~~s~D~~~la~s~D~~G~e~y~lr~kdL~tg~~~~d~i~~~~~~~~Wa~d~~~lfYt~~d~~~rp~kv~~h~~g  208 (682)
T COG1770         129 FSLGAASISPDHNLLAYSVDVLGDEQYTLRFKDLATGEELPDEITNTSGSFAWAADGKTLFYTRLDENHRPDKVWRHRLG  208 (682)
T ss_pred             eeeeeeeeCCCCceEEEEEecccccEEEEEEEecccccccchhhcccccceEEecCCCeEEEEEEcCCCCcceEEEEecC
Confidence            999999999999999999999999999999999999999998888888889999999 9999999998999999999999


Q ss_pred             CCCCCcEEEEeecCCCeEEEEEeCCCCcEEEEEEccccccEEEEEECCCCC-ceeEeeecccceeeeEeecCCEEEEEec
Q 006375          160 ADQSNDICLYHEKDDIYSLGLQASESKKFLFIASESKITRFVFYLDVSKPE-ELRVLTPRVVGVDTAASHRGNHFFITRR  238 (648)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~s~Dg~~l~~~~~~~~~~~l~~~dl~~~~-~~~~l~~~~~~~~~~~s~dg~~l~~~~~  238 (648)
                      ++.+.+++||++.++.|++++..|.+.++|++..++..++++++++.+.++ .++.+.++..+++|.+.+.|+.+|+.+|
T Consensus       209 t~~~~d~lvyeE~d~~f~~~v~~s~s~~yi~i~~~~~~tsE~~ll~a~~p~~~p~vv~pr~~g~eY~~eh~~d~f~i~sN  288 (682)
T COG1770         209 TPGSSDELVYEEKDDRFFLSVGRSRSEAYIVISLGSHITSEVRLLDADDPEAEPKVVLPRENGVEYSVEHGGDRFYILSN  288 (682)
T ss_pred             CCCCcceEEEEcCCCcEEEEeeeccCCceEEEEcCCCcceeEEEEecCCCCCceEEEEEcCCCcEEeeeecCcEEEEEec
Confidence            988899999999999999999999999999999999999999999999887 6788999999999999999999999999


Q ss_pred             cCCCCCcEEEEEeCCCCCccee--EecCCCCcccceEEEeCCEEEEEEecCCeeEEEEEEcCCCCCcccccCCCceeecC
Q 006375          239 SDELFNSELLACPVDNTSETTV--LIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPLKSLQGGKSVEFI  316 (648)
Q Consensus       239 ~~~~~~~~l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~v~~~~~~g~~~~~l~~~~~i~~~  316 (648)
                      .++ .|++|++.++ .+....|  ++++.++..+.++..+.+++++.+++++.+++++.+... ++       ...|.|+
T Consensus       289 ~~g-knf~l~~ap~-~~~~~~w~~~I~h~~~~~l~~~~~f~~~lVl~eR~~glp~v~v~~~~~-~~-------~~~i~f~  358 (682)
T COG1770         289 ADG-KNFKLVRAPV-SADKSNWRELIPHREDVRLEGVDLFADHLVLLERQEGLPRVVVRDRKT-GE-------ERGIAFD  358 (682)
T ss_pred             CCC-cceEEEEccC-CCChhcCeeeeccCCCceeeeeeeeccEEEEEecccCCceEEEEecCC-Cc-------eeeEEec
Confidence            854 8999999998 5566677  899999999999999999999999999999999998864 22       2568899


Q ss_pred             CCeeeee-CCCCcccccEEEEEEeeCCCCCEEEEEECCCCcEEEEEEeeecCCCCCCCcceEEEEEeCCCCeEEeEEEEE
Q 006375          317 DPVYSID-PSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVY  395 (648)
Q Consensus       317 ~~~~~v~-~~~~~~~~~~l~~~~ss~~~P~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~g~~i~~~l~~  395 (648)
                      ++.++.. +.+.+++++.++|.++|+++|.++|.||+.++++++++.++++++|+++.|.+++++++..||++||+.|++
T Consensus       359 ~~ay~~~l~~~~e~~s~~lR~~ysS~ttP~~~~~~dm~t~er~~LkqqeV~~g~dp~~Y~s~riwa~a~dgv~VPVSLvy  438 (682)
T COG1770         359 DEAYSAGLSGNPEFDSDRLRYSYSSMTTPATLFDYDMATGERTLLKQQEVPGGFDPEDYVSRRIWATADDGVQVPVSLVY  438 (682)
T ss_pred             chhhhccccCCCCCCCccEEEEeecccccceeEEeeccCCcEEEEEeccCCCCCChhHeEEEEEEEEcCCCcEeeEEEEE
Confidence            9888765 577889999999999999999999999999999999999888888999999999999999999999999999


Q ss_pred             eeCccccCCCCcEEEEecCCCCCCCCCCCchhHHHHHHCCCEEEEEccCCCCCCChhhhhcccccCCCCcHhHHHHHHHH
Q 006375          396 RKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEY  475 (648)
Q Consensus       396 ~~~~~~~~~~~P~vl~~hGg~~~~~~~~~~~~~~~l~~~G~~v~~~~~rG~g~~g~~~~~~~~~~~~~~~~~D~~~~~~~  475 (648)
                      +++. +.+++.|++|++||+||.++.+.|+..++.|++||++.+++|+||||+.|+.|+++|+..+|+|+|+||++|+++
T Consensus       439 rkd~-~~~g~~p~lLygYGaYG~s~~p~Fs~~~lSLlDRGfiyAIAHVRGGgelG~~WYe~GK~l~K~NTf~DFIa~a~~  517 (682)
T COG1770         439 RKDT-KLDGSAPLLLYGYGAYGISMDPSFSIARLSLLDRGFVYAIAHVRGGGELGRAWYEDGKLLNKKNTFTDFIAAARH  517 (682)
T ss_pred             eccc-CCCCCCcEEEEEeccccccCCcCcccceeeeecCceEEEEEEeecccccChHHHHhhhhhhccccHHHHHHHHHH
Confidence            9997 788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHcCCCCCCeEEEEeeChhHHHHHHHHhhCCCceeEEEecCCcccccccccCCCCCCCcccccccCCCCCHHHHHHHHc
Q 006375          476 LIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEEFYFYMKS  555 (648)
Q Consensus       476 l~~~~~~d~~~i~i~G~S~GG~l~~~~~~~~p~~~~a~v~~~~~~d~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~  555 (648)
                      |++++++++++|+++|+|+||+||+++++++|++|+++|+.+||+|++++|+++++|++..+|.|||+|.+++.+++|++
T Consensus       518 Lv~~g~~~~~~i~a~GGSAGGmLmGav~N~~P~lf~~iiA~VPFVDvltTMlD~slPLT~~E~~EWGNP~d~e~y~yikS  597 (682)
T COG1770         518 LVKEGYTSPDRIVAIGGSAGGMLMGAVANMAPDLFAGIIAQVPFVDVLTTMLDPSLPLTVTEWDEWGNPLDPEYYDYIKS  597 (682)
T ss_pred             HHHcCcCCccceEEeccCchhHHHHHHHhhChhhhhheeecCCccchhhhhcCCCCCCCccchhhhCCcCCHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCCCCeEEEeecCCCCccCCchHHHHHHHHHhcCCCCCeEEEEecCCCCccCCCchHHHHHHHHHHHHHHHH
Q 006375          556 YSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMR  635 (648)
Q Consensus       556 ~sp~~~~~~~~~P~~li~~g~~D~~v~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~gH~~~~~~~~~~~~~~~~~~fl~~  635 (648)
                      ||||+|++...||++|+++|.+|++|.+|++.|++++|+..+.+..+++++++|++||++.+++.+.+++.|++++|+.+
T Consensus       598 YSPYdNV~a~~YP~ilv~~Gl~D~rV~YwEpAKWvAkLR~~~td~~plLlkt~M~aGHgG~SgRf~~lee~A~eYaF~l~  677 (682)
T COG1770         598 YSPYDNVEAQPYPAILVTTGLNDPRVQYWEPAKWVAKLRELKTDGNPLLLKTNMDAGHGGASGRFQRLEEIAFEYAFLLK  677 (682)
T ss_pred             cCchhccccCCCCceEEEccccCCccccchHHHHHHHHhhcccCCCcEEEEecccccCCCCCCchHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCC
Q 006375          636 ALSM  639 (648)
Q Consensus       636 ~l~~  639 (648)
                      .++.
T Consensus       678 ~~~~  681 (682)
T COG1770         678 LAGT  681 (682)
T ss_pred             hccC
Confidence            8874

>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
2xe4_A751 Structure Of Oligopeptidase B From Leishmania Major 1e-132
3iun_A693 Appep_d622n Opened State Length = 693 2e-58
3mun_A693 Appep_pepclose Closed State Length = 693 3e-58
3iuj_A693 Appep_wt2 Opened State Length = 693 4e-57
3ivm_A693 Appep_wt+pp Closed State Length = 693 4e-57
2bkl_A695 Structural And Mechanistic Analysis Of Two Prolyl E 2e-52
1yr2_A741 Structural And Mechanistic Analysis Of Two Prolyl E 2e-49
3ddu_A709 Prolyl Oligopeptidase With Gsk552 Length = 709 6e-42
1qfm_A710 Prolyl Oligopeptidase From Porcine Muscle Length = 1e-41
1qfs_A710 Prolyl Oligopeptidase From Porcine Muscle With Cova 3e-41
1vz2_A710 Prolyl Oligopeptidase From Porcine Brain, Y73c/v427 5e-41
1vz3_A710 Prolyl Oligopeptidase From Porcine Brain, T597c Mut 6e-41
1e8m_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant, C 7e-41
1h2x_A710 Prolyl Oligopeptidase From Porcine Brain, Y473f Mut 9e-41
1o6g_A710 Prolyl Oligopeptidase From Porcine Brain, D641n Mut 9e-41
1e5t_A710 Prolyl Oligopeptidase From Porcine Brain, Mutant Le 1e-40
1o6f_A710 Prolyl Oligopeptidase From Porcine Brain, D641a Mut 2e-40
4ax4_A710 Prolyl Oligopeptidase From Porcine Brain, H680a Mut 5e-40
4hvt_A711 Structure Of A Post-Proline Cleaving Enzyme From Ri 3e-35
1ve6_A582 Crystal Structure Of An Acylpeptide HydrolaseESTERA 4e-04
3o4h_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 4e-04
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 4e-04
2qzp_A562 Crystal Structure Of Mutation Of An Acylptide Hydro 4e-04
2hu8_A582 Binding Of Inhibitors By Acylaminoacyl Peptidase Le 8e-04
>pdb|2XE4|A Chain A, Structure Of Oligopeptidase B From Leishmania Major Length = 751 Back     alignment and structure 
Iteration: 1

 Score =  469 bits (1207), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 269/649 (41%), Positives = 374/649 (57%), Gaps = 25/649 (3%)
Query: 1   MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGP 60
           ++AE    I ++D+SAP+  G Y YYTR ++GK Y  +CR           V    E G 
Sbjct: 106 IYAEHISHINEDDMSAPYVYGKYRYYTREVKGKPYKIYCR-----------VFTDKEPG- 153
Query: 61  DAPPEHLILDENVKAEGRGFYSVGCFQ-VSPDNKLVAYAEDTKGDEIYTVYVIDI-ETGT 118
           D   E +I+D N  AEG+ F  V   +   P++ LVA++ D  G+E+YT+    I +   
Sbjct: 154 DVAAEEVIIDVNQVAEGKAFCDVMEVKPAPPEHDLVAFSVDMSGNEVYTIEFKRISDPSQ 213
Query: 119 PVGKPLVGVTASVEWAGNE-ALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYS 177
            +   + G    + W  +  +L Y+T DE LR +K W H +   QS D+CLY E + ++S
Sbjct: 214 TIADKVSGTNGEIVWGPDHTSLFYVTKDETLRENKVWRHVMGKLQSEDVCLYEEHNPLFS 273
Query: 178 LGLQASESKKFLFIASESKITRFVFYLDVSKPEE---LRVLTPRVVGVD-TAASHRGNHF 233
             +  +     L I S+S  T  V  LD+ K      L ++ PR  GV      H  +H 
Sbjct: 274 AFMYKAADTNTLCIGSQSPETAEVHLLDLRKGNAHNTLEIVRPREKGVRYDVQMHGTSHL 333
Query: 234 FITRRSDELFNSELLACPVDNTSE-TTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKI 292
            I        N +LL  P    S+ + VL+ H E V ++ I +  ++L V  R  GL +I
Sbjct: 334 VILTNEGGAVNHKLLIAPRGQPSDWSHVLVDHSEDVFMESIAVRSNYLVVAGRRAGLTRI 393
Query: 293 TTYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESV---FSSRILRFHYSSLRTPPSVYD 349
            T    +     K+  G + V   +P++++   ES    +     R  YSSL TP + +D
Sbjct: 394 WTMMADSQDGVFKAGTGLREVVMEEPIFTVHLVESQMLEYEEPTFRMEYSSLATPNTWFD 453
Query: 350 YDMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLL 409
                      K+  V GGFD  NY  ER++A+A D T+IP+ +VY K+L  +    P +
Sbjct: 454 VSPQDHSRTAVKVREVGGGFDAANYKVERRFATAPDQTKIPLSVVYHKDL-DMSQPQPCM 512
Query: 410 LYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENG-KFLKKKNTFTD 468
           LYGYGSY +  DP F+   L   DRG IFAIA IRGG ELGR WYE G K+L K+NTF+D
Sbjct: 513 LYGYGSYGLSMDPQFSIQHLPYCDRGMIFAIAHIRGGSELGRAWYEIGAKYLTKRNTFSD 572
Query: 469 FIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLD 528
           FIA AE+L+     T  +L  EGRSAGGLL+GAVLNMRPDLFK A+A VPFVDV+TTM D
Sbjct: 573 FIAAAEFLVNAKLTTPSQLACEGRSAGGLLMGAVLNMRPDLFKVALAGVPFVDVMTTMCD 632
Query: 529 PTIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAK 588
           P+IPLTT EWEEWG+P + ++Y YM SYSP+DNV+AQ YP+I+V  GL+DPRV Y EPAK
Sbjct: 633 PSIPLTTGEWEEWGNPNEYKYYDYMLSYSPMDNVRAQEYPNIMVQCGLHDPRVAYWEPAK 692
Query: 589 FVAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRAL 637
           +V+KLRE KTD+N +L   ++ +GHFS   R++  +E+A    F+ + L
Sbjct: 693 WVSKLRECKTDNNEILLNIDMESGHFSAKDRYKFWKESAIQQAFVCKHL 741
>pdb|3IUN|A Chain A, Appep_d622n Opened State Length = 693 Back     alignment and structure
>pdb|3MUN|A Chain A, Appep_pepclose Closed State Length = 693 Back     alignment and structure
>pdb|3IUJ|A Chain A, Appep_wt2 Opened State Length = 693 Back     alignment and structure
>pdb|3IVM|A Chain A, Appep_wt+pp Closed State Length = 693 Back     alignment and structure
>pdb|2BKL|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 695 Back     alignment and structure
>pdb|1YR2|A Chain A, Structural And Mechanistic Analysis Of Two Prolyl Endopeptidases: Role Of Inter-Domain Dynamics In Catalysis And Specificity Length = 741 Back     alignment and structure
>pdb|3DDU|A Chain A, Prolyl Oligopeptidase With Gsk552 Length = 709 Back     alignment and structure
>pdb|1QFM|A Chain A, Prolyl Oligopeptidase From Porcine Muscle Length = 710 Back     alignment and structure
>pdb|1QFS|A Chain A, Prolyl Oligopeptidase From Porcine Muscle With Covalently Bound Inhibitor Z-Pro-Prolinal Length = 710 Back     alignment and structure
>pdb|1VZ2|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y73c/v427c/c255t Mutant Length = 710 Back     alignment and structure
>pdb|1VZ3|A Chain A, Prolyl Oligopeptidase From Porcine Brain, T597c Mutant Length = 710 Back     alignment and structure
>pdb|1E8M|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant, Complexed With Inhibitor Length = 710 Back     alignment and structure
>pdb|1H2X|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Y473f Mutant Length = 710 Back     alignment and structure
>pdb|1O6G|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641n Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|1E5T|A Chain A, Prolyl Oligopeptidase From Porcine Brain, Mutant Length = 710 Back     alignment and structure
>pdb|1O6F|A Chain A, Prolyl Oligopeptidase From Porcine Brain, D641a Mutant With Bound Peptide Ligand Suc-Gly-Pro Length = 710 Back     alignment and structure
>pdb|4AX4|A Chain A, Prolyl Oligopeptidase From Porcine Brain, H680a Mutant Length = 710 Back     alignment and structure
>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From Rickettsia Typhi Length = 711 Back     alignment and structure
>pdb|1VE6|A Chain A, Crystal Structure Of An Acylpeptide HydrolaseESTERASE FROM Aeropyrum Pernix K1 Length = 582 Back     alignment and structure
>pdb|3O4H|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|2QZP|A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1 Length = 562 Back     alignment and structure
>pdb|2HU8|A Chain A, Binding Of Inhibitors By Acylaminoacyl Peptidase Length = 582 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 0.0
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 0.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 0.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 0.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 0.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 7e-29
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 8e-26
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 1e-12
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 3e-12
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 2e-11
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 2e-10
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 1e-09
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 2e-09
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 3e-08
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 6e-08
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 1e-07
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 2e-07
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 5e-07
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 6e-07
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 8e-07
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 6e-05
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 5e-04
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 8e-04
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Length = 751 Back     alignment and structure
 Score =  858 bits (2220), Expect = 0.0
 Identities = 266/658 (40%), Positives = 371/658 (56%), Gaps = 25/658 (3%)

Query: 2   FAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPD 61
           +AE    I ++D+SAP+  G Y YYTR ++GK Y  +CR                    D
Sbjct: 107 YAEHISHINEDDMSAPYVYGKYRYYTREVKGKPYKIYCRVFTDK------------EPGD 154

Query: 62  APPEHLILDENVKAEGRGFYSVGCFQ-VSPDNKLVAYAEDTKGDEIYTVYVIDIET-GTP 119
              E +I+D N  AEG+ F  V   +   P++ LVA++ D  G+E+YT+    I      
Sbjct: 155 VAAEEVIIDVNQVAEGKAFCDVMEVKPAPPEHDLVAFSVDMSGNEVYTIEFKRISDPSQT 214

Query: 120 VGKPLVGVTASVEWAG-NEALVYITMDEILRPDKAWLHKLEADQSNDICLYHEKDDIYSL 178
           +   + G    + W   + +L Y+T DE LR +K W H +   QS D+CLY E + ++S 
Sbjct: 215 IADKVSGTNGEIVWGPDHTSLFYVTKDETLRENKVWRHVMGKLQSEDVCLYEEHNPLFSA 274

Query: 179 GLQASESKKFLFIASESKITRFVFYLDVSKPE---ELRVLTPRVVGVD-TAASHRGNHFF 234
            +  +     L I S+S  T  V  LD+ K      L ++ PR  GV      H  +H  
Sbjct: 275 FMYKAADTNTLCIGSQSPETAEVHLLDLRKGNAHNTLEIVRPREKGVRYDVQMHGTSHLV 334

Query: 235 ITRRSDELFNSELLACPVDNTSE-TTVLIPHRESVKLQDIQLFIDHLAVYEREGGLQKIT 293
           I        N +LL  P    S+ + VL+ H E V ++ I +  ++L V  R  GL +I 
Sbjct: 335 ILTNEGGAVNHKLLIAPRGQPSDWSHVLVDHSEDVFMESIAVRSNYLVVAGRRAGLTRIW 394

Query: 294 TYRLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESV---FSSRILRFHYSSLRTPPSVYDY 350
           T    +     K+  G + V   +P++++   ES    +     R  YSSL TP + +D 
Sbjct: 395 TMMADSQDGVFKAGTGLREVVMEEPIFTVHLVESQMLEYEEPTFRMEYSSLATPNTWFDV 454

Query: 351 DMDMGISVLKKIETVLGGFDTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLL 410
                     K+  V GGFD  NY  ER++A+A D T+IP+ +VY K+L  +    P +L
Sbjct: 455 SPQDHSRTAVKVREVGGGFDAANYKVERRFATAPDQTKIPLSVVYHKDL-DMSQPQPCML 513

Query: 411 YGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENG-KFLKKKNTFTDF 469
           YGYGSY +  DP F+   L   DRG IFAIA IRGG ELGR WYE G K+L K+NTF+DF
Sbjct: 514 YGYGSYGLSMDPQFSIQHLPYCDRGMIFAIAHIRGGSELGRAWYEIGAKYLTKRNTFSDF 573

Query: 470 IACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDP 529
           IA AE+L+     T  +L  EGRSAGGLL+GAVLNMRPDLFK A+A VPFVDV+TTM DP
Sbjct: 574 IAAAEFLVNAKLTTPSQLACEGRSAGGLLMGAVLNMRPDLFKVALAGVPFVDVMTTMCDP 633

Query: 530 TIPLTTAEWEEWGDPWKEEFYFYMKSYSPVDNVKAQNYPHILVTAGLNDPRVMYSEPAKF 589
           +IPLTT EWEEWG+P + ++Y YM SYSP+DNV+AQ YP+I+V  GL+DPRV Y EPAK+
Sbjct: 634 SIPLTTGEWEEWGNPNEYKYYDYMLSYSPMDNVRAQEYPNIMVQCGLHDPRVAYWEPAKW 693

Query: 590 VAKLREMKTDDNILLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSMLPSVGSEQ 647
           V+KLRE KTD+N +L   ++ +GHFS   R++  +E+A    F+ + L     +   +
Sbjct: 694 VSKLRECKTDNNEILLNIDMESGHFSAKDRYKFWKESAIQQAFVCKHLKSTVRLLVRR 751
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Length = 693 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Length = 695 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Length = 710 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Length = 741 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Length = 615 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 100.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.93
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.92
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.91
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.9
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.89
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.89
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.89
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.88
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.88
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.88
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.88
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.87
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.87
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.87
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.87
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.87
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.87
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.86
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.86
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.86
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.86
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.85
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.85
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.85
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.85
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.85
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.85
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.84
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.84
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.84
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.84
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.84
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.84
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.84
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.84
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.83
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.83
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.83
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.83
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.83
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.83
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.82
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.82
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.82
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.82
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.81
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.81
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.81
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.81
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.8
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.8
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.8
3h04_A275 Uncharacterized protein; protein with unknown func 99.8
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.8
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.79
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.79
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.78
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.78
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.78
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.78
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.77
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.77
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.76
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.76
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.75
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.75
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.74
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.74
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.74
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.74
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.74
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.74
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.74
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.73
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.73
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.73
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.72
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.71
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.71
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.71
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.71
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.71
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.7
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.7
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.7
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.7
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.7
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.7
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.7
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.7
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.69
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.68
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.68
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.68
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.68
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.68
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.67
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.67
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.67
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.66
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.66
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.66
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.65
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.65
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.65
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.65
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.64
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.64
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.64
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.64
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.64
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.64
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.63
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.63
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.63
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.63
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.62
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.62
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.62
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.62
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.62
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.61
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.61
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.61
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.61
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.61
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.61
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.61
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.6
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.6
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.6
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.6
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.6
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.59
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.59
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.59
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.59
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.59
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.59
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.59
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.58
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.58
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.58
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.56
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.56
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.56
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.55
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.55
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.55
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.54
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.54
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.54
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.53
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.53
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.53
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.53
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.53
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.53
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.52
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.52
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.52
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.52
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.52
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.51
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.51
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.51
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.51
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.51
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.51
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.51
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.51
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.49
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.49
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.49
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.49
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.49
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.48
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.48
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.48
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.47
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.47
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.47
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.47
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.46
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.46
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.46
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.46
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.45
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.43
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.15
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.42
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.42
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.42
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.42
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.41
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.41
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.41
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.41
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.4
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.4
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.39
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.38
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.37
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.36
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.35
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.35
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.33
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.33
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.31
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.31
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.28
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.27
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.26
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.26
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.26
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.22
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.21
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.21
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.17
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.17
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.15
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.15
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.15
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.14
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.12
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.11
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.1
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.1
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.09
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.09
3lp5_A250 Putative cell surface hydrolase; structural genom 99.09
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.08
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.08
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.06
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.05
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.04
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.04
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.03
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.02
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.01
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.0
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.98
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.96
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.94
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.94
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.93
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.91
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.9
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.89
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.88
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.88
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.87
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.86
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.86
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.85
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.83
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.81
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.81
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.8
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.79
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.79
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.78
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.78
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.78
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.77
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.75
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.74
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.74
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.73
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.73
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.73
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.73
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.72
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.71
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.71
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.7
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.69
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.69
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.67
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.66
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.65
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.64
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.64
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.63
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.63
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.61
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.6
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.6
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.59
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.59
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.59
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.59
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.58
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.57
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.56
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.55
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.55
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 98.55
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.54
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.52
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.49
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.47
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.46
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.43
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.42
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.42
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.41
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.41
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.41
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.4
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 98.4
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.4
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.39
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.39
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.39
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.38
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.38
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.37
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.37
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.37
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.36
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.34
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 98.33
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.33
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.32
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 98.32
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.31
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.31
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.31
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.3
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.3
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.3
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.29
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.29
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.29
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.27
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 98.25
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.25
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.24
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.23
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.22
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.22
3jrp_A379 Fusion protein of protein transport protein SEC13 98.21
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.21
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.2
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.2
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.19
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 98.18
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.17
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.17
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.16
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.16
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.16
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.16
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.15
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 98.14
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.13
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.13
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 98.13
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.1
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.1
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 98.09
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.07
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.07
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.07
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.06
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 98.05
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.05
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.03
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 98.03
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 98.02
2ece_A462 462AA long hypothetical selenium-binding protein; 98.01
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 98.01
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 98.0
2pm7_B297 Protein transport protein SEC13, protein transport 97.99
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.98
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.94
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.93
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.93
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.92
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.91
2ece_A462 462AA long hypothetical selenium-binding protein; 97.91
3jro_A 753 Fusion protein of protein transport protein SEC13 97.91
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.91
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.89
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.86
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.86
4e54_B435 DNA damage-binding protein 2; beta barrel, double 97.86
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.84
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.84
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.83
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.82
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.8
3v65_B386 Low-density lipoprotein receptor-related protein; 97.79
3jrp_A379 Fusion protein of protein transport protein SEC13 97.78
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.76
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.75
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.73
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.72
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.71
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.68
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.67
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.66
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.64
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.64
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.6
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 97.58
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.58
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 97.58
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.56
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.56
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.56
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.55
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.54
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.53
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.51
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.51
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.48
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 97.48
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.46
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.46
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.45
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.45
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.45
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.45
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 97.44
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.42
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.41
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.4
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.4
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.39
3v65_B386 Low-density lipoprotein receptor-related protein; 97.34
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.32
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.31
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.24
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.22
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.21
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 97.21
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.2
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.19
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.19
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.18
2pm7_B297 Protein transport protein SEC13, protein transport 97.14
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.13
3jro_A 753 Fusion protein of protein transport protein SEC13 97.13
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 97.12
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.12
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.08
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.08
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.03
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.0
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.96
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.93
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.87
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.84
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 96.8
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.75
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 96.72
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.67
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 96.64
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 96.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.6
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.6
2qe8_A343 Uncharacterized protein; structural genomics, join 96.59
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.52
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.51
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 96.48
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.43
2fp8_A322 Strictosidine synthase; six bladed beta propeller 96.42
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.41
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.41
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.41
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.37
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.29
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.28
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 96.26
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.25
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.25
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 96.14
2qe8_A343 Uncharacterized protein; structural genomics, join 96.12
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.08
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-83  Score=724.52  Aligned_cols=605  Identities=27%  Similarity=0.474  Sum_probs=513.1

Q ss_pred             CHHHHhhccCCCCCCCCeEeCCEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEEecccccCCCCc
Q 006375            1 MFAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGF   80 (648)
Q Consensus         1 ~~~~~~~r~~~~~~s~p~~~g~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~lld~n~~~~~~~~   80 (648)
                      |++||++|+.+++.++|.++|+|+||+++.++++|+++||+...                  ++++||||+|+++++ ++
T Consensus        68 l~~~~~~~~~~~~~~~p~~~g~~~y~~~~~~~~~~~~~~r~~~~------------------~~~~vllD~n~la~~-~~  128 (693)
T 3iuj_A           68 IKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQNQNVLWRQQEG------------------KPAEVFLDPNTLSPD-GT  128 (693)
T ss_dssp             HHHHHHHHSCCCEECCCEEETTEEEEEEECSSCSSCEEEEECTT------------------SCCEEEECGGGGSTT-SC
T ss_pred             HHHHHHHhhccccCCCCEEECCEEEEEEEcCCCceeEEEEeCCC------------------CCcEEEEehhhccCC-Cc
Confidence            57899999999999999999999999999999999999997532                  467999999999986 67


Q ss_pred             EEEeeEEeCCCCCEEEEEEeCCCCeEEEEEEEECCCCCeeeccccCc-cceeEEecCC-eEEEEEeCCC--------CCC
Q 006375           81 YSVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGV-TASVEWAGNE-ALVYITMDEI--------LRP  150 (648)
Q Consensus        81 ~~~~~~~~SPDG~~la~~~~~~G~e~~~l~v~dl~~g~~~~~~~~~~-~~~~~WspDg-~l~y~~~~~~--------~~~  150 (648)
                      +.+.+++|||||++|||+.+..|+++.+|+++|++||+.+.+.++++ ...++|+ || +|+|++.+..        +++
T Consensus       129 ~~l~~~~~SpDg~~lAy~~~~~G~~~~~i~v~dl~tg~~~~~~~~~~k~~~~~Ws-Dg~~l~y~~~~~~~~~~~~~~~~~  207 (693)
T 3iuj_A          129 TALDQLSFSRDGRILAYSLSLAGSDWREIHLMDVESKQPLETPLKDVKFSGISWL-GNEGFFYSSYDKPDGSELSARTDQ  207 (693)
T ss_dssp             CEEEEEEECTTSSEEEEEEECSSCCEEEEEEEETTTCSEEEEEEEEEESCCCEEE-TTTEEEEEESSCCC-------CCC
T ss_pred             EEEEEEEECCCCCEEEEEEecCCCceEEEEEEECCCCCCCccccCCceeccEEEe-CCCEEEEEEecCcccccccccCCC
Confidence            89999999999999999999999999999999999999887777766 5779999 99 9999998754        678


Q ss_pred             ceEEEEECCCCCCCcEEEEeecC--CCeEEEEEeCCCCcEEEEEEccccc-cEEEEEECCCCC-ceeEeeecccceeeeE
Q 006375          151 DKAWLHKLEADQSNDICLYHEKD--DIYSLGLQASESKKFLFIASESKIT-RFVFYLDVSKPE-ELRVLTPRVVGVDTAA  226 (648)
Q Consensus       151 ~~l~~~~l~~~~~~~~~~~~~~~--~~~~~~~~~s~Dg~~l~~~~~~~~~-~~l~~~dl~~~~-~~~~l~~~~~~~~~~~  226 (648)
                      .+||+|++++++.++++++++.+  +.+..++.|||||++|++.+.+... ++||++|++++. .++.+..+.....+.+
T Consensus       208 ~~v~~~~lgt~~~~~~~v~~~~~~~~~~~~~~~~SpDg~~l~~~~~~~~~~~~i~~~d~~~~~~~~~~l~~~~~~~~~~~  287 (693)
T 3iuj_A          208 HKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLISAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLV  287 (693)
T ss_dssp             CEEEEEETTSCGGGCEEEESCSGGGCCSEEEEEECTTSCEEEEEEESSSSCCEEEEEETTSTTCCCEEEECSSSSCEEEE
T ss_pred             cEEEEEECCCCcccceEEEecCCCCCeEEEEEEEcCCCCEEEEEEccCCCCcEEEEEECCCCCCceEEEeCCCCceEEEE
Confidence            89999999999888899998865  5567789999999999998766544 699999998874 3777877766555569


Q ss_pred             eecCCEEEEEeccCCCCCcEEEEEeCCCCCccee--EecCCCCcccceEEEeCCEEEEEEecCCeeEEEEEEcCCCCCcc
Q 006375          227 SHRGNHFFITRRSDELFNSELLACPVDNTSETTV--LIPHRESVKLQDIQLFIDHLAVYEREGGLQKITTYRLPAVGEPL  304 (648)
Q Consensus       227 s~dg~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~v~~~~~~g~~~  304 (648)
                      +++|++|||+++. ++++++|++++++++....|  ++++.... + +++++++++++...+++..+|++++++  ++..
T Consensus       288 ~~~g~~l~~~t~~-~~~~~~l~~~d~~~~~~~~~~~l~~~~~~~-~-~~s~~g~~lv~~~~~~g~~~l~~~d~~--g~~~  362 (693)
T 3iuj_A          288 DNKGSTLYLLTNR-DAPNRRLVTVDAANPGPAHWRDLIPERQQV-L-TVHSGSGYLFAEYMVDATARVEQFDYE--GKRV  362 (693)
T ss_dssp             EEETTEEEEEECT-TCTTCEEEEEETTSCCGGGCEEEECCCSSC-E-EEEEETTEEEEEEEETTEEEEEEECTT--SCEE
T ss_pred             eccCCEEEEEECC-CCCCCEEEEEeCCCCCccccEEEecCCCCE-E-EEEEECCEEEEEEEECCeeEEEEEECC--CCee
Confidence            9999999999997 56789999999987554334  77776654 5 999999999999999999999999887  4432


Q ss_pred             cccCCCceeecCCCeeeeeCCCCcccccEEEEEEeeCCCCCEEEEEECCCCcEEEEEEeeecCCCCCCCcceEEEEEeCC
Q 006375          305 KSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGISVLKKIETVLGGFDTNNYFTERKWASAS  384 (648)
Q Consensus       305 ~~l~~~~~i~~~~~~~~v~~~~~~~~~~~l~~~~ss~~~P~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~  384 (648)
                            +.+.+|+.. .+.+++.+++++.++|.++|+++|+++|.+|+.+++.++++.  ....+++..+.++++++++.
T Consensus       363 ------~~l~~p~~~-~~~~~~~~~d~~~l~~~~ss~~tP~~l~~~d~~~g~~~~l~~--~~~~~~~~~~~~~~~~~~~~  433 (693)
T 3iuj_A          363 ------REVALPGLG-SVSGFNGKHDDPALYFGFENYAQPPTLYRFEPKSGAISLYRA--SAAPFKPEDYVSEQRFYQSK  433 (693)
T ss_dssp             ------EEECCSSSS-EEEECCCCTTCSCEEEEEECSSSCCEEEEECTTTCCEEEEEC--CCSSCCGGGEEEEEEEEECT
T ss_pred             ------EEeecCCCc-eEEeeecCCCCCEEEEEecCCCCCCEEEEEECCCCeEEEEEe--CCCCcChhhCeeEEEEEecC
Confidence                  345566543 344566778899999999999999999999999988655443  22357778889999999999


Q ss_pred             CCeEEeEEEEEeeCccccCCCCcEEEEecCCCCCCCCCCCchhHHHHHHCCCEEEEEccCCCCCCChhhhhcccccCCCC
Q 006375          385 DGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRLSLLDRGFIFAIAQIRGGGELGRQWYENGKFLKKKN  464 (648)
Q Consensus       385 ~g~~i~~~l~~~~~~~~~~~~~P~vl~~hGg~~~~~~~~~~~~~~~l~~~G~~v~~~~~rG~g~~g~~~~~~~~~~~~~~  464 (648)
                      ||.+|++++++|++. ..+++.|+||++|||++....+.|...++.|+++||+|+++|+||+|++|+.|+.++...++.+
T Consensus       434 dg~~i~~~l~~p~~~-~~~~~~P~ll~~hGg~~~~~~~~~~~~~~~l~~~G~~v~~~d~RG~g~~g~~~~~~~~~~~~~~  512 (693)
T 3iuj_A          434 DGTRVPLIISYRKGL-KLDGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQAWHLAGTQQNKQN  512 (693)
T ss_dssp             TSCEEEEEEEEESSC-CCSSCCCEEEECCCCTTCCCCCCCCHHHHHHHHTTCEEEEECCTTSSTTCHHHHHTTSGGGTHH
T ss_pred             CCcEEEEEEEecCCC-CCCCCccEEEEECCCCCcCCCCccCHHHHHHHHCCCEEEEEeCCCCCccCHHHHHhhhhhcCCC
Confidence            999999999999986 5678899999999999998899999988999999999999999999999999999999999999


Q ss_pred             cHhHHHHHHHHHHHcCCCCCCeEEEEeeChhHHHHHHHHhhCCCceeEEEecCCcccccccccCCCCCCCcccccccCCC
Q 006375          465 TFTDFIACAEYLIKNCYCTKEKLCIEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDP  544 (648)
Q Consensus       465 ~~~D~~~~~~~l~~~~~~d~~~i~i~G~S~GG~l~~~~~~~~p~~~~a~v~~~~~~d~~~~~~~~~~~~~~~~~~~~g~~  544 (648)
                      .++|++++++||++++++|++||+|+|+||||++++++++++|++|+|+|+.+|++|+..++.   .+.....+.+||+|
T Consensus       513 ~~~D~~~~~~~l~~~~~~d~~ri~i~G~S~GG~la~~~~~~~p~~~~a~v~~~~~~d~~~~~~---~~~~~~~~~~~g~p  589 (693)
T 3iuj_A          513 VFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAVMTQRPDLMRVALPAVGVLDMLRYHT---FTAGTGWAYDYGTS  589 (693)
T ss_dssp             HHHHHHHHHHHHHHTTSCCGGGEEEEEETHHHHHHHHHHHHCTTSCSEEEEESCCCCTTTGGG---SGGGGGCHHHHCCT
T ss_pred             cHHHHHHHHHHHHHcCCCCcceEEEEEECHHHHHHHHHHhhCccceeEEEecCCcchhhhhcc---CCCchhHHHHcCCc
Confidence            999999999999999999999999999999999999999999999999999999999887642   22222233678999


Q ss_pred             CCHHH-HHHHHcCCccccCCC-CCCCeEEEeecCCCCccCCchHHHHHHHHHhcCCCCCeEEEEecCCCCccCCCchHHH
Q 006375          545 WKEEF-YFYMKSYSPVDNVKA-QNYPHILVTAGLNDPRVMYSEPAKFVAKLREMKTDDNILLFKCELGAGHFSKSGRFER  622 (648)
Q Consensus       545 ~~~~~-~~~~~~~sp~~~~~~-~~~P~~li~~g~~D~~v~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~gH~~~~~~~~~  622 (648)
                      .+++. ++++.++||++++++ +++||+||+||++|++||++++++|+++|++++.....+.+...+++||+........
T Consensus       590 ~~~~~~~~~~~~~sp~~~~~~~~~~Pp~Li~~G~~D~~v~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~gH~~~~~~~~~  669 (693)
T 3iuj_A          590 ADSEAMFDYLKGYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQLIRIETNAGHGAGTPVAKL  669 (693)
T ss_dssp             TSCHHHHHHHHHHCHHHHCCTTCCCCEEEEEEESSCSSSCTHHHHHHHHHHHHHCCSSSCEEEEEEC-------CHHHHH
T ss_pred             cCHHHHHHHHHhcCHHHhhcccCCCCceeEEecCCCCCCChhHHHHHHHHHHhhCCCCCCEEEEEeCCCCCCCcccHHHH
Confidence            87776 888999999999999 8999999999999999999999999999999853223345555568999877665667


Q ss_pred             HHHHHHHHHHHHHhcCCCCCC
Q 006375          623 LREAAFTYTFLMRALSMLPSV  643 (648)
Q Consensus       623 ~~~~~~~~~fl~~~l~~~~~~  643 (648)
                      .+..+++++||.++||....|
T Consensus       670 ~~~~~~~~~fl~~~l~~~~~~  690 (693)
T 3iuj_A          670 IEQSADIYAFTLYEMGYRELP  690 (693)
T ss_dssp             HHHHHHHHHHHHHHTTCSSCS
T ss_pred             HHHHHHHHHHHHHHcCCCCCC
Confidence            778889999999999987443
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 648
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 2e-40
d1qfma1430 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-termin 4e-33
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 4e-18
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 2e-14
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 7e-14
d1mpxa2381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 9e-14
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 3e-13
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 4e-13
d2b9va2385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 7e-12
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 2e-11
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 6e-11
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 2e-10
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 1e-09
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 4e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-04
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 0.003
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Prolyl oligopeptidase, C-terminal domain
domain: Prolyl oligopeptidase, C-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  146 bits (369), Expect = 2e-40
 Identities = 92/277 (33%), Positives = 140/277 (50%), Gaps = 8/277 (2%)

Query: 370 DTNNYFTERKWASASDGTQIPICIVYRKNLVKLDGSDPLLLYGYGSYEICNDPAFNSSRL 429
           D ++Y T + +  + DGT+IP+ IV++K + KLDGS P  LYGYG + I   P ++ SRL
Sbjct: 1   DASDYQTVQIFYPSKDGTKIPMFIVHKKGI-KLDGSHPAFLYGYGGFNISITPNYSVSRL 59

Query: 430 SLLDRG-FIFAIAQIRGGGELGRQWYENGKFLKKKNTFTDFIACAEYLIKNCYCTKEKLC 488
             +     + A+A IRGGGE G  W++ G    K+N F DF   AEYLIK  Y + ++L 
Sbjct: 60  IFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLT 119

Query: 489 IEGRSAGGLLIGAVLNMRPDLFKAAVAAVPFVDVLTTMLDPTIPLTTAEWEEWGDPWKEE 548
           I G S GGLL+    N RPDLF   +A V  +D+L           T ++         E
Sbjct: 120 INGGSNGGLLVATCANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFE 179

Query: 549 FYFYMKSYSPVDNVKAQN--YPHILVTAGLNDPRVMYSEPAKFVAKLRE----MKTDDNI 602
           +         V   +A +  YP +L+    +D RV+     KF+A L+      +  +N 
Sbjct: 180 WLIKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQNNP 239

Query: 603 LLFKCELGAGHFSKSGRFERLREAAFTYTFLMRALSM 639
           LL   +  AGH +     + + E +  + F+ R L++
Sbjct: 240 LLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNI 276
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 430 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 100.0
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 100.0
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.97
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.97
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.96
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.92
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.92
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.9
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.84
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.84
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.84
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.83
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.83
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.82
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.82
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.81
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.81
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.81
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.81
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.81
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.8
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.77
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.76
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.73
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.73
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.71
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.7
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.7
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.68
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.68
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.67
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.67
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.67
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.66
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.65
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.63
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.63
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.63
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.63
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.62
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.61
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.61
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.6
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.6
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.6
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.6
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.58
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.58
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.58
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.57
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.57
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.56
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.56
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.55
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.55
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.54
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.53
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.53
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.52
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.51
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.49
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.49
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.49
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.47
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.46
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.45
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.43
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.38
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.32
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.32
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.29
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.28
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.25
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.25
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.21
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.05
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.03
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.02
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.02
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.0
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.97
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.96
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.93
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.91
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.91
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.89
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.87
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.84
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.81
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.77
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.76
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.72
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.7
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.69
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.66
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.66
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.66
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.66
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.65
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.62
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.62
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.61
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.58
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.56
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.55
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.55
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 98.53
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.5
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 98.49
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.48
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.47
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.45
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.45
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.44
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.43
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.41
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.38
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.38
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.35
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.31
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.26
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.24
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.22
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.17
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.15
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.12
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.11
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.1
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.1
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.05
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.01
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 97.99
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.98
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.92
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.82
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.81
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.74
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.7
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.6
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.6
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.48
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.46
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 97.45
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.42
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.4
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.4
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.37
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.35
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.35
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.27
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.27
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.25
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.89
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.72
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.63
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 96.56
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.44
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.44
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.43
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 96.24
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.07
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 96.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.79
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 95.76
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.56
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 94.9
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.32
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.3
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 93.9
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 93.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 93.72
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 93.41
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 93.26
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 92.89
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.05
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 90.81
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 90.52
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.88
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 89.2
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 85.96
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 85.89
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 85.68
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 85.12
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 84.72
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 84.44
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 83.8
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Peptidase/esterase 'gauge' domain
family: Prolyl oligopeptidase, N-terminal domain
domain: Prolyl oligopeptidase, N-terminal domain
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=5.5e-36  Score=315.96  Aligned_cols=335  Identities=16%  Similarity=0.207  Sum_probs=268.9

Q ss_pred             HHHHhhccCCCCCCCCeEeCCEEEEEEecCCceEEEEEEEecCCCCCCCCccccCCCCCCCCCceEEEecccccCCCCcE
Q 006375            2 FAELKGRIKQEDVSAPFRQGSYYYYTRTLEGKEYVQHCRRLIHNNEAPPSVHDTMETGPDAPPEHLILDENVKAEGRGFY   81 (648)
Q Consensus         2 ~~~~~~r~~~~~~s~p~~~g~~~y~~~~~~g~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~lld~n~~~~~~~~~   81 (648)
                      .+++++++..++.++|.+.|+++||.+..+++.+.+++|+....                 +.+|||||+|+++++ +.+
T Consensus        64 ~~~~~~~~~~~~~~~p~~~g~~y~~~~~~~~~~~~~~~~~~~~~-----------------~~~evllD~n~la~~-~~~  125 (430)
T d1qfma1          64 KERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLE-----------------GEARVFLDPNILSDD-GTV  125 (430)
T ss_dssp             HHHHHHHTCSCEECCCEEETTEEEEEEECSSCSSCEEEEESSSS-----------------SCCEEEECGGGGCSS-SCE
T ss_pred             HHHHHhhhcCCceeeeEEeCCEEEEEEecCCCccceEEeccccC-----------------CCeeeecchhhhccc-ccc
Confidence            45566666668899999999999999998888888888876542                 478999999999884 567


Q ss_pred             EEeeEEeCCCCCEEEEEEeCCCCeEEEEEEEECCCCCeeeccccCc-cceeEEecCC-eEEEEEeCC-----------CC
Q 006375           82 SVGCFQVSPDNKLVAYAEDTKGDEIYTVYVIDIETGTPVGKPLVGV-TASVEWAGNE-ALVYITMDE-----------IL  148 (648)
Q Consensus        82 ~~~~~~~SPDG~~la~~~~~~G~e~~~l~v~dl~~g~~~~~~~~~~-~~~~~WspDg-~l~y~~~~~-----------~~  148 (648)
                      .+.++.+||||+++||+.+.+|+|.++|+++|+++|+.+.+.+++. .+.++|++|+ .|+|++.+.           ..
T Consensus       126 ~~~~~~~Spd~~~la~s~d~~G~e~~~l~v~Dl~tg~~~~~~i~~~~~~~~~W~~D~~~~~Y~~~~~~~~~~~~~~~~~~  205 (430)
T d1qfma1         126 ALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNAYPQQDGKSDGTETSTN  205 (430)
T ss_dssp             EEEEEEECTTSSEEEEEEEETTCSCEEEEEEETTTTEEEEEEEEEECSCCEEECTTSSEEEEEECCCCSSCCSSSCCCCC
T ss_pred             eecceEecCCCCEEEEEeccccCchheeEEeccCcceecccccccccccceEEcCCCCEEEEEEeccccCcccccccccC
Confidence            7888999999999999999999999999999999999988777765 3679999999 999998653           35


Q ss_pred             CCceEEEEECCCCCCCcEEEEeecCC-CeEEEEEeCCCCcEEEEEEcccc--ccEEEEEECCCCC-------ceeEeeec
Q 006375          149 RPDKAWLHKLEADQSNDICLYHEKDD-IYSLGLQASESKKFLFIASESKI--TRFVFYLDVSKPE-------ELRVLTPR  218 (648)
Q Consensus       149 ~~~~l~~~~l~~~~~~~~~~~~~~~~-~~~~~~~~s~Dg~~l~~~~~~~~--~~~l~~~dl~~~~-------~~~~l~~~  218 (648)
                      ++.+||+|.++++++++.+++++.+. .+..++..|+||+++++.+....  .+.+|++|+....       .+.++..+
T Consensus       206 ~~~~v~~h~lgt~~~~d~~v~~e~d~~~~~~~~~~s~d~~~l~i~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~  285 (430)
T d1qfma1         206 LHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDN  285 (430)
T ss_dssp             CCCEEEEEETTSCGGGCEEEECCTTCTTCEEEEEECTTSCEEEEEEECSSSSCCEEEEEEGGGSSSSSCSSCCCEEEECS
T ss_pred             CcceEEEEECCCCccccccccccccCCceEEeeeccCCcceeeEEeeccCCccEEEEEeeCCCcccccccccceeEeecc
Confidence            67899999999999999999998764 46677889999999998776543  4689999986543       13344444


Q ss_pred             ccceeeeEeecCCEEEEEeccCCCCCcEEEEEeCCCCCccee--EecCCCC-cccceEEEeCCEEEEEEecCCeeEEEEE
Q 006375          219 VVGVDTAASHRGNHFFITRRSDELFNSELLACPVDNTSETTV--LIPHRES-VKLQDIQLFIDHLAVYEREGGLQKITTY  295 (648)
Q Consensus       219 ~~~~~~~~s~dg~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~--~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~l~v~  295 (648)
                      .....+.+.++|+.+|+.+|. ++++++|+.++++.+...+|  ++++.+. ..+..+...++++++..++++.++|.++
T Consensus       286 ~~~~~~~~~~~~~~~~~~Tn~-~a~~~~L~~~~~~~~~~~~w~~vi~~~~~~~~~~~~~~~~~~lvl~~~~~~~~~l~v~  364 (430)
T d1qfma1         286 FEGEYDYVTNEGTVFTFKTNR-HSPNYRLINIDFTDPEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNTLQLH  364 (430)
T ss_dssp             SSSCEEEEEEETTEEEEEECT-TCTTCEEEEEETTBCCGGGCEEEECCCSSCEEEEEEEETTTEEEEEEEETTEEEEEEE
T ss_pred             cccceEEEecCCceeecccCc-ccccceeEEecCCCCccccceEEecccCcceeeeEEEEECCEEEEEEEcCCEeEEEEE
Confidence            444455578889999999997 68999999999988766666  7876654 4455677788999999999999999999


Q ss_pred             EcCCCCCcccccCCCceeecCCCeeeeeCCCCcccccEEEEEEeeCCCCCEEEEEECCCCcE--EEEEEee
Q 006375          296 RLPAVGEPLKSLQGGKSVEFIDPVYSIDPSESVFSSRILRFHYSSLRTPPSVYDYDMDMGIS--VLKKIET  364 (648)
Q Consensus       296 ~~~~~g~~~~~l~~~~~i~~~~~~~~v~~~~~~~~~~~l~~~~ss~~~P~~~~~~d~~~~~~--~~~~~~~  364 (648)
                      +++  ++..      ..+.+| +.+++.+.+.+++++.++|.++|+++|+++|.||+++++.  ++.+..+
T Consensus       365 ~~~--~~~~------~~~~~~-~~~sv~~~~~~~~~~~~~~~~ss~~tP~~~y~~Dl~t~~~~~~~~k~~~  426 (430)
T d1qfma1         365 DLA--TGAL------LKIFPL-EVGSVVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVT  426 (430)
T ss_dssp             ETT--TCCE------EEEECC-CSSEEEEEECCTTCSEEEEEEECSSCCCEEEEEETTSSSCCCEEEEECC
T ss_pred             ECC--CCcE------EEecCC-CCceEeeccCCCCCCEEEEEEcCCCCCCeEEEEECCCCCcceeeEeccC
Confidence            987  3432      234433 3456666777788899999999999999999999999864  3444433
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure