Citrus Sinensis ID: 006440

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-----
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKVMNDSLHSV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccccccccEEccHHHHHHHHHcccccHHHHHHccccccccEEEEEEcccccEEEEEcccHHHHHHccccEEEEcHHHHHHHHHHHcccccEEccccEEEEEEcccEEEEEEccccEEEccEEEEcccccHHHHcccccccccccccEEEEEEEEcccccccccccEEEEEEccEEEEEEEccccEEEEEEEEEcccccccccccHHHHHHHHHccccHHHHHHHHHcccccEEEEEccccccccccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHcccccHHHHHHccccEEEEEccccccccccEEEccccccccEEEcccccccccccEEEEEccccccccEEEEEcccEEEEEEcccccccEEEcccccccccccccccccccccEEEEcccccccccccccc
ccccEEEccccccccHcccccccccccccccHHHccccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHccccccccEEEcHHHHHHHHHccccHHHHHHHHcccccccEEEEEccccccEEEEcccccHHHHHcccccEEEEHHHHHHHHHHHcccccEEcccEEEEEEEccccEEEEEccccEEEEEEEEEcccHHHHHHHHHcccccccEcEEEEEEEEEEccccccccccEEEEEccccEEEEEEccccEEEEEEEEcccccccccccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHccccccccccccEEEEccccccccccHcHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcHHHHHHHHcccEEEEEccccccccccEEEEEccccccEEEEccccccccccEEEEccccccHccEEEEEccccEEEEEccccccEEEEcccccEEEccccccEEEccccEEEEcccHHHHHcccccc
MVSSMFYNSVNLSTAvfsrthfpvpvykhsciefsrydhcinykfrtgtsgqsknptQMKAAvaesptnnsdsenkKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDmsairgegqyrgpiqIQSNALAALEAIDLDVAEEVMRAGcvtgdringlvdgisgswyikfdtftpaaekglpvtRVISRMTLQQILAKAVGdeiilnesnvidfkdhgdKVSVVLENgqcyagdlligadgIWSKVrknlfgpqeaiysgytcytgiadfvpadiesvgYRVFLGHKqyfvssdvgagkmQWYAfhkepaggvdgpegkKERLLKIFEGWCDNVVDLILATDEEAILRrdiydrtpiftwgrgrvtllgdsvhamqpnlgqggcmaiEDGYQLAVELEKACkksnesktpIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLgvglgplsfltkfriphpgrvggrFFIDLAMPLMLSWVlggnssklegrspccklsdkaSDNLRTWFRDDDALEramngewflvpsgsenvvsqpiylsvshenepyligseshedfsrtsivipsaqvsKMHARISYKDGAFYLIDLqsehgtyvtdnegrryrvssnfparfrpsdtiefgsdkkvmndslhsv
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRtgtsgqsknPTQMKAAVaesptnnsdsenKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKepaggvdgpeGKKERLLKIFEGWCDNVVDLILATdeeailrrdiydrtpiftwGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACkksnesktpidiVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGseshedfsrTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGtyvtdnegrryrvssnfparfrpsdtiefgsdkkvmndslhsv
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKlrilvagggigglvfalaaKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKVMNDSLHSV
*****FYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRT******************************LRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGG*******KERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACK*******PIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNS*******PCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIG******FSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDN*************************************
***S***NSVNLSTAVFSRTHFPVPVYKH***************************************************LVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPC************TWFRDDDALERAMNGEWFLVPSGSEN**SQPI*LSVSHEN******************VIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKV********
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT************************ENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKVMNDSLHSV
**SSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAES*********KKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKV*ND*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKVMNDSLHSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query645 2.2.26 [Sep-21-2011]
O81360661 Zeaxanthin epoxidase, chl N/A no 0.996 0.972 0.753 0.0
Q40412663 Zeaxanthin epoxidase, chl N/A no 0.978 0.951 0.713 0.0
P93236669 Zeaxanthin epoxidase, chl N/A no 0.978 0.943 0.712 0.0
Q9FGC7667 Zeaxanthin epoxidase, chl yes no 0.976 0.944 0.706 0.0
Q96375660 Zeaxanthin epoxidase, chl N/A no 0.947 0.925 0.694 0.0
Q0JCU7659 Zeaxanthin epoxidase, chl yes no 0.869 0.851 0.751 0.0
Q9F131394 3-hydroxybenzoate 6-hydro N/A no 0.516 0.845 0.312 5e-30
A6T923384 FAD-dependent urate hydro yes no 0.524 0.880 0.293 5e-25
B6D1N4384 FAD-dependent urate hydro yes no 0.524 0.880 0.293 2e-24
B5B0J6384 FAD-dependent urate hydro no no 0.372 0.625 0.300 6e-20
>sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 Back     alignment and function desciption
 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/654 (75%), Positives = 563/654 (86%), Gaps = 11/654 (1%)

Query: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT-SGQSKNPTQM 59
           M S++FYNS+NLS AVFSRTHFP+P+ K   +EFS   H  +Y  R+ T SGQ K  T++
Sbjct: 1   MASTLFYNSMNLSAAVFSRTHFPIPINKDFPLEFSPCIHT-DYHLRSRTRSGQKKCLTEV 59

Query: 60  KAAVA---ESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGE 116
           +A VA   E P+  + ++ KKLRILVAGGGIGGLVFALAAK+KGF+V+VFEKD+SA+RGE
Sbjct: 60  RATVASPTEVPSAPASTQPKKLRILVAGGGIGGLVFALAAKKKGFDVVVFEKDLSAVRGE 119

Query: 117 GQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPA 176
           GQYRGPIQIQSNALAALEAID+DVAEEVMR GCVTGDRINGLVDG+SG+WY+KFDTFTPA
Sbjct: 120 GQYRGPIQIQSNALAALEAIDMDVAEEVMRVGCVTGDRINGLVDGVSGTWYVKFDTFTPA 179

Query: 177 AEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLL 236
            E+GLPVTRVISR+ LQQILA+AVG+EII+N+SNV++F+D GDKV+V+LENGQ Y GD+L
Sbjct: 180 VERGLPVTRVISRIALQQILARAVGEEIIINDSNVVNFEDLGDKVNVILENGQRYEGDML 239

Query: 237 IGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVG 296
           +GADGIWSKVRKNLFG  EA+YSGYTCYTGIADFVPADI SVGYRVFLGHKQYFVSSDVG
Sbjct: 240 VGADGIWSKVRKNLFGLNEAVYSGYTCYTGIADFVPADINSVGYRVFLGHKQYFVSSDVG 299

Query: 297 AGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTP 356
            GKMQWYAFHKE  GGVD P GKKERLLKIFEGWCDNV+DL+LAT+E+AILRRDIYDRTP
Sbjct: 300 GGKMQWYAFHKESPGGVDSPNGKKERLLKIFEGWCDNVIDLLLATEEDAILRRDIYDRTP 359

Query: 357 IFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSA 416
           I TWG+G VTLLGDSVHAMQPN+GQGGCMAIEDGYQLA+EL+KA KKS+E+ TP+D+ S+
Sbjct: 360 ILTWGKGHVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGTPVDVASS 419

Query: 417 LKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFI 476
           L+SYE +RRLRVA+IHG+AR AA+MASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGR FI
Sbjct: 420 LRSYENSRRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFI 479

Query: 477 DLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSG 536
           D AMPLMLSWVLGGNSSKLEGRSP C+LSDKASD LR WF DDDALERA++GEW+L+P G
Sbjct: 480 DKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRNWFEDDDALERAIDGEWYLIPCG 539

Query: 537 SENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLID 596
            +N  SQ I L+   +N P +IGS  H D S  SI IP  QVS+MHARISYKDGAFYL D
Sbjct: 540 QDNDASQLICLNRDEKN-PCIIGSAPHGDVSGISIAIPKPQVSEMHARISYKDGAFYLTD 598

Query: 597 LQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDK-----KVMNDSLHSV 645
           L+SEHGT++ D EG+RYRV  NFPARFRPSD IE GS K     KVM  S  SV
Sbjct: 599 LRSEHGTWIADIEGKRYRVPPNFPARFRPSDAIEIGSQKVAFRVKVMKSSPGSV 652
Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Involved in the epoxidation of zeaxanthin.
Prunus armeniaca (taxid: 36596)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 9EC: 0
>sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 Back     alignment and function description
>sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 Back     alignment and function description
>sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 Back     alignment and function description
>sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 Back     alignment and function description
>sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 Back     alignment and function description
>sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 Back     alignment and function description
>sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 Back     alignment and function description
>sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query645
290361322664 zeaxanthin epoxidase [Citrus unshiu] 0.989 0.960 0.993 0.0
17402597664 zeaxanthin epoxidase [Citrus unshiu] 0.989 0.960 0.992 0.0
290361326664 zeaxanthin epoxidase [Citrus sinensis] 0.989 0.960 0.987 0.0
190576749664 zeaxanthin epoxidase [Citrus maxima] 0.989 0.960 0.973 0.0
290361328664 zeaxanthin epoxidase [Citrus sinensis] 0.989 0.960 0.978 0.0
290361324664 zeaxanthin epoxidase [Citrus unshiu] 0.989 0.960 0.976 0.0
224084342692 predicted protein [Populus trichocarpa] 0.984 0.917 0.765 0.0
255565190665 zeaxanthin epoxidase, putative [Ricinus 0.981 0.951 0.771 0.0
5902708661 RecName: Full=Zeaxanthin epoxidase, chlo 0.996 0.972 0.753 0.0
38112202658 zeaxanthin epoxidase [Vitis vinifera] 0.972 0.952 0.773 0.0
>gi|290361322|dbj|BAI79257.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/638 (99%), Positives = 635/638 (99%)

Query: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK 60
           MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK
Sbjct: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK 60

Query: 61  AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR 120
           AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR
Sbjct: 61  AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR 120

Query: 121 GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG 180
           GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG
Sbjct: 121 GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG 180

Query: 181 LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD 240
           LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD
Sbjct: 181 LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD 240

Query: 241 GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM 300
           GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM
Sbjct: 241 GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM 300

Query: 301 QWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW 360
           QWYAFHKEPAGGVD PEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW
Sbjct: 301 QWYAFHKEPAGGVDDPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW 360

Query: 361 GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY 420
           GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY
Sbjct: 361 GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY 420

Query: 421 ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM 480
           ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM
Sbjct: 421 ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM 480

Query: 481 PLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENV 540
           PLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENV
Sbjct: 481 PLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENV 540

Query: 541 VSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSE 600
           VSQPIYLSVSHENEPYLIGSESHEDF RTSIVIPSAQVSKMHARISYKDGAFYLIDLQSE
Sbjct: 541 VSQPIYLSVSHENEPYLIGSESHEDFPRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSE 600

Query: 601 HGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKVM 638
           HGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKK +
Sbjct: 601 HGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI 638

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|17402597|dbj|BAB78733.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
>gi|290361326|dbj|BAI79259.1| zeaxanthin epoxidase [Citrus sinensis] Back     alignment and taxonomy information
>gi|190576749|gb|ACE79170.1| zeaxanthin epoxidase [Citrus maxima] Back     alignment and taxonomy information
>gi|290361328|dbj|BAI79260.1| zeaxanthin epoxidase [Citrus sinensis] Back     alignment and taxonomy information
>gi|290361324|dbj|BAI79258.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
>gi|224084342|ref|XP_002307265.1| predicted protein [Populus trichocarpa] gi|222856714|gb|EEE94261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565190|ref|XP_002523587.1| zeaxanthin epoxidase, putative [Ricinus communis] gi|223537149|gb|EEF38782.1| zeaxanthin epoxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|5902708|sp|O81360.1|ABA2_PRUAR RecName: Full=Zeaxanthin epoxidase, chloroplastic; AltName: Full=PA-ZE; Flags: Precursor gi|5360186|gb|AAD42899.1|AF159948_1 zeaxanthin epoxidase [Prunus armeniaca] gi|3264757|gb|AAC24582.1| zeaxanthin epoxidase [Prunus armeniaca] Back     alignment and taxonomy information
>gi|38112202|gb|AAR11195.1| zeaxanthin epoxidase [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query645
TAIR|locus:2158083667 ABA1 "ABA DEFICIENT 1" [Arabid 0.976 0.944 0.681 1.6e-237
UNIPROTKB|Q0JCU7659 ZEP "Zeaxanthin epoxidase, chl 0.899 0.880 0.707 6e-222
UNIPROTKB|A6T923384 hpxO "FAD-dependent urate hydr 0.370 0.622 0.318 6.5e-21
UNIPROTKB|B6D1N4384 hpxO "FAD-dependent urate hydr 0.370 0.622 0.318 2.9e-20
TIGR_CMR|SPO_3692395 SPO_3692 "monooxygenase, putat 0.482 0.787 0.282 7.1e-20
UNIPROTKB|B5B0J6384 hpxO "FAD-dependent urate hydr 0.409 0.687 0.294 1.6e-19
UNIPROTKB|Q88FY2382 nicC "6-hydroxynicotinate 3-mo 0.497 0.840 0.271 2.7e-18
UNIPROTKB|P86491385 P86491 "6-hydroxynicotinate 3- 0.333 0.558 0.291 1.6e-16
TAIR|locus:2060584427 CTF2B "AT2G29720" [Arabidopsis 0.358 0.540 0.308 4.4e-16
TAIR|locus:2058723439 CTF2A "AT2G35660" [Arabidopsis 0.351 0.517 0.307 3.8e-15
TAIR|locus:2158083 ABA1 "ABA DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2290 (811.2 bits), Expect = 1.6e-237, P = 1.6e-237
 Identities = 439/644 (68%), Positives = 518/644 (80%)

Query:     1 MVSSMFYNSVNLSTAV--FSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSG-QSKNPT 57
             M S+ F  S+N S +   F+RTH   PV K   ++ S +          G SG +S+   
Sbjct:     1 MGSTPFCYSINPSPSKLDFTRTHVFSPVSKQFYLDLSSFSGKPG-----GVSGFRSRRAL 55

Query:    58 Q-MKAAVA----ESPTNNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSA 112
               +KAA A    E        + KK                   K+KGF+VLVFEKD+SA
Sbjct:    56 LGVKAATALVEKEEKREAVTEKKKKSRVLVAGGGIGGLVFALAAKKKGFDVLVFEKDLSA 115

Query:   113 IRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDT 172
             IRGEG+YRGPIQIQSNALAALEAID++VAE+VM AGC+TGDRINGLVDGISG+WY+KFDT
Sbjct:   116 IRGEGKYRGPIQIQSNALAALEAIDIEVAEQVMEAGCITGDRINGLVDGISGTWYVKFDT 175

Query:   173 FTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYA 232
             FTPAA +GLPVTRVISRMTLQQILA+AVG+++I NESNV+DF+D GDKV+VVLENGQ Y 
Sbjct:   176 FTPAASRGLPVTRVISRMTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYE 235

Query:   233 GDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVS 292
             GDLL+GADGIWSKVR NLFG  EA YSGYTCYTGIADF+PADIESVGYRVFLGHKQYFVS
Sbjct:   236 GDLLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVS 295

Query:   293 SDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIY 352
             SDVG GKMQWYAFH+EPAGG D P G K+RL +IF+GWCDNV+DL+ AT+EEAILRRDIY
Sbjct:   296 SDVGGGKMQWYAFHEEPAGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEEAILRRDIY 355

Query:   353 DRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPID 412
             DR+P FTWG+GRVTLLGDS+HAMQPN+GQGGCMAIED +QLA+EL++A K+S E+ TP+D
Sbjct:   356 DRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETTTPVD 415

Query:   413 IVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGG 472
             +VS+LK YE +RRLRVA+IH +AR AA+MASTYKAYLGVGLGPLSFLTKFR+PHPGRVGG
Sbjct:   416 VVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGG 475

Query:   473 RFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFL 532
             RFF+D+AMP ML WVLGGNS KL+GR P C+L+DKA D LR WF DDDALER + GEW+L
Sbjct:   476 RFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYL 535

Query:   533 VPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAF 592
             +P G +  VS+ + L+   E++P ++GSE  +DF    IVIPS+QVSKMHAR+ YKDGAF
Sbjct:   536 IPHGDDCCVSETLCLT-KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAF 594

Query:   593 YLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKK 636
             +L+DL+SEHGTYVTDNEGRRYR + NFPARFR SD IEFGSDKK
Sbjct:   595 FLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKK 638
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IEA;IDA
GO:0009540 "zeaxanthin epoxidase [overall
GO:0009688 "abscisic acid biosynthetic process" evidence=IEA;TAS
GO:0016020 "membrane" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006970 "response to osmotic stress" evidence=IMP
GO:0009414 "response to water deprivation" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=TAS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009408 "response to heat" evidence=IMP
GO:0010114 "response to red light" evidence=IEP
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
GO:0016123 "xanthophyll biosynthetic process" evidence=IMP
UNIPROTKB|Q0JCU7 ZEP "Zeaxanthin epoxidase, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A6T923 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (taxid:272620)] Back     alignment and assigned GO terms
UNIPROTKB|B6D1N4 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae (taxid:573)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3692 SPO_3692 "monooxygenase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|B5B0J6 hpxO "FAD-dependent urate hydroxylase" [Klebsiella oxytoca (taxid:571)] Back     alignment and assigned GO terms
UNIPROTKB|Q88FY2 nicC "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas putida KT2440 (taxid:160488)] Back     alignment and assigned GO terms
UNIPROTKB|P86491 P86491 "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas fluorescens (taxid:294)] Back     alignment and assigned GO terms
TAIR|locus:2060584 CTF2B "AT2G29720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058723 CTF2A "AT2G35660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81360ABA2_PRUAR1, ., 1, 4, ., 1, 3, ., 9, 00.75380.99680.9727N/Ano
Q0JCU7ZEP_ORYSJ1, ., 1, 4, ., 1, 3, ., 9, 00.75170.86970.8512yesno
Q40412ABA2_NICPL1, ., 1, 4, ., 1, 3, ., 9, 00.71330.97820.9517N/Ano
P93236ABA2_SOLLC1, ., 1, 4, ., 1, 3, ., 9, 00.71200.97820.9431N/Ano
Q96375ABA2_CAPAN1, ., 1, 4, ., 1, 3, ., 9, 00.69450.94720.9257N/Ano
Q9FGC7ZEP_ARATH1, ., 1, 4, ., 1, 3, ., 9, 00.70650.97670.9445yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13.24LOW CONFIDENCE prediction!
3rd Layer1.14.130.983
3rd Layer1.14.13.900.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
PLN02927668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa 0.0
PRK08163396 PRK08163, PRK08163, salicylate hydroxylase; Provis 7e-49
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-44
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 5e-44
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 4e-42
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 3e-32
PRK06475400 PRK06475, PRK06475, salicylate hydroxylase; Provis 2e-24
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 2e-17
TIGR03219414 TIGR03219, salicylate_mono, salicylate 1-monooxyge 1e-16
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisio 1e-16
pfam0049867 pfam00498, FHA, FHA domain 3e-14
PRK07588391 PRK07588, PRK07588, hypothetical protein; Provisio 4e-13
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 3e-12
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 1e-09
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 1e-09
smart0024052 smart00240, FHA, Forkhead associated domain 1e-08
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Review 2e-07
COG1716191 COG1716, COG1716, FOG: FHA domain [Signal transduc 2e-07
PRK05868372 PRK05868, PRK05868, hypothetical protein; Validate 6e-07
PRK06126545 PRK06126, PRK06126, hypothetical protein; Provisio 8e-07
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 2e-06
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 4e-06
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 1e-05
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 4e-05
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 5e-05
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 6e-04
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 7e-04
TIGR03364365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 7e-04
TIGR03354 396 TIGR03354, VI_FHA, type VI secretion system FHA do 0.001
COG3456 430 COG3456, COG3456, Predicted component of the type 0.001
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 0.002
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 0.002
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information 
 Score =  951 bits (2460), Expect = 0.0
 Identities = 460/644 (71%), Positives = 537/644 (83%), Gaps = 13/644 (2%)

Query: 1   MVSSMFYNSVNLSTAV--FSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSG--QSKNP 56
           M S++F  S+N S +   F+RTH   PV K   ++ S +      K   G SG    K  
Sbjct: 1   MGSTLFCYSINPSPSKLDFTRTHVFSPVAKQFYLDLSSFSG----KPGGGLSGFRSRKAL 56

Query: 57  TQMKAAVA----ESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSA 112
             +KAA A    E        + KK R+LVAGGGIGGLVFALAAK+KGF+VLVFEKD+SA
Sbjct: 57  LGVKAATALVEKEEKREAVTEKKKKSRVLVAGGGIGGLVFALAAKKKGFDVLVFEKDLSA 116

Query: 113 IRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDT 172
           IRGEG+YRGPIQIQSNALAALEAID+DVAE+VM AGC+TGDRINGLVDGISGSWY+KFDT
Sbjct: 117 IRGEGKYRGPIQIQSNALAALEAIDIDVAEQVMEAGCITGDRINGLVDGISGSWYVKFDT 176

Query: 173 FTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYA 232
           FTPAA +GLPVTRVISRMTLQQILA+AVG+++I NESNV+DF+D GDKV+VVLENGQ Y 
Sbjct: 177 FTPAASRGLPVTRVISRMTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYE 236

Query: 233 GDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVS 292
           GDLL+GADGIWSKVR NLFG  EA YSGYTCYTGIADF+PADIESVGYRVFLGHKQYFVS
Sbjct: 237 GDLLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVS 296

Query: 293 SDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIY 352
           SDVG GKMQWYAFH+EPAGG D P G K+RL +IF+GWCDNV+DL+ AT+E+AILRRDIY
Sbjct: 297 SDVGGGKMQWYAFHEEPAGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIY 356

Query: 353 DRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPID 412
           DR+P FTWG+GRVTLLGDS+HAMQPN+GQGGCMAIED +QLA+EL++A K+S E+ TP+D
Sbjct: 357 DRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETNTPVD 416

Query: 413 IVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGG 472
           +VS+LK YE +RRLRVA+IH +AR AA+MASTYKAYLGVGLGPLSFLTKFR+PHPGRVGG
Sbjct: 417 VVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGG 476

Query: 473 RFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFL 532
           RFF+D+AMPLML WVLGGNS KLEGR P C+L+DKA D LR WF DDDALER + GEW+L
Sbjct: 477 RFFVDIAMPLMLDWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYL 536

Query: 533 VPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAF 592
           +P G +  VS+ + L+   E++P ++GSE  +DF    IVIPS+QVSKMHAR+ YKDGAF
Sbjct: 537 IPHGDDCCVSETLCLT-KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAF 595

Query: 593 YLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKK 636
           +L+DL+SEHGTYVTDNEGRRYR + NFPARFR SD IEFGSDKK
Sbjct: 596 FLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKK 639

Length = 668
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|214578 smart00240, FHA, Forkhead associated domain Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|234178 TIGR03354, VI_FHA, type VI secretion system FHA domain protein Back     alignment and domain information
>gnl|CDD|225987 COG3456, COG3456, Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 645
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK08013400 oxidoreductase; Provisional 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK06185407 hypothetical protein; Provisional 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 100.0
PRK07236386 hypothetical protein; Provisional 100.0
PRK07538413 hypothetical protein; Provisional 100.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 100.0
PRK05868372 hypothetical protein; Validated 100.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK06996398 hypothetical protein; Provisional 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PRK06184502 hypothetical protein; Provisional 100.0
PRK06834488 hypothetical protein; Provisional 100.0
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 100.0
PRK09126392 hypothetical protein; Provisional 100.0
PRK08244493 hypothetical protein; Provisional 100.0
PRK08294634 phenol 2-monooxygenase; Provisional 100.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 100.0
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 100.0
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 100.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 100.0
PRK07190487 hypothetical protein; Provisional 100.0
PRK06126545 hypothetical protein; Provisional 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK08132547 FAD-dependent oxidoreductase; Provisional 100.0
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 100.0
PLN02985514 squalene monooxygenase 100.0
PTZ00367567 squalene epoxidase; Provisional 100.0
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 99.97
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.96
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.96
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.96
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.95
PRK11445351 putative oxidoreductase; Provisional 99.95
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.95
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.93
PRK10015429 oxidoreductase; Provisional 99.93
PRK10157428 putative oxidoreductase FixC; Provisional 99.92
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.91
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.9
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.87
PLN02463447 lycopene beta cyclase 99.86
PLN02697529 lycopene epsilon cyclase 99.84
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.82
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.72
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.71
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.69
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.36
TIGR03354 396 VI_FHA type VI secretion system FHA domain protein 99.33
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.24
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.21
COG2081408 Predicted flavoproteins [General function predicti 99.2
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.18
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 99.18
KOG1882293 consensus Transcriptional regulator SNIP1, contain 99.17
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.15
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.15
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.14
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.12
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 99.07
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.05
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.01
PRK11728393 hydroxyglutarate oxidase; Provisional 98.99
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.97
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.95
COG3456 430 Predicted component of the type VI protein secreti 98.94
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.94
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.93
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.93
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.92
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.89
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.88
COG0579429 Predicted dehydrogenase [General function predicti 98.85
KOG1881 793 consensus Anion exchanger adaptor protein Kanadapt 98.79
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.77
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.77
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.76
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.71
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.7
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.69
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.68
PLN02464627 glycerol-3-phosphate dehydrogenase 98.66
PRK05257494 malate:quinone oxidoreductase; Validated 98.64
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.64
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.6
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.58
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.57
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.57
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.56
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.56
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.56
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.54
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.53
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.53
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.5
PRK12416463 protoporphyrinogen oxidase; Provisional 98.48
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 98.47
KOG1880 337 consensus Nuclear inhibitor of phosphatase-1 [Gene 98.47
PRK07804541 L-aspartate oxidase; Provisional 98.47
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.46
PLN02661357 Putative thiazole synthesis 98.43
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.43
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.42
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.4
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.4
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.39
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.38
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.37
PRK08274466 tricarballylate dehydrogenase; Validated 98.36
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.36
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.3
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.28
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.26
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.26
PRK07121492 hypothetical protein; Validated 98.25
PRK08401466 L-aspartate oxidase; Provisional 98.24
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.23
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.21
PRK06175433 L-aspartate oxidase; Provisional 98.2
PLN02568539 polyamine oxidase 98.19
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.17
PRK09897534 hypothetical protein; Provisional 98.16
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.15
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.12
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.12
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 98.11
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.1
PRK08071510 L-aspartate oxidase; Provisional 98.1
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.09
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.09
PRK10262321 thioredoxin reductase; Provisional 98.07
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.06
PRK14694468 putative mercuric reductase; Provisional 98.06
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.03
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.02
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.01
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.0
PLN02507499 glutathione reductase 97.99
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.99
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 97.98
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.97
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.97
PLN02529738 lysine-specific histone demethylase 1 97.97
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 97.97
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.96
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.95
PRK12842574 putative succinate dehydrogenase; Reviewed 97.94
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.93
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.9
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 97.89
PRK09077536 L-aspartate oxidase; Provisional 97.89
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.87
PTZ00058561 glutathione reductase; Provisional 97.86
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.84
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 97.84
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 97.84
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.83
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 97.83
PLN02815594 L-aspartate oxidase 97.83
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.82
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 97.82
PRK08275554 putative oxidoreductase; Provisional 97.79
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.79
PRK08626657 fumarate reductase flavoprotein subunit; Provision 97.76
KOG2852380 consensus Possible oxidoreductase [General functio 97.75
PRK07395553 L-aspartate oxidase; Provisional 97.75
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.75
PTZ00153659 lipoamide dehydrogenase; Provisional 97.72
PLN02546558 glutathione reductase 97.71
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.69
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.69
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.66
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.66
PRK06370463 mercuric reductase; Validated 97.64
PRK06116450 glutathione reductase; Validated 97.62
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.62
PRK12839572 hypothetical protein; Provisional 97.62
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.61
PRK07208479 hypothetical protein; Provisional 97.61
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.61
PRK07512513 L-aspartate oxidase; Provisional 97.59
PRK13512438 coenzyme A disulfide reductase; Provisional 97.59
PRK14727479 putative mercuric reductase; Provisional 97.58
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.58
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.58
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.58
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.57
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.57
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.57
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.57
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.56
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.55
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 97.54
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.54
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.53
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 97.53
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.53
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 97.52
COG3349485 Uncharacterized conserved protein [Function unknow 97.52
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.51
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.5
PRK07846451 mycothione reductase; Reviewed 97.5
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.5
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.48
PLN02852491 ferredoxin-NADP+ reductase 97.45
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.45
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.45
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.43
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.43
PRK07233434 hypothetical protein; Provisional 97.42
PLN02576496 protoporphyrinogen oxidase 97.42
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.41
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.39
PRK065671028 putative bifunctional glutamate synthase subunit b 97.39
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.37
PRK06116450 glutathione reductase; Validated 97.36
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.36
PRK12831464 putative oxidoreductase; Provisional 97.35
PRK12779944 putative bifunctional glutamate synthase subunit b 97.35
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.34
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.34
KOG2853509 consensus Possible oxidoreductase [General functio 97.34
TIGR02053463 MerA mercuric reductase. This model represents the 97.33
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.32
PLN02268435 probable polyamine oxidase 97.3
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.3
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.28
PLN02507499 glutathione reductase 97.28
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.26
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.25
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.24
PTZ00052499 thioredoxin reductase; Provisional 97.22
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.22
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.21
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.21
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.19
PTZ00188506 adrenodoxin reductase; Provisional 97.19
PLN02328808 lysine-specific histone demethylase 1 homolog 97.19
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.17
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.17
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.16
PRK13748561 putative mercuric reductase; Provisional 97.15
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.15
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.13
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.13
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.13
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.12
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.12
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.12
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.11
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.11
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.11
KOG2311679 consensus NAD/FAD-utilizing protein possibly invol 97.1
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.09
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.09
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.09
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.08
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.07
PLN02487569 zeta-carotene desaturase 97.07
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.06
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.06
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.06
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.05
TIGR02053463 MerA mercuric reductase. This model represents the 97.04
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.03
PRK13977576 myosin-cross-reactive antigen; Provisional 97.02
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.0
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.0
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 96.99
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.98
PRK06370463 mercuric reductase; Validated 96.97
PRK05976472 dihydrolipoamide dehydrogenase; Validated 96.97
PRK12814652 putative NADPH-dependent glutamate synthase small 96.97
PRK07846451 mycothione reductase; Reviewed 96.94
PRK02106560 choline dehydrogenase; Validated 96.94
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.94
PTZ00052499 thioredoxin reductase; Provisional 96.9
PLN02676487 polyamine oxidase 96.9
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.9
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.89
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.89
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.87
PRK13512438 coenzyme A disulfide reductase; Provisional 96.87
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.87
COG3573552 Predicted oxidoreductase [General function predict 96.85
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.84
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 96.84
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 96.83
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.81
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.81
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.81
PLN02612567 phytoene desaturase 96.81
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.78
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.73
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.72
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.72
PRK14694468 putative mercuric reductase; Provisional 96.67
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.65
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.65
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.62
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.62
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.59
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.57
PTZ00058561 glutathione reductase; Provisional 96.55
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.54
PRK14727479 putative mercuric reductase; Provisional 96.54
PTZ00153659 lipoamide dehydrogenase; Provisional 96.52
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.51
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.5
TIGR02500 410 type_III_yscD type III secretion apparatus protein 96.49
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.45
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.41
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.39
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.39
PRK13748561 putative mercuric reductase; Provisional 96.38
PRK13984604 putative oxidoreductase; Provisional 96.27
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.26
PLN03000 881 amine oxidase 96.22
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.13
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.09
PLN02976 1713 amine oxidase 96.04
KOG0245 1221 consensus Kinesin-like protein [Cytoskeleton] 96.03
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.02
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 95.98
PLN02546558 glutathione reductase 95.96
PLN02785587 Protein HOTHEAD 95.94
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 95.83
KOG4716503 consensus Thioredoxin reductase [Posttranslational 95.7
KOG03992142 consensus Glutamate synthase [Amino acid transport 95.67
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 95.67
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.66
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 95.48
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 95.47
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 95.39
PRK10262321 thioredoxin reductase; Provisional 95.36
KOG2293547 consensus Daxx-interacting protein MSP58/p78, cont 95.24
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 95.17
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.03
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 94.96
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.92
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 94.92
KOG2960328 consensus Protein involved in thiamine biosynthesi 94.73
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.72
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 94.66
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 94.62
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 94.58
PRK12770352 putative glutamate synthase subunit beta; Provisio 94.42
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.3
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 94.17
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 94.02
TIGR02730493 carot_isom carotene isomerase. Members of this fam 93.93
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 93.89
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.84
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.81
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.75
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 93.74
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 93.67
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.53
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.35
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.05
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 93.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 93.0
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.82
PRK06719157 precorrin-2 dehydrogenase; Validated 92.74
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.68
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.59
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.43
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.43
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.38
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 92.34
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.1
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 92.05
PRK12921305 2-dehydropantoate 2-reductase; Provisional 91.97
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 91.96
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.81
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.76
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 91.76
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 91.74
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 91.66
PRK07233434 hypothetical protein; Provisional 91.66
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 91.62
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.48
PLN02612567 phytoene desaturase 91.41
PRK04148134 hypothetical protein; Provisional 91.35
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.33
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.27
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.19
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.11
PRK15116268 sulfur acceptor protein CsdL; Provisional 90.88
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 90.74
PRK08229341 2-dehydropantoate 2-reductase; Provisional 90.64
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 90.59
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.58
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.37
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 90.32
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 90.3
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 90.28
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 90.17
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 89.99
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 89.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 89.92
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.84
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 89.81
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 89.63
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.5
PTZ00082321 L-lactate dehydrogenase; Provisional 89.5
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 89.44
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 89.41
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.4
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.33
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 89.28
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 89.27
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 89.24
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 89.24
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 88.98
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 88.93
PRK07417279 arogenate dehydrogenase; Reviewed 88.78
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 88.72
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 88.66
PRK12831464 putative oxidoreductase; Provisional 88.47
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 88.38
KOG0241 1714 consensus Kinesin-like protein [Cytoskeleton] 88.34
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.22
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 88.1
cd01483143 E1_enzyme_family Superfamily of activating enzymes 88.08
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 88.06
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 88.03
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 87.77
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 87.69
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 87.64
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 87.55
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 87.51
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.39
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 87.37
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 87.34
PRK06223307 malate dehydrogenase; Reviewed 87.33
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 87.26
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 87.2
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 87.12
PLN02353473 probable UDP-glucose 6-dehydrogenase 87.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 87.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 86.92
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 86.85
PRK07502307 cyclohexadienyl dehydrogenase; Validated 86.83
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 86.79
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.54
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 86.46
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.04
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 86.0
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.0
PRK08328231 hypothetical protein; Provisional 85.86
PRK08306296 dipicolinate synthase subunit A; Reviewed 85.8
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 85.77
PLN02976 1713 amine oxidase 85.77
PRK12549284 shikimate 5-dehydrogenase; Reviewed 85.73
PLN02576496 protoporphyrinogen oxidase 85.64
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 85.62
PTZ00117319 malate dehydrogenase; Provisional 85.41
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.36
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.33
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 85.32
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 85.07
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 85.06
PLN02695370 GDP-D-mannose-3',5'-epimerase 85.06
PRK11730715 fadB multifunctional fatty acid oxidation complex 85.02
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 84.93
PLN03209576 translocon at the inner envelope of chloroplast su 84.9
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.89
PRK10669558 putative cation:proton antiport protein; Provision 84.87
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 84.8
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 84.66
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 84.63
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 84.58
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 84.5
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 84.49
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 84.43
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 84.36
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 84.36
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.34
PRK09496453 trkA potassium transporter peripheral membrane com 84.3
KOG2755334 consensus Oxidoreductase [General function predict 84.28
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 84.24
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 84.18
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information 
Probab=100.00  E-value=1.4e-89  Score=751.59  Aligned_cols=638  Identities=71%  Similarity=1.188  Sum_probs=531.6

Q ss_pred             CcccccccCCCCccce--eeccCCCccccCCcccccccccccCcccccccccCCccccccccccccCCCCCCC----CCC
Q 006440            1 MVSSMFYNSVNLSTAV--FSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNS----DSE   74 (645)
Q Consensus         1 ~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~   74 (645)
                      |++++|+++++++++.  ++|+++|.+.......++.++..|+..+......+  .+...++......+....    ...
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~   78 (668)
T PLN02927          1 MGSTLFCYSINPSPSKLDFTRTHVFSPVAKQFYLDLSSFSGKPGGGLSGFRSR--KALLGVKAATALVEKEEKREAVTEK   78 (668)
T ss_pred             CCccccccCCCccchhhhccccCCCCcccccchhhhccccccCccccccccch--hhhcchhhhhhhccccccccccccc
Confidence            8999999999999999  99999999999999999999988876322221111  222223333322221111    113


Q ss_pred             CCcCcEEEEcCCHHHHHHHHHHHHCCCeEEEEeccCccccCCCCcccceeeCchHHHHHHhcChhHHHHHHHhccccccc
Q 006440           75 NKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDR  154 (645)
Q Consensus        75 ~~~~~v~i~g~g~~g~~~a~~l~~~g~~~~~~~~~~~~~~~~g~~~~~~~l~~~~~~~l~~l~~g~~~~~~~~~~~~~~~  154 (645)
                      .+..+|+||||||+|+++|+.|+++|++|+|+|+++...+..|.+++++.++++++++|+++|+++.+++.+.+......
T Consensus        79 ~~~~~VlIVGgGIaGLalAlaL~r~Gi~V~V~Er~~~~~r~~G~~~~~I~L~pngl~aLe~LGl~~~e~l~~~g~~~~~~  158 (668)
T PLN02927         79 KKKSRVLVAGGGIGGLVFALAAKKKGFDVLVFEKDLSAIRGEGKYRGPIQIQSNALAALEAIDIDVAEQVMEAGCITGDR  158 (668)
T ss_pred             cCCCCEEEECCCHHHHHHHHHHHhcCCeEEEEeccccccccccccCcccccCHHHHHHHHHcCcchHHHHHhhcCcccce
Confidence            45689999999999999999999999999999997644444444445688999999999999766788887766543333


Q ss_pred             cccccccCCCceeeeccCCCchhhcCCCeEEeeCHHHHHHHHHHHcCCceEEcCceEEEEEeeCCeEEEEEcCCcEEecc
Q 006440          155 INGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGD  234 (645)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~i~a~  234 (645)
                      +..+.++..+.+...++...+....+.+..+.|+|..|+++|.+.++...++++++|++++.++++++|++++|+++++|
T Consensus       159 i~~~~d~~~G~~~~~~~~~~~~~~~g~p~~~~I~R~~L~~~L~~alg~~~i~~g~~V~~I~~~~d~VtV~~~dG~ti~aD  238 (668)
T PLN02927        159 INGLVDGISGSWYVKFDTFTPAASRGLPVTRVISRMTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGD  238 (668)
T ss_pred             eeeeeecCCCceEeeccccccccccCCCeEEEEeHHHHHHHHHhhCCCCEEEcCCEEEEEEEeCCEEEEEECCCCEEEcC
Confidence            33233433455555554433223345566789999999999999988777888999999999999999999999999999


Q ss_pred             EEEEccCCchhhhhhhcCCCCCcccCeEEEEEEeccCCCCccccceEEEecCceEEEEeecCCCeEEEEEEEeCCCCCCC
Q 006440          235 LLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVD  314 (645)
Q Consensus       235 lvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (645)
                      +||+|||++|.+|+.+++.....|.++.+|+++.+..+.+.....+..+.++..+++.++..++.+.|+.+...+.....
T Consensus       239 lVVGADG~~S~vR~~l~g~~~~~~sG~~~~rgi~~~~p~~~~~~~~~~~~G~~~~~v~~~v~~g~~~~~~f~~~p~~~~~  318 (668)
T PLN02927        239 LLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEPAGGAD  318 (668)
T ss_pred             EEEECCCCCcHHHHHhcCCCCCcccceEEEEEEcCCCcccccccceEEEEcCCeEEEEEcCCCCeEEEEEEEECCccccc
Confidence            99999999999999997776778999899988876655443444456677888888888887777888777665533323


Q ss_pred             CCcchHHHHHHHHcCCChhHHHHHHcCCccceeecccccCCCCCcccCCcEEEEccccCcCCCCCcchhhHHHHHHHHHH
Q 006440          315 GPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLA  394 (645)
Q Consensus       315 ~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~rvvLvGDAAH~~~P~~GqG~n~al~Da~~La  394 (645)
                      ......+.+++.|..|++.+.+++.......+..+.++...+..+|..|||+|+|||||+|+|+.|||+|+||+||..|+
T Consensus       319 ~~~~~~e~L~~~f~~w~~~v~elI~~t~~~~i~~~~iyd~~p~~~W~~grVvLiGDAAH~~~P~~GqG~n~AieDa~~La  398 (668)
T PLN02927        319 APNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIYDRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLA  398 (668)
T ss_pred             cchhHHHHHHHHhccCCHHHHHHHHhCccccceeeeEEeccCCCccccCcEEEEcCccCCCCCccccchHHHHHHHHHHH
Confidence            34556788899999999999888877665556677788777777999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCCChhhHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhHhhhhhccCCCccchhhhcccCCCCccccee
Q 006440          395 VELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRF  474 (645)
Q Consensus       395 ~~L~~~~~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~~~~~~~~  474 (645)
                      ++|.++++.....+.+.+.+.+|+.|+++|++++..++..+++...++..+..+.+.++.|+.+++.++++.|.++.+|+
T Consensus       399 ~~L~~~~~~~~~~~~~~~~~~aL~~Ye~~R~~rv~~i~~~ar~a~~~~~~~~~y~~~~~~p~~~~~~~~~~~~~~~~~~~  478 (668)
T PLN02927        399 LELDEAWKQSVETNTPVDVVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRF  478 (668)
T ss_pred             HHHHHhhccccccCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHhcCCCCCCceeeee
Confidence            99988764322223345678999999999999999999999999999998877778889999999999999999999999


Q ss_pred             eeeccchhhhHhhhcCCCCCCCCCCCceecCcccchHHhhhhccchhhhHhcCCcEEEEecCCCCCCCCCeEeeccCCCC
Q 006440          475 FIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENE  554 (645)
Q Consensus       475 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  554 (645)
                      |++.+||+||+|+.+++..++||++.+|.++|++++.+.+|++++++.|++.+++|+|+|.++.....++++|. ++|+.
T Consensus       479 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~l~~~~~~~~~~~~~~l~-~~~~~  557 (668)
T PLN02927        479 FVDIAMPLMLDWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCCVSETLCLT-KDEDQ  557 (668)
T ss_pred             eeecccHHHhhhhhcCCccccCCCCCccccccchhHHHHHHhcccHHHHHhhcCCeEEEecCCCCcccceeeee-cCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999888888999999 88899


Q ss_pred             CEEEcCCCCCCCCcceeeeCCCcccccceEEEEECCEEEEEECCCCcceeecCCCCceeecCCCCcEEcCCCCEEEECCC
Q 006440          555 PYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSD  634 (645)
Q Consensus       555 ~~~iGR~~~~~~~~~~~~~~~~~vSr~Ha~i~~~~~~~~i~D~~S~nGt~vn~~~~~~~~l~~~~~~~l~~gd~i~~g~~  634 (645)
                      +++|||.+.+++++.+|+|+++.||+.||+|.++++.|+|+||+|+||||||+..+++++++|+.+++|++||+|+||++
T Consensus       558 p~~iG~~~~~~~~~~~i~i~~~~vS~~Ha~i~~~~~~~~~~Dl~S~nGT~v~~~~~~r~~~~p~~~~~l~~~d~I~~g~~  637 (668)
T PLN02927        558 PCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSD  637 (668)
T ss_pred             CeEecCCCCcCCCCceEEecCCccChhHeEEEEECCEEEEEECCCCCccEEeCCCCceEecCCCCceEeCCCCEEEeCCC
Confidence            99999999999999999999999999999999999999999999999999999988989999999999999999999999


Q ss_pred             ceEEeec
Q 006440          635 KKVMNDS  641 (645)
Q Consensus       635 ~~~~~~~  641 (645)
                      ++..|+.
T Consensus       638 ~~~~fr~  644 (668)
T PLN02927        638 KKAAFRV  644 (668)
T ss_pred             cceeEEE
Confidence            8888863

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG0245 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG0241 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
3rp8_A407 Crystal Structure Of Klebsiella Pneumoniae R204q Hp 3e-23
3rp6_A407 Crystal Structure Of Klebsiella Pneumoniae Hpxo Com 1e-22
3c96_A410 Crystal Structure Of The Flavin-Containing Monooxyg 4e-18
2rgj_A402 Crystal Structure Of Flavin-Containing Monooxygenas 7e-17
3gmc_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 1e-09
3alh_A379 Higher Resolution And Native Structure Of 2-Methyl- 1e-09
3alk_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 2e-09
3all_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 3e-09
3gmb_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 2e-08
4hb9_A412 Crystal Structure Of A Putative Fad Containing Mono 4e-08
3alm_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 2e-05
>pdb|3RP8|A Chain A, Crystal Structure Of Klebsiella Pneumoniae R204q Hpxo Complexed With Fad Length = 407 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 122/254 (48%), Gaps = 15/254 (5%)
Query: 187 ISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKV 246
           +SR  LQ+ +    G + +     V   ++  D V+V   +G   +GDLLI ADG  S +
Sbjct: 124 VSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSHSAL 183
Query: 247 RKNLFG--PQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYA 304
           R  + G  PQ   Y+GY  + G+ +   A      +  F+G  +      V AG+  ++ 
Sbjct: 184 RPWVLGFTPQRR-YAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFF 242
Query: 305 FHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGR 364
               PAG  +  +  +  L + F GW   V  LI A D +   R +I+D  P     RGR
Sbjct: 243 DVPLPAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVRGR 302
Query: 365 VTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYE--R 422
           V LLGD+ H+  P++GQGGC A+ED    AV L    +++       DI +AL+ YE  R
Sbjct: 303 VALLGDAGHSTTPDIGQGGCAAMED----AVVLGAVFRQTR------DIAAALREYEAQR 352
Query: 423 ARRLRVAVIHGLAR 436
             R+R  V+    R
Sbjct: 353 CDRVRDLVLKARKR 366
>pdb|3RP6|A Chain A, Crystal Structure Of Klebsiella Pneumoniae Hpxo Complexed With Fad Length = 407 Back     alignment and structure
>pdb|3C96|A Chain A, Crystal Structure Of The Flavin-Containing Monooxygenase Phzs From Pseudomonas Aeruginosa. Northeast Structural Genomics Consortium Target Par240 Length = 410 Back     alignment and structure
>pdb|2RGJ|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase Phzs Length = 402 Back     alignment and structure
>pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 Back     alignment and structure
>pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 Back     alignment and structure
>pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 Back     alignment and structure
>pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 Back     alignment and structure
>pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 Back     alignment and structure
>pdb|4HB9|A Chain A, Crystal Structure Of A Putative Fad Containing Monooxygenase From Photorhabdus Luminescens Subsp. Laumondii Tto1 (Target Psi-012791) Length = 412 Back     alignment and structure
>pdb|3ALM|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant C294a Length = 379 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query645
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 1e-130
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 6e-95
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 5e-93
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 3e-82
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 1e-80
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 1e-37
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 7e-22
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-21
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 4e-17
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-16
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 7e-16
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 7e-14
3atr_A453 Conserved archaeal protein; saturating double bond 2e-12
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-12
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 2e-11
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 5e-11
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 6e-11
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 3e-10
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 3e-10
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 5e-10
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 8e-10
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 1e-09
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 2e-09
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 2e-09
2xt9_B115 Putative signal transduction protein GARA; lyase-s 3e-09
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 3e-09
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 6e-09
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 6e-09
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 8e-09
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 9e-09
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 1e-08
3po8_A100 RV0020C protein, putative uncharacterized protein 1e-08
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 2e-08
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 2e-08
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 3e-08
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 4e-08
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 1e-07
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 3e-06
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 3e-06
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 4e-06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 2e-05
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 3e-05
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 3e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 3e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 8e-05
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 8e-05
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 1e-04
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 1e-04
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 1e-04
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 1e-04
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 1e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 1e-04
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 3e-04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 3e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 3e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 4e-04
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 8e-04
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
 Score =  387 bits (996), Expect = e-130
 Identities = 103/377 (27%), Positives = 160/377 (42%), Gaps = 20/377 (5%)

Query: 64  AESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPI 123
               +  +      ++ +V G GIGGL  A+A K+ G +  V+E     I+  G     I
Sbjct: 10  HHHSSGENLYFQGHMKAIVIGAGIGGLSAAVALKQSGIDCDVYEAV-KEIKPVG---AAI 65

Query: 124 QIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPV 183
            +  N +  +    L + + +   G     R     D  SG    +F    P  E+    
Sbjct: 66  SVWPNGVKCMAH--LGMGDIMETFGGPL--RRMAYRDFRSGENMTQFS-LAPLIERTGSR 120

Query: 184 TRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIW 243
              +SR  LQ+ +    G + +     V   ++  D V+V   +G   +GDLLI ADG  
Sbjct: 121 PCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSH 180

Query: 244 SKVRKNLFGPQ-EAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQW 302
           S +R  + G   +  Y+GY  + G+ +   A      +  F+G  +      V AG+  +
Sbjct: 181 SALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYF 240

Query: 303 YAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGR 362
           +     PAG  +  +  +  L + F GW   V  LI A D +   R +I+D  P     R
Sbjct: 241 FFDVPLPAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVR 300

Query: 363 GRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYER 422
           GRV LLGD+ H+  P++GQGGC A+ED   L     +            DI +AL+ YE 
Sbjct: 301 GRVALLGDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQT----------RDIAAALREYEA 350

Query: 423 ARRLRVAVIHGLARSAA 439
            R  RV  +   AR   
Sbjct: 351 QRCDRVRDLVLKARKRC 367
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query645
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
4hb9_A412 Similarities with probable monooxygenase; flavin, 100.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 100.0
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 100.0
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 100.0
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 100.0
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 100.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 100.0
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 100.0
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 100.0
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 100.0
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 100.0
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 100.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 100.0
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 100.0
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 100.0
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 100.0
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.97
3atr_A453 Conserved archaeal protein; saturating double bond 99.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.97
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.97
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.96
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.95
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.95
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.94
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.94
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.94
2bry_A497 NEDD9 interacting protein with calponin homology a 99.82
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 99.79
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 99.76
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 99.75
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 99.74
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 99.74
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 99.73
2xt9_B115 Putative signal transduction protein GARA; lyase-s 99.72
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 99.72
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.72
3po8_A100 RV0020C protein, putative uncharacterized protein 99.71
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 99.71
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 99.7
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 99.7
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 99.7
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 99.7
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 99.7
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 99.69
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 99.68
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 99.68
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 99.68
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 99.68
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 99.67
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 99.67
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 99.65
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 99.62
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 99.61
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 99.54
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 99.49
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 99.48
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 99.47
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.45
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.39
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.37
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.35
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.32
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.32
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.3
3dme_A369 Conserved exported protein; structural genomics, P 99.28
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.27
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.26
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.23
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 99.2
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 99.18
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.15
4a0e_A123 YSCD, type III secretion protein; transport protei 99.14
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.1
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.09
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.08
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.08
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.05
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.04
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.03
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.02
2cul_A232 Glucose-inhibited division protein A-related PROT 99.01
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.01
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.01
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 99.01
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.98
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.98
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.97
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.95
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.94
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.94
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.94
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.94
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.92
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.92
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.92
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.91
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 98.89
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.87
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.87
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.86
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.85
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 98.85
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.85
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.84
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.83
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.8
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.8
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.79
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.79
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.78
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.78
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.78
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.77
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.76
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.76
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.73
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.73
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.72
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.72
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.71
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 98.7
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.69
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.68
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.67
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.62
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.62
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.61
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.59
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.58
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.57
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.57
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.56
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.56
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.52
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.51
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.5
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.49
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.43
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.43
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.42
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.42
1wv3_A238 Similar to DNA segregation ATPase and related prot 98.4
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.39
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.38
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.37
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.36
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.36
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.34
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.29
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.26
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.23
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.21
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.21
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.18
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.16
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.11
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.11
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.11
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.06
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.05
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.04
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.03
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.02
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.99
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.98
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.97
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.96
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.95
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.94
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.93
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.92
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.91
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.89
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.88
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.88
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.86
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.86
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.86
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.84
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.84
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.83
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.83
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.82
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.79
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.78
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.78
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.76
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.76
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.76
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.74
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.71
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.71
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.69
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.68
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.66
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.65
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.64
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.63
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.59
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.57
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.57
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.57
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.56
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.56
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.56
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.55
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.53
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.52
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.51
4dna_A463 Probable glutathione reductase; structural genomic 97.51
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.49
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.49
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.49
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.48
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.46
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.44
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.43
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.42
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.42
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.42
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.42
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.42
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.42
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.41
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.41
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.4
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.4
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.38
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.37
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.37
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.37
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.37
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.36
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.36
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.36
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.36
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.34
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.33
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.33
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.32
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.31
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.31
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.31
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.3
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.3
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.29
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.26
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.26
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.25
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.25
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.24
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.23
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.22
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.2
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.18
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.17
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.14
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.13
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.13
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.1
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.09
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.09
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.09
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.06
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.04
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.04
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.02
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.01
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.98
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.95
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.95
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.94
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.94
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.93
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.91
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.9
4dna_A463 Probable glutathione reductase; structural genomic 96.88
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.82
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.79
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.79
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.79
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.78
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.77
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.75
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.73
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.72
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.66
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.66
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.54
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.52
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.48
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.48
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.44
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.41
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.4
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.37
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.34
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.29
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.28
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.26
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.25
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.23
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.16
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.1
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.03
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 95.96
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.85
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 95.83
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.76
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.73
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.66
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.61
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.46
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 95.37
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 95.36
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 95.27
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.25
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.2
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.17
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.14
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.77
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.77
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 94.75
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 94.53
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.15
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.14
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.14
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.06
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.05
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.7
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 93.65
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.45
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 93.4
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.37
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.36
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.08
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.01
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 92.78
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.68
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 92.56
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.32
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 92.31
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 92.18
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.15
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.04
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 91.98
3tl2_A315 Malate dehydrogenase; center for structural genomi 91.96
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.96
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 91.96
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.94
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 91.89
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.88
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.82
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.81
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.72
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 91.68
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 91.66
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.59
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.57
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.56
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.55
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.4
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 91.34
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.23
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.1
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.06
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 90.87
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 90.85
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.78
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 90.76
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 90.75
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 90.7
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 90.52
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 90.52
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 90.43
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 90.41
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.39
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.32
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.29
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.29
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 90.25
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 90.21
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.09
3qha_A296 Putative oxidoreductase; seattle structural genomi 90.07
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.02
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.99
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.89
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.88
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 89.85
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 89.82
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 89.74
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 89.72
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 89.69
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 89.61
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.38
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.3
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 89.3
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 89.26
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.21
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 89.11
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 89.08
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.01
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 88.92
3l6d_A306 Putative oxidoreductase; structural genomics, prot 88.89
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 88.72
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 88.7
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 88.39
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 88.39
4ezb_A317 Uncharacterized conserved protein; structural geno 88.36
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 88.3
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 88.17
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 88.07
3ius_A286 Uncharacterized conserved protein; APC63810, silic 88.0
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 87.99
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 87.98
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 87.97
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.89
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 87.79
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 87.74
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 87.72
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.71
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 87.69
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.67
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 87.53
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 87.5
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 87.47
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 87.46
1vpd_A299 Tartronate semialdehyde reductase; structural geno 87.39
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.39
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 87.39
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 87.39
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 87.38
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 87.36
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 87.29
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 87.16
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 87.1
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 87.07
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 87.0
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 86.95
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 86.89
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 86.88
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 86.85
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 86.73
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 86.72
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 86.69
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 86.66
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 86.66
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 86.66
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 86.66
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 86.63
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 86.59
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 86.32
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 86.26
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 86.16
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 86.16
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 86.15
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 86.06
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 86.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 85.9
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 85.87
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 85.86
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 85.86
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 85.68
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 85.67
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 85.61
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 85.57
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 85.4
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 85.3
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 85.18
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 85.15
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 85.09
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 85.03
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 84.96
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 84.77
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 84.64
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 84.61
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 84.59
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 84.57
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 84.54
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 84.54
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 84.34
2rir_A300 Dipicolinate synthase, A chain; structural genomic 84.31
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 84.3
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.21
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 84.08
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 83.96
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 83.84
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 83.81
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 83.79
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 83.78
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 83.59
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 83.52
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 83.5
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 83.36
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-42  Score=372.13  Aligned_cols=369  Identities=27%  Similarity=0.375  Sum_probs=274.5

Q ss_pred             CCCCcCcEEEEcCCHHHHHHHHHHHHCCCeEEEEeccCccccCCCCcccceeeCchHHHHHHhcChhHHHHHHHhccccc
Q 006440           73 SENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTG  152 (645)
Q Consensus        73 ~~~~~~~v~i~g~g~~g~~~a~~l~~~g~~~~~~~~~~~~~~~~g~~~~~~~l~~~~~~~l~~l~~g~~~~~~~~~~~~~  152 (645)
                      ....++||+||||||+|+++|+.|+++|++|+|+|+.+.... .   ..++.+.++++++|+++  |+++++...+....
T Consensus        19 ~~~~~~dV~IVGaG~aGl~~A~~La~~G~~V~v~E~~~~~~~-~---~~~~~l~~~~~~~l~~l--g~~~~~~~~~~~~~   92 (407)
T 3rp8_A           19 YFQGHMKAIVIGAGIGGLSAAVALKQSGIDCDVYEAVKEIKP-V---GAAISVWPNGVKCMAHL--GMGDIMETFGGPLR   92 (407)
T ss_dssp             ----CCEEEEECCSHHHHHHHHHHHHTTCEEEEEESSSCC--------CEEEECHHHHHHHHHT--TCHHHHHHHSCCCC
T ss_pred             cCCCCCEEEEECCCHHHHHHHHHHHhCCCCEEEEeCCCCCCC-c---CeeEEECHHHHHHHHHC--CCHHHHHhhcCCCc
Confidence            344578999999999999999999999999999999864322 2   23688999999999999  78888877654321


Q ss_pred             cccccccccCCCceeeeccCCCchhhcCCCeEEeeCHHHHHHHHHHHcCCceEEcCceEEEEEeeCCeEEEEEcCCcEEe
Q 006440          153 DRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYA  232 (645)
Q Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~i~  232 (645)
                       .+. +.+...+.....++........+ +..+.++|..|++.|.+.+....++++++|++++.++++++|++.+|++++
T Consensus        93 -~~~-~~~~~~g~~~~~~~~~~~~~~~~-~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~~~  169 (407)
T 3rp8_A           93 -RMA-YRDFRSGENMTQFSLAPLIERTG-SRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSAS  169 (407)
T ss_dssp             -EEE-EEETTTCCEEEEEECHHHHHHHS-SCCEEEEHHHHHHHHHHHHCGGGEEESCCEEEEEEETTEEEEEETTSCEEE
T ss_pred             -ceE-EEECCCCCEeEEecchhhhhhcC-CceEEEEHHHHHHHHHHhCCcCEEEECCEEEEEEecCCcEEEEEcCCCEEe
Confidence             221 23322233333333211111111 235789999999999998865558899999999999999999999999999


Q ss_pred             ccEEEEccCCchhhhhhhcCC-CCCcccCeEEEEEEeccCCCCccccceEEEecCceEEEEeecCCCeEEEEEEEeCCCC
Q 006440          233 GDLLIGADGIWSKVRKNLFGP-QEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAG  311 (645)
Q Consensus       233 a~lvVgADG~~S~vR~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  311 (645)
                      ||+||+|||.+|.||+.+.+. ....|.++.++.++............+..+.+++.+++.+|..++...|++....+..
T Consensus       170 a~~vV~AdG~~S~vr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~  249 (407)
T 3rp8_A          170 GDLLIAADGSHSALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPLPAG  249 (407)
T ss_dssp             ESEEEECCCTTCSSHHHHHSSCCCCEEEEEEEEEEEEECCTTTCCTTEEEEEEETTEEEEEEEETTTEEEEEEEEECCTT
T ss_pred             eCEEEECCCcChHHHHHhcCCCCCCcccCcEEEEEEEecccccCCCCceEEEECCCcEEEEEEcCCCeEEEEEEeCCCcC
Confidence            999999999999999999443 3556666666766654322222334566677888888889999998888877665443


Q ss_pred             CCCCCcchHHHHHHHHcCCChhHHHHHHcCCccceeecccccCCCCCcccCCcEEEEccccCcCCCCCcchhhHHHHHHH
Q 006440          312 GVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGY  391 (645)
Q Consensus       312 ~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~rvvLvGDAAH~~~P~~GqG~n~al~Da~  391 (645)
                      .........+.+.+.+..|.+.+.+.+..........+.++...+..+|..+|++|||||||.++|++|||+|+||+||.
T Consensus       250 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rv~LvGDAAh~~~P~~GqG~~~al~da~  329 (407)
T 3rp8_A          250 LAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVRGRVALLGDAGHSTTPDIGQGGCAAMEDAV  329 (407)
T ss_dssp             CSCCTTTHHHHHHHHTTTCCHHHHHHHHHSCGGGCEEEEEEECCCCSCCEETTEEECGGGTCCCCGGGSCHHHHHHHHHH
T ss_pred             CCCCchhHHHHHHHHhcCCChHHHHHHHcCCccceeEEeeEecCCCCceecCCEEEEEcccccCCcchhhhHHHHHHHHH
Confidence            33334566788889999999988888877766554445555555557899999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccCCCCChhhHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhHhhhhhccCCCccchhhhcccCCC
Q 006440          392 QLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHP  467 (645)
Q Consensus       392 ~La~~L~~~~~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~  467 (645)
                      .|+++|...         . +...+|+.|+++|++++..++..++.+..+       +....+++..+|+..|...
T Consensus       330 ~La~~L~~~---------~-~~~~~l~~Y~~~r~~~~~~~~~~s~~~~~~-------~~~~~~~~~~~R~~~l~~~  388 (407)
T 3rp8_A          330 VLGAVFRQT---------R-DIAAALREYEAQRCDRVRDLVLKARKRCDI-------THGKDMQLTEAWYQELREE  388 (407)
T ss_dssp             HHHHHHHSC---------C-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HTTTTHHHHHHHHHHHHSC
T ss_pred             HHHHHHhcC---------C-CHHHHHHHHHHHHHHHHHHHHHHHHHhhhh-------hhcCCHHHHHHHHHHHhhc
Confidence            999999842         1 568999999999999999988887654433       3334455677888776544
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 645
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 5e-19
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 2e-16
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 2e-15
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 1e-07
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-14
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-05
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 5e-09
d1mzka_122 b.26.1.2 (A:) Kinase associated protein phosphatas 1e-08
d1dmza_158 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 1e-06
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-06
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 4e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 7e-06
d2piea1127 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 8e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 9e-06
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 1e-05
d1g6ga_127 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 1e-05
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-05
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 5e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 9e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 9e-05
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-04
d2g1la1102 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H 1e-04
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-04
d1wlna1107 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T 3e-04
d1gxca_116 b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T 4e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 6e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 6e-04
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 8e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 9e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 9e-04
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 0.001
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.002
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.002
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 0.002
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 0.002
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 0.003
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 0.003
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 0.003
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.004
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Phenol hydroxylase
species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]

 Score = 87.1 bits (214), Expect = 5e-19
 Identities = 48/392 (12%), Positives = 99/392 (25%), Gaps = 64/392 (16%)

Query: 80  ILVAGGGIGGLVFALA-----AKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALE 134
           +L+ G G  GL+ A        ++   +V + +K  S     G  +    +Q   L +L+
Sbjct: 10  VLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKR-STKVYNG--QA-DGLQCRTLESLK 65

Query: 135 AIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQ 194
              L +A++++         I       +G                     V+ +  +++
Sbjct: 66  N--LGLADKILSEANDM-STIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIER 122

Query: 195 ILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQ 254
            +  ++ +                          +    D     D     V   L    
Sbjct: 123 RILDSIAEI------------SDTRIKVERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMS 170

Query: 255 EAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVD 314
           E   +         +                          G  +       +E A    
Sbjct: 171 EDESTPLQFGHKTEN--------------------------GLFRSNLQTQEEEDANYRL 204

Query: 315 GPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHA 374
               +   +  +   +                    + ++         RV + GD+ H 
Sbjct: 205 PEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIVTEK----FSKDERVFIAGDACHT 260

Query: 375 MQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGL 434
             P  GQG   ++ D Y L  +L                   LK+YE  R+     +   
Sbjct: 261 HSPKAGQGMNTSMMDTYNLGWKLGLVLTG-------RAKRDILKTYEEERQPFAQALIDF 313

Query: 435 ARSAAVMASTY---KAYLGVGLGPLSFLTKFR 463
               + + S          +G+    F   F 
Sbjct: 314 DHQFSRLFSGRPAKDVADEMGVSMDVFKEAFV 345
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query645
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.96
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.95
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.9
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.88
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.76
d1mzka_122 Kinase associated protein phosphatase {Thale cress 99.76
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.76
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.73
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.66
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.64
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.63
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.6
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.6
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 99.47
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.43
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.43
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.25
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.23
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.16
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.13
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.12
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.1
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.0
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.85
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.73
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.72
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.65
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.62
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.62
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.62
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.61
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.59
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.54
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.51
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.51
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.51
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.48
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.46
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.46
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.46
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.44
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.44
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.44
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.43
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.39
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.34
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.33
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.3
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.25
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.22
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.2
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.17
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.17
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.16
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.15
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.15
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.15
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.14
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.13
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.12
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.1
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.07
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.07
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.05
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.02
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.02
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.99
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.99
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.99
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.94
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.94
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.94
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.93
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.91
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.9
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.9
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.88
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.78
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.74
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.68
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.66
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.63
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.63
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.61
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.6
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.55
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.54
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.43
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.42
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.35
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.24
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.15
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.0
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.99
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.89
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.71
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.67
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.58
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.56
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.31
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.16
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.12
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.51
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.33
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.16
d3c96a2111 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.98
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.85
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.76
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.75
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 94.67
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.62
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.6
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.42
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.2
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.12
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.0
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.93
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 93.75
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.59
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.58
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 93.58
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.55
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.28
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.91
d2voua2128 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.71
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.66
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.51
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.38
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 92.29
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.2
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.19
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.16
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.15
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.01
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.95
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.95
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.89
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.79
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 91.79
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.68
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 91.42
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.13
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.09
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.72
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 90.56
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.52
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.51
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.48
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 90.34
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.2
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.19
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 90.04
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.85
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 89.76
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.11
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.07
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.45
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 88.28
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.96
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.91
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 87.87
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 87.22
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.09
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.78
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 86.45
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.4
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 86.27
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.16
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.09
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.98
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.55
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 84.39
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 84.28
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.22
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 83.53
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.18
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.15
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.14
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 82.83
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 82.53
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 82.1
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 81.71
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monooxygenase PhzS
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.96  E-value=4.4e-28  Score=243.66  Aligned_cols=247  Identities=34%  Similarity=0.470  Sum_probs=177.1

Q ss_pred             cCcEEEEcCCHHHHHHHHHHHHCCC-eEEEEeccCccccCCCCcccceeeCchHHHHHHhcChhHHHHHHHhcccccccc
Q 006440           77 KLRILVAGGGIGGLVFALAAKRKGF-EVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRI  155 (645)
Q Consensus        77 ~~~v~i~g~g~~g~~~a~~l~~~g~-~~~~~~~~~~~~~~~g~~~~~~~l~~~~~~~l~~l~~g~~~~~~~~~~~~~~~~  155 (645)
                      ++||+||||||+||++|+.|+++|+ +|+|+|+.+... ..   ..++.+.++++++|+++  ++++.+...........
T Consensus         1 ~~~V~IvGaG~aGl~~A~~L~~~Gi~~V~V~Er~~~~~-~~---g~~i~l~~~~~~~l~~~--~~~~~~~~~~~~~~~~~   74 (288)
T d3c96a1           1 PIDILIAGAGIGGLSCALALHQAGIGKVTLLESSSEIR-PL---GVGINIQPAAVEALAEL--GLGPALAATAIPTHELR   74 (288)
T ss_dssp             CCEEEEECCSHHHHHHHHHHHHTTCSEEEEEESSSSCC-CC---SCEEEECHHHHHHHHHT--TCHHHHHHHSEEECEEE
T ss_pred             CCEEEEECcCHHHHHHHHHHHhCCCCeEEEEeCCCCCC-CC---ceEEEECHHHHHHHHHc--CchhhhHhhhcccccce
Confidence            3699999999999999999999996 899999986432 22   23688999999999999  77888876654322211


Q ss_pred             ccccccCCCceeeeccCCCchhhcCCCeEEeeCHHHHHHHHHHH----cCCceEEcCceEEEEEeeCCeEEEEEcCC---
Q 006440          156 NGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKA----VGDEIILNESNVIDFKDHGDKVSVVLENG---  228 (645)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~----~~~~~i~~~~~v~~i~~~~~~v~v~~~~g---  228 (645)
                        ..+ ..+.....+.... ......+ .+...+......+...    .....+.++++++.++.+++++.+++.++   
T Consensus        75 --~~~-~~g~~~~~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~v~v~~~~g~~~  149 (288)
T d3c96a1          75 --YID-QSGATVWSEPRGV-EAGNAYP-QYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRVLIGARDGHGK  149 (288)
T ss_dssp             --EEC-TTSCEEEEEECGG-GGTCSSC-EEEEEHHHHHHHHHHHHHHHHCTTSEEESEEEEEEEEETTEEEEEEEETTSC
T ss_pred             --eEc-CCCCEEEeccccc-cccccCc-ccccchhhhHHHHHHHHHHhccCeeeecCcEEEEeeecCCcEEEEEEcCCCC
Confidence              111 2233222222211 1111222 2344454444443332    23345788999999999999999999876   


Q ss_pred             -cEEeccEEEEccCCchhhhhhhcCCCCCcccCeEEEEEEeccCCCCccccceEEEecCceEEEEeecCCCeEEEEEEEe
Q 006440          229 -QCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHK  307 (645)
Q Consensus       229 -~~i~a~lvVgADG~~S~vR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  307 (645)
                       +++++|+||+|||.+|.||+.+.......+.                                                
T Consensus       150 ~~~~~ad~vi~ADG~~S~vr~~~~~~~~~~~~------------------------------------------------  181 (288)
T d3c96a1         150 PQALGADVLVGADGIHSAVRAHLHPDQRPLRD------------------------------------------------  181 (288)
T ss_dssp             EEEEEESEEEECCCTTCHHHHHHCTTCCCCCC------------------------------------------------
T ss_pred             eEEEeeceeeccCCccceeeeeeccccccccc------------------------------------------------
Confidence             4799999999999999999886221000000                                                


Q ss_pred             CCCCCCCCCcchHHHHHHHHcCCChhHHHHHHcCCccceeecccccCCCCCcccCCcEEEEccccCcCCCCCcchhhHHH
Q 006440          308 EPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAI  387 (645)
Q Consensus       308 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~rvvLvGDAAH~~~P~~GqG~n~al  387 (645)
                                                                      ....|..++++++|||+|.++|+.|||+|+++
T Consensus       182 ------------------------------------------------~~~~~~~~~~~~~gda~h~~~p~~g~G~~~ai  213 (288)
T d3c96a1         182 ------------------------------------------------PLPHWGRGRITLLGDAAHLMYPMGANGASQAI  213 (288)
T ss_dssp             ------------------------------------------------CCSCCCBTTEEECTHHHHCCCSSTTCTHHHHH
T ss_pred             ------------------------------------------------cccccccCcceecccccceeCCccccchhhhh
Confidence                                                            01135678999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHhhhHHHHHHHHHHHHHH
Q 006440          388 EDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAV  440 (645)
Q Consensus       388 ~Da~~La~~L~~~~~~~~~~~~~~~~~~~L~~Y~~~R~~~~~~~~~~s~~~~~  440 (645)
                      +|+..|++.|.+.          .+...+|+.|++.|++++..++..++....
T Consensus       214 ~d~~~l~~~l~~~----------~~~~~al~~y~~~r~pr~~~~~~~~~~~~~  256 (288)
T d3c96a1         214 LDGIELAAALARN----------ADVAAALREYEEARRPTANKIILANREREK  256 (288)
T ss_dssp             HHHHHHHHHHHHC----------SSHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHhhC----------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999762          345789999999999999998887765443
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure