Citrus Sinensis ID: 006482
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 643 | ||||||
| 225433351 | 804 | PREDICTED: uncharacterized protein LOC10 | 0.972 | 0.777 | 0.573 | 1e-180 | |
| 356533381 | 784 | PREDICTED: uncharacterized protein LOC10 | 0.933 | 0.765 | 0.529 | 1e-162 | |
| 297831252 | 728 | hypothetical protein ARALYDRAFT_898989 [ | 0.772 | 0.682 | 0.554 | 1e-143 | |
| 145338880 | 714 | protein BLISTER [Arabidopsis thaliana] g | 0.838 | 0.754 | 0.520 | 1e-141 | |
| 255554298 | 713 | conserved hypothetical protein [Ricinus | 0.734 | 0.661 | 0.555 | 1e-135 | |
| 125528809 | 760 | hypothetical protein OsI_04881 [Oryza sa | 0.754 | 0.638 | 0.477 | 1e-109 | |
| 115441767 | 760 | Os01g0911800 [Oryza sativa Japonica Grou | 0.751 | 0.635 | 0.483 | 1e-109 | |
| 242055353 | 770 | hypothetical protein SORBIDRAFT_03g04350 | 0.685 | 0.572 | 0.487 | 1e-109 | |
| 414879058 | 748 | TPA: hypothetical protein ZEAMMB73_30879 | 0.709 | 0.609 | 0.482 | 1e-108 | |
| 147843847 | 443 | hypothetical protein VITISV_004427 [Viti | 0.455 | 0.661 | 0.679 | 1e-104 |
| >gi|225433351|ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251145 [Vitis vinifera] gi|297741880|emb|CBI33315.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 637 bits (1642), Expect = e-180, Method: Compositional matrix adjust.
Identities = 369/643 (57%), Positives = 454/643 (70%), Gaps = 18/643 (2%)
Query: 9 LPEASQDYDSSNSSKSGFQGIEESQSKGNDSFPKVPTLVNSGPSHDFVTKISPQNSVSTL 68
P+A +D DSS SS+S F +EE+Q K + S K T+++ G S + S +NS
Sbjct: 172 FPQAIRDTDSS-SSQSNFHRMEETQQKDHKSSLKSFTVIDPGISQVPLANASSENS---- 226
Query: 69 FQSKPSNAIALGN-GHSFHSSSEGTAHLTTSTGGSASEVGLNTPSTTNFSDPVSFNTGEG 127
NAI N G++ SS + H T+ SA VG + P + +F+ + N +
Sbjct: 227 -----GNAILPNNYGYANMKSSADSVHPITTAKQSAFGVGQDVPGSVDFNVHMLSNKEDK 281
Query: 128 KPSNSASGLASLQ-STPFK-RSEYSGYNFDAGNSFNHVPVSSATNKFTLGKSRASFLDSL 185
K S+S L S ++P S + + FD S NH+P+ S T + +SR SFLDS+
Sbjct: 282 KLSSSFGYLPSTHGASPLASESSSTSFAFDVRGSSNHLPLYSVTPETNARRSRPSFLDSI 341
Query: 186 NVPRASSGTLFEQTEPERDS--FMSSSSLNSMDVLGSSPAQNPSMEKETTGAFSKTTTSN 243
NVPR S + TEP + F SSS +NSMDVLGSS + E E FSK SN
Sbjct: 342 NVPRVPSASHLPLTEPGKAEPFFSSSSKVNSMDVLGSSASTKSLAESENFEPFSKAGNSN 401
Query: 244 IPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQHIEDLTQEK 303
PS FD+ N +VS +R ++ R G +++S+E + F+S K NEDFAALEQHIEDLTQEK
Sbjct: 402 GPSLFDHSINSSVSVGNRVEMLRHGLDQNSLERKFEFHSQKQNEDFAALEQHIEDLTQEK 461
Query: 304 FALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFR 363
F+LQR+LEASRAL+ESLAAENSSLTDSYNQQ SVVNQLKS+MEKLQEEIK QLV+LESF+
Sbjct: 462 FSLQRALEASRALAESLAAENSSLTDSYNQQGSVVNQLKSDMEKLQEEIKAQLVDLESFK 521
Query: 364 NEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKIS 423
EYAN +LECNAADERAK+LASEVIGLEEKALRLRS+ELKLERQLENS +EISS+KKK+S
Sbjct: 522 IEYANAQLECNAADERAKLLASEVIGLEEKALRLRSSELKLERQLENSNAEISSFKKKVS 581
Query: 424 SLEKERQDFQSTIEALQEEKKMMQSKLRKASGSGKSIDFGKTAASTVNASTSTEDLAITD 483
SLEKERQD Q TI+ALQEEKK++Q K+RKAS +GKSID K+ + STST+DL D
Sbjct: 582 SLEKERQDLQLTIDALQEEKKLLQKKVRKASANGKSIDASKSPTDRKDVSTSTDDLVNED 641
Query: 484 TTL---DNSNQDTHDDASLPRIDASGSTLLPESGRLALEGLAVNIPHDQMRMIHNINALI 540
+ S+ + + AS+ + S LLP+ G++ E +VNIP DQMRMI NINALI
Sbjct: 642 NACMIPETSSLEMLNSASVQANELSSFPLLPDGGQMNFEVSSVNIPADQMRMIQNINALI 701
Query: 541 SELALEKEELVQALSSELAQSSKLKDLNNELSRKLEHQTQRLELLTAQNMANENISFRQP 600
SELALEKEEL+QAL +E +QSSKLKDLN ELSRKLE QTQRLELLT+Q+MANE I RQP
Sbjct: 702 SELALEKEELMQALVTESSQSSKLKDLNKELSRKLEVQTQRLELLTSQSMANEVIQARQP 761
Query: 601 DSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPSRRRTSKLL 643
DS HD+ AYADEGDEVVERVLGWIM+LFPGGP++RRTSKLL
Sbjct: 762 DSRIMHDNAAYADEGDEVVERVLGWIMRLFPGGPAKRRTSKLL 804
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356533381|ref|XP_003535243.1| PREDICTED: uncharacterized protein LOC100817279 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297831252|ref|XP_002883508.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] gi|297329348|gb|EFH59767.1| hypothetical protein ARALYDRAFT_898989 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|145338880|ref|NP_189040.3| protein BLISTER [Arabidopsis thaliana] gi|9294667|dbj|BAB03016.1| unnamed protein product [Arabidopsis thaliana] gi|332643320|gb|AEE76841.1| protein BLISTER [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255554298|ref|XP_002518189.1| conserved hypothetical protein [Ricinus communis] gi|223542785|gb|EEF44322.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|125528809|gb|EAY76923.1| hypothetical protein OsI_04881 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115441767|ref|NP_001045163.1| Os01g0911800 [Oryza sativa Japonica Group] gi|20161363|dbj|BAB90287.1| heavy meromyosin-like [Oryza sativa Japonica Group] gi|113534694|dbj|BAF07077.1| Os01g0911800 [Oryza sativa Japonica Group] gi|125573067|gb|EAZ14582.1| hypothetical protein OsJ_04505 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242055353|ref|XP_002456822.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] gi|241928797|gb|EES01942.1| hypothetical protein SORBIDRAFT_03g043500 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|414879058|tpg|DAA56189.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879059|tpg|DAA56190.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] gi|414879060|tpg|DAA56191.1| TPA: hypothetical protein ZEAMMB73_308793 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|147843847|emb|CAN79450.1| hypothetical protein VITISV_004427 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 643 | ||||||
| TAIR|locus:2076071 | 714 | BLI "BLISTER" [Arabidopsis tha | 0.897 | 0.808 | 0.437 | 3.8e-110 | |
| DICTYBASE|DDB_G0271670 | 374 | DDB_G0271670 [Dictyostelium di | 0.418 | 0.719 | 0.174 | 0.0001 | |
| UNIPROTKB|O18515 | 534 | O18515 "Nucleoporin p62" [Hydr | 0.314 | 0.378 | 0.221 | 0.0002 | |
| CGD|CAL0006203 | 768 | orf19.4906 [Candida albicans ( | 0.376 | 0.315 | 0.247 | 0.00052 | |
| UNIPROTKB|Q5APQ2 | 768 | CaO19.4906 "Putative uncharact | 0.376 | 0.315 | 0.247 | 0.00052 | |
| UNIPROTKB|I3LRD3 | 2501 | CENPE "Uncharacterized protein | 0.421 | 0.108 | 0.224 | 0.0007 | |
| DICTYBASE|DDB_G0271334 | 1505 | DDB_G0271334 "dilute domain-co | 0.186 | 0.079 | 0.251 | 0.00074 |
| TAIR|locus:2076071 BLI "BLISTER" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1088 (388.1 bits), Expect = 3.8e-110, P = 3.8e-110
Identities = 266/608 (43%), Positives = 359/608 (59%)
Query: 47 VNSGPSHDFVTKISPQNSVSTLFQSKPSNAIALGNGHSFHSSSEGTAHLTTSTGGSASEV 106
VN+ P + I Q+S S S +L +G S +G H + T +
Sbjct: 127 VNTRPEVVPYSNIDKQSSESFDRASTLRETASLFSGTSMQM--DGFIHGSGLTSSRKDSL 184
Query: 107 GLNTPSTTNFSDPVSFNTGEG--------KPSNSASGLASLQSTPFKRSEYSGYNFDAGN 158
T +F + G G KP+ S+S L + T + SE S ++ + +
Sbjct: 185 QPTTRMAGSFDEVAKNQQGSGELGGSIVQKPTLSSSYLFNSPDTSSRPSEPSDFSVNITS 244
Query: 159 SFNHVPVSSATNKFTLGKSRASFLDSLNVPRASSGTLFEQTEPERXXXXXXXXXXXXXXX 218
S P++SA ++ T+ +SR SFLDSLN+ RA T ++ PE
Sbjct: 245 SS---PLNSAKSEATVKRSRPSFLDSLNISRAPE-TQYQH--PEIQADLVTSSGSQLSGS 298
Query: 219 XXXPAQNPSMEKETTGAFSKTT-TSNIPSAFDYLGNPTVSTSDRGDIRRLGSNESSIENQ 277
S +++ G S T+ S+ P+ F+ + ++ G + G + S+ Q
Sbjct: 299 DGFGPSYISGRRDSNGPSSLTSGASDYPNPFEKFRSSLYPAAN-GVMP--GFTDFSMPKQ 355
Query: 278 HGFYSTKHNEDFAALEQHIEDLTQEKFALQXXXXXXXXXXXXXXXXXXXXTDSYNQQRSV 337
N+DF ALEQHIEDLTQEKF+LQ TD+YNQQR +
Sbjct: 356 --------NDDFTALEQHIEDLTQEKFSLQRDLDASRALAESLASENSSMTDTYNQQRGL 407
Query: 338 VNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRL 397
VNQLK +ME+L ++I+ Q+ ELES R EYAN +LECNAADER++ILASEVI LE+KALRL
Sbjct: 408 VNQLKDDMERLYQQIQAQMGELESVRVEYANAQLECNAADERSQILASEVISLEDKALRL 467
Query: 398 RSNELKLERQLENXXXXXXXXXXXXXXXXXXRQDFQSTIEALQEEKKMMQSKLRKASGSG 457
RSNELKLER+LE RQD QSTI+ALQEEKK++Q+ ++KAS G
Sbjct: 468 RSNELKLERELEKAQTEMLSYKKKLQSLEKDRQDLQSTIKALQEEKKVLQTMVQKASSGG 527
Query: 458 KSIDFGKXXXXXXXXXXXXEDLAITDTTLDNSNQDTHDDASLPRIDASGSTLLPESGRLA 517
KS D K E LAI+DTT ++SNQ+T D +L D+S + ++PE+ +L
Sbjct: 528 KSTDLSKNSTSRKNVSTSTEGLAISDTTPESSNQET-DSTTLLESDSSNTAIIPETRQLT 586
Query: 518 LEGLAVNIPHDQMRMIHNINALISELALEKEELVQALSSELAQSSKLKDLNNELSRKLEH 577
LEG ++++P DQMR+IHNIN LI+ELA+EKEELVQALSSEL++S+ +++LN ELSRKLE
Sbjct: 587 LEGFSLSVPADQMRVIHNINTLIAELAIEKEELVQALSSELSRSAHVQELNKELSRKLEA 646
Query: 578 QTQRLELLTAQNMANENIS--FRQPDSASTHDHTAYADEGDEVVERVLGWIMKLFPGGPS 635
QTQRLEL+TAQ MA +N+S +QPD+ + T ADEGDEVVERVLGWIMK+FPGGPS
Sbjct: 647 QTQRLELVTAQKMAIDNVSPEKQQPDTHVVQERTPIADEGDEVVERVLGWIMKMFPGGPS 706
Query: 636 RRRTSKLL 643
+RRTSKLL
Sbjct: 707 KRRTSKLL 714
|
|
| DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O18515 O18515 "Nucleoporin p62" [Hydra vulgaris (taxid:6087)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006203 orf19.4906 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5APQ2 CaO19.4906 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LRD3 CENPE "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0271334 DDB_G0271334 "dilute domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 643 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-07 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 4e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-06 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 9e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 2e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 5e-05 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 6e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-05 | |
| COG3096 | 1480 | COG3096, MukB, Uncharacterized protein involved in | 9e-05 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 4e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 6e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-04 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK10929 | 1109 | PRK10929, PRK10929, putative mechanosensitive chan | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| COG4717 | 984 | COG4717, COG4717, Uncharacterized conserved protei | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.004 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 65.5 bits (160), Expect = 6e-11
Identities = 48/196 (24%), Positives = 93/196 (47%), Gaps = 3/196 (1%)
Query: 261 RGDIRRLGSNESSIENQHGFYSTKHNEDFAALEQ---HIEDLTQEKFALQRSLEASRALS 317
+ L +E Q + LEQ +E+L +E L+ LE +
Sbjct: 701 EDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERL 760
Query: 318 ESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAAD 377
E L E SL ++ + + + +L+ + + LQEE++ ELE + E + +
Sbjct: 761 EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLE 820
Query: 378 ERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIE 437
+R + L E+ LEE+ L +LE +LE + E+ K+++ LE E+++ + ++
Sbjct: 821 QRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELK 880
Query: 438 ALQEEKKMMQSKLRKA 453
L+EEK+ ++ +LR+
Sbjct: 881 ELEEEKEELEEELREL 896
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|225638 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236798 PRK10929, PRK10929, putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227061 COG4717, COG4717, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.2 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.09 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.95 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.91 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.65 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.56 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.54 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.49 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.46 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.4 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.25 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.22 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.2 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.18 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.18 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.1 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.05 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.02 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.97 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.95 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.86 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.81 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.72 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.7 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.7 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.64 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.63 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.63 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.57 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.53 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.51 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.44 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.43 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.39 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.34 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.33 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.31 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.18 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.15 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.05 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.05 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.05 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 95.97 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.97 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 95.94 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.81 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.8 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.77 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.75 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.74 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.65 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.65 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.64 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.62 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 95.6 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.53 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.35 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.26 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.26 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 95.17 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 95.14 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.06 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 95.01 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 94.99 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.95 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.91 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.91 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.87 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.85 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 94.83 | |
| PF13166 | 712 | AAA_13: AAA domain | 94.76 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.54 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.45 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 94.43 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 94.41 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 94.35 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.3 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 94.29 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.23 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.23 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.19 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 94.16 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 94.14 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.1 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.95 | |
| PF13514 | 1111 | AAA_27: AAA domain | 93.9 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 93.9 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.87 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 93.82 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 93.79 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.75 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 93.73 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 93.67 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 93.66 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.55 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 93.36 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 93.26 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 93.18 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.08 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.07 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.03 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 93.01 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 92.98 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.96 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 92.96 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 92.92 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 92.88 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 92.85 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 92.83 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 92.82 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 92.82 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 92.76 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 92.66 | |
| PF13514 | 1111 | AAA_27: AAA domain | 92.58 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 92.55 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 92.54 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.45 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 92.44 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 92.12 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 92.03 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 92.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 91.98 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 91.89 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.79 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 91.62 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 91.58 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 91.57 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 91.54 | |
| cd07647 | 239 | F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ | 91.4 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 91.38 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 91.0 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 90.95 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 90.88 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 90.8 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 90.74 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 90.71 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 90.65 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 90.55 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 90.49 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 90.49 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.45 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 90.43 | |
| cd07671 | 242 | F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin | 90.41 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 90.33 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 90.13 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 90.04 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 89.98 | |
| PF05546 | 207 | She9_MDM33: She9 / Mdm33 family; InterPro: IPR0088 | 89.96 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 89.81 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 89.74 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 89.5 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 89.44 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 89.35 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 89.2 | |
| cd07655 | 258 | F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ | 89.12 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 89.08 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 88.96 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 88.84 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.83 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 88.8 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 88.51 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 88.33 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 88.22 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 88.2 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 88.18 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 88.14 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 88.11 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 88.07 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 88.01 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 87.82 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 87.73 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 87.09 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 86.96 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 86.85 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 86.84 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 86.79 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 86.77 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 86.63 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 86.63 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 86.6 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 86.47 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 86.44 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 86.32 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 86.21 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 86.14 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.1 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 86.0 | |
| cd07675 | 252 | F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ | 85.78 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 85.57 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 85.48 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 85.32 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 85.11 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 84.93 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 84.88 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 84.87 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 84.83 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 84.67 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 84.64 | |
| cd07672 | 240 | F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin | 84.6 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 84.27 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 84.25 | |
| PF13166 | 712 | AAA_13: AAA domain | 84.01 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 83.73 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 83.38 | |
| PF13815 | 118 | Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro | 83.24 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 82.95 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 82.9 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.88 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 82.85 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 82.82 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 82.58 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 82.55 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 82.51 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 82.48 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 82.3 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 82.03 | |
| PRK09973 | 85 | putative outer membrane lipoprotein; Provisional | 81.96 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 81.8 | |
| PF04380 | 79 | BMFP: Membrane fusogenic activity; InterPro: IPR00 | 81.56 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 81.34 | |
| PF13942 | 179 | Lipoprotein_20: YfhG lipoprotein | 80.87 | |
| PRK10722 | 247 | hypothetical protein; Provisional | 80.57 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 80.56 | |
| cd07649 | 233 | F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am | 80.38 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 80.03 |
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Probab=98.20 E-value=0.0024 Score=72.16 Aligned_cols=163 Identities=17% Similarity=0.313 Sum_probs=72.9
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHH
Q 006482 287 EDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEY 366 (643)
Q Consensus 287 ~~faaLqqhIeDLT~EKfaLqR~L~~s~~l~esLa~ENsaLt~~yNqQ~~~v~qLk~~mE~Lq~Ei~aQ~~~le~l~aEr 366 (643)
.+...|++.++++..+--.+...+.....-.+++..+-..+..........+..++.++++++.++......++.+..+.
T Consensus 677 ~e~~~l~~~~~~l~~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~e~~~~~~~~ 756 (1179)
T TIGR02168 677 REIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKEL 756 (1179)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34445555555555554444444444444444444444444444444444444444555444444444444444444444
Q ss_pred HHHhhhhhhHHHHHHHHHHHHHhHHHHHHHHhhhhhhhHHHHhhhHHHHHHHHHHhhhHHHhhhhhHHHHHHHHHHHHHH
Q 006482 367 ANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEEKKMM 446 (643)
Q Consensus 367 daArle~~aA~ERak~LAaEVV~LEEk~l~LRS~eLKlerele~l~~E~~s~~~qlsslekeR~~l~s~i~aLQEEKklL 446 (643)
..+..+.....++...+-.++-.|++++..++...-.++.++..+..++..++.++..+..+...++..+..++.+.+.+
T Consensus 757 ~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~l 836 (1179)
T TIGR02168 757 TELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANLRERLESLERRIAAT 836 (1179)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 44444444444444444444444444443333222223334444444444444444444444444444444444444444
Q ss_pred HHH
Q 006482 447 QSK 449 (643)
Q Consensus 447 qsk 449 (643)
+.+
T Consensus 837 ~~~ 839 (1179)
T TIGR02168 837 ERR 839 (1179)
T ss_pred HHH
Confidence 433
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. |
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05546 She9_MDM33: She9 / Mdm33 family; InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis [] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PRK09973 putative outer membrane lipoprotein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF04380 BMFP: Membrane fusogenic activity; InterPro: IPR007475 BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF13942 Lipoprotein_20: YfhG lipoprotein | Back alignment and domain information |
|---|
| >PRK10722 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 643 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 7e-08 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-07 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 2e-07 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 6e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 8e-05 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 6e-05 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 1e-04 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 78.7 bits (193), Expect = 3e-15
Identities = 67/528 (12%), Positives = 142/528 (26%), Gaps = 156/528 (29%)
Query: 228 MEKETTGAFSKTTTSNIPSAFDYLGNPTVSTSDRGDIRRL-----GSNESSIENQHGFYS 282
++ SK +I + + + RL E ++ F
Sbjct: 38 VQDMPKSILSKEEIDHI------IMSKDAVSG----TLRLFWTLLSKQEEMVQK---FVE 84
Query: 283 TKHNEDFAALEQHIEDLTQEKFALQRSLEASRALSESLAAENSSLTDSYNQQR-SVVNQL 341
++ L I+ ++ + R R + L +N YN R +L
Sbjct: 85 EVLRINYKFLMSPIKTEQRQPSMMTRMYIEQR---DRLYNDNQVFAK-YNVSRLQPYLKL 140
Query: 342 KSEMEKLQEEIKV----------QLVELESFRNE-----------YANVRLECNAADERA 380
+ + +L+ V V L+ + + N++ CN+ +
Sbjct: 141 RQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK-NCNSPETVL 199
Query: 381 KILASEVIGLEEKALRLRSNELKLERQLENSQSEISSYKKKISSLEKERQ---------- 430
++L L ++ N N + I S + ++ L K +
Sbjct: 200 EMLQK----L---LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLN 252
Query: 431 ----------DFQSTI----------EAL--QEEKKMMQSKLRKASGSGKSID-FGKTAA 467
+ I + L + + K
Sbjct: 253 VQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLK--- 309
Query: 468 STVNASTSTEDL-----------------AITD--TTLDNSNQDTHDDASLPR-IDASGS 507
+DL +I D T DN D L I++S +
Sbjct: 310 ---YLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDK--LTTIIESSLN 364
Query: 508 TLLPESGRLALEGLAVNIPHDQMRMIHNINALISELALE------KEELVQALSSELAQS 561
L P R + L+V P A I + L + V + ++L +
Sbjct: 365 VLEPAEYRKMFDRLSV-FPPS---------AHIPTILLSLIWFDVIKSDVMVVVNKLHKY 414
Query: 562 SKLKDLNNELSRKLEHQTQRLELLTAQNMA--NENI--SFRQPDSASTHD---------- 607
S ++ E + + + +N + +I + P + + D
Sbjct: 415 SLVEKQPKESTISI-PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYF 473
Query: 608 --HTAY----ADEGDEVVE--RV---LGWI-MKLFPGGPSRRRTSKLL 643
H + + + + V ++ K+ + + +L
Sbjct: 474 YSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSIL 521
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.24 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.21 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.83 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.62 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.01 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.98 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.71 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.65 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.53 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.47 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.3 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.28 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 95.67 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.62 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.62 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 94.56 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 94.51 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.34 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 93.81 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 93.66 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 93.47 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.46 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 92.74 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 92.71 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 92.43 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 92.27 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 91.96 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 91.67 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 91.48 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 91.48 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 91.15 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 90.75 | |
| 3i2w_A | 290 | Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt | 90.51 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 90.42 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 89.74 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.58 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.1 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 86.87 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 85.37 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 84.8 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 84.2 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 84.13 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 83.99 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 82.65 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 82.51 | |
| 3m3w_A | 320 | Pacsin3, protein kinase C and casein kinase II sub | 82.4 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 82.28 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 81.33 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 81.22 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 80.52 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 80.25 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=98.24 E-value=0.00082 Score=60.15 Aligned_cols=38 Identities=13% Similarity=0.320 Sum_probs=15.2
Q ss_pred HHHHhhhHHHHHHHHHHhhhHHHhhhhhHHHHHHHHHH
Q 006482 405 ERQLENSQSEISSYKKKISSLEKERQDFQSTIEALQEE 442 (643)
Q Consensus 405 erele~l~~E~~s~~~qlsslekeR~~l~s~i~aLQEE 442 (643)
+.++..+..++..+..++..+...+..+...+..++++
T Consensus 222 ~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 259 (284)
T 1c1g_A 222 EEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDE 259 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33333344444444444444444444444433333333
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 643 | |||
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 94.87 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 89.25 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 88.57 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 87.09 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 82.58 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 81.39 |
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: CDC42-interacting protein 4, CIP4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=94.87 E-value=1.1 Score=39.15 Aligned_cols=111 Identities=14% Similarity=0.226 Sum_probs=68.3
Q ss_pred HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHhhhhhhHHHHHHHHHHHHHhHHHHHHHHhhhhhhhHH
Q 006482 327 LTDSYNQQRSVVNQLKSEMEKLQEEIKVQLVELESFRNEYANVRLECNAADERAKILASEVIGLEEKALRLRSNELKLER 406 (643)
Q Consensus 327 Lt~~yNqQ~~~v~qLk~~mE~Lq~Ei~aQ~~~le~l~aErdaArle~~aA~ERak~LAaEVV~LEEk~l~LRS~eLKler 406 (643)
|..-..++......++.++.+++.++......++..+..|+.+..++..|......+...+-.-..++.+++...-+.+.
T Consensus 93 l~~~~~~~~~~~k~~~~~~~~~~k~l~~~~~~~~k~k~~y~~~~~e~e~~~~~~~~~~~~~~~~~~~~~K~~~~~~~~~~ 172 (279)
T d2efka1 93 LTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSH 172 (279)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHH
Confidence 33444456666777888889999999999999999999999988888877777666554443334444444444444444
Q ss_pred HHhhhHHHHHHHHHHhhhHHHhhh-----hhHHHHHHHH
Q 006482 407 QLENSQSEISSYKKKISSLEKERQ-----DFQSTIEALQ 440 (643)
Q Consensus 407 ele~l~~E~~s~~~qlsslekeR~-----~l~s~i~aLQ 440 (643)
.++.++.+ |..+|..+...+. .|-.+++.||
T Consensus 173 ~~~~~~~~---y~~~l~~~n~~~~~~~~~~~p~~l~~lq 208 (279)
T d2efka1 173 MAEESKNE---YAAQLQRFNRDQAHFYFSQMPQIFDKLQ 208 (279)
T ss_dssp HHHHHHHH---HHHHHHHHHHHHHHHHHTHHHHHHHHHH
T ss_pred HHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 44444433 3344443333322 2344555555
|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|