Citrus Sinensis ID: 006515

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640--
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
ccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEEEccccccccccccEEEccccccEEcccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccccccccccccccccHHHccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEEEccccccccccccccccccHHHHcccccccccccccccccccccEEcccccEEccccccccccccccccccEEEEccccccccccccccccccccccEEEcccccccccccHHHHHcccccccccEEEEcccccccEEEEEccEEEEEccccccccccccccEEEEccccccccccHHHHHcccccEEEEEEEEEEccccEEEEEEEccccccccccccccccEEEEEEEEEccccccccccccccccEEEEEHHHHHHHHHHHHHHEEEEEEEccccccccccccccccccc
cccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccHccccccccEEEcccccccccccccccccccEEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHcccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEccccccccccHHHcccccccEEEEEcccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEccccccccccHHHccccccEEEccccEEEccccHHHHHcccccHHHcHHHHcccccccccccccHcEEEccccccEEcccccccccccccccccEEEEEcccccccccccHHcccccccEEEEEccccccccccHHHHHHccccccccccccccccccccEEEEEEEEEEEccccccccccccEEEEEEEcccccccccccHHHcccccEEEEEEEEEEcccEEEEEEEEccccccccccccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
mellrpslLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWnlrskinlttidpctrnaswasenanprvacdctsnschithlKIYALDIMGELPSELFMLRKLMDlnlgqnvlngsipaeigqlsNMQYLSLGInnftgrvptelgnlTKLISLsfssnnffgplpkelgklTSLQQlyidssgvtgsipQEFANLKSLRILWAsdnlftgkipeffGTLTELADLRLQgtllegpiprsFRALNKLedlrigdlsaedstldFLESQKSLSILSlrncrvsgkipdqlGTFAKLQLLDLSfnkltgqiptslqdlSTLQYLYlgnnnlsgelpvniiapnlialdvsynplsgnlprnfakgglsMKALGMMQclhsntkcsnkvpsssfsikcggtqiasasgiefdddsktLEAASFYTssgnrwavsntgnfisnpngplyiaqtdsqitgtldselyktarispsslryyglglengkyridLHFAEitmedslswkglgrRVFDVYIQGERVLRDLNikkeaggsKRALVKTFEANVTNTIIEIHFfwagkgtccipfqgtygplVSAIHAsqvstgngsskgdkkhvgKIVGITVGCAAALVIISSVFYLwwtkdssshiriftdspkqnlvr
MELLRPSLLLTVSLSLLQLVSAQtstdsaevDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMedslswkglgRRVFDVYIqgervlrdlnikkeaggskralVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVstgngsskgdkKHVGKIVGITVGCAAALVIISSVFYLWWTKDSsshiriftdspkqnlvr
MEllrpsllltvslsllqlvsaqtsTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLsfssnnffGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
*******LLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKC********FSIKCGGTQIAS**GI********LEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHA***************HVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIF**********
**LLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAA*FYTSSG**WA**NTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHA********************VGITVGCAAALVIISSVFYLWWTKDSSSHI***TDSPKQNL**
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQ************KHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
*ELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSS****I*****K*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLRPSLLLTVSLSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKGGLSMKALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQNLVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query642 2.2.26 [Sep-21-2011]
C0LGH2 1032 Probable LRR receptor-lik yes no 0.934 0.581 0.444 1e-144
C0LGH3 1033 Probable LRR receptor-lik no no 0.950 0.590 0.446 1e-143
C0LGN2 1020 Probable leucine-rich rep no no 0.861 0.542 0.380 5e-94
C0LGE0 1014 Probable LRR receptor-lik no no 0.872 0.552 0.352 6e-93
C0LGG8 1038 Probable LRR receptor-lik no no 0.852 0.526 0.354 9e-92
C0LGG9 1035 Probable LRR receptor-lik no no 0.839 0.520 0.359 4e-91
C0LGG7 953 Probable LRR receptor-lik no no 0.788 0.530 0.374 1e-87
Q9ASQ6 1019 Probable LRR receptor-lik no no 0.917 0.578 0.352 1e-80
Q9FXF2 1021 Probable LRR receptor-lik no no 0.883 0.555 0.317 5e-78
Q9SHI2 1101 Leucine-rich repeat recep no no 0.376 0.219 0.401 3e-40
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function desciption
 Score =  511 bits (1316), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 283/636 (44%), Positives = 387/636 (60%), Gaps = 36/636 (5%)

Query: 17  LQLVSAQTSTDSA----EVDALNKLIDYWNLRS----KINLTTIDPCTRNASWASENA-- 66
           +Q+V +Q  T +     E  ALN +   W +++     I+         +AS    N   
Sbjct: 24  VQVVQSQNQTGATTHPDEARALNSIFAAWKIQAPREWNISGELCSGAAIDASVLDSNPAY 83

Query: 67  NPRVACDCT---SNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEI 123
           NP + CDC+   S  C IT++K+YA+D++G +P EL+ L  L +LNLGQNVL GS+P  I
Sbjct: 84  NPLIKCDCSFQNSTICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAI 143

Query: 124 GQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYID 183
           G L+ MQ+++ GIN  +G VP E+G LT L  L  SSNNF G +P E+G+ T LQQ+YID
Sbjct: 144 GNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYID 203

Query: 184 SSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSF 243
           SSG++G IP  FANL  L   W +D   T +IP+F G  T+L  LR+ GT L GPIP SF
Sbjct: 204 SSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSF 263

Query: 244 RALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLS 303
             L  L +LR+GD+S+  S+LDF++  KSLS+L LRN  ++G IP  +G  + L+ +DLS
Sbjct: 264 SNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLS 323

Query: 304 FNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLP---- 359
           FNKL G IP SL +LS L +L+LGNN L+G  P      +L  +DVSYN LSG+LP    
Sbjct: 324 FNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQKTQ-SLRNVDVSYNDLSGSLPSWVS 382

Query: 360 ----------RNFAKGGLSMKALGMMQCLHSNTKCSN-KVPSSSFSIKCGGTQIASASGI 408
                      NF   GL  + L  + CL  N  C+  K   S FSI CGG +  S +G 
Sbjct: 383 LPSLKLNLVANNFTLEGLDNRVLPGLNCLQKNFPCNRGKGIYSDFSINCGGPEKRSVTGA 442

Query: 409 EFDDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTAR 468
            F+ + +    ASF+ S+G RWA S+ G F  + N  +YIA + SQ   TLDSEL+++AR
Sbjct: 443 LFEREDEDFGPASFFVSAGQRWAASSVGLFAGSSNN-IYIATSQSQFVNTLDSELFQSAR 501

Query: 469 ISPSSLRYYGLGLENGKYRIDLHFAEITM--EDSLSWKGLGRRVFDVYIQGERVLRDLNI 526
           +S SS+RYYGLGLENG Y + L FAEI +    S +WKGLGRR FD+Y+QG  V +D ++
Sbjct: 502 LSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDIYVQGRLVEKDFDV 561

Query: 527 KKEAGGSK-RALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHAS---QV 582
           ++ AG S  RA+ + ++ANV+   +E+H FWAGKGTCCIP QG YGPL+SA+ A+     
Sbjct: 562 RRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGPLISAVSATPDFTP 621

Query: 583 STGNGSSKGDKKHVGKIVGITVGCAAALVIISSVFY 618
           +  N      K   G IVG+ VG     ++   V +
Sbjct: 622 TVANKPPSKGKNRTGTIVGVIVGVGLLSILAGVVMF 657

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2 Back     alignment and function description
>sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=1 SV=1 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 Back     alignment and function description
>sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 Back     alignment and function description
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query642
296082046649 unnamed protein product [Vitis vinifera] 0.978 0.967 0.747 0.0
359476140 889 PREDICTED: probable LRR receptor-like se 0.978 0.706 0.747 0.0
255548896 895 ATP binding protein, putative [Ricinus c 0.959 0.688 0.747 0.0
224143160608 predicted protein [Populus trichocarpa] 0.878 0.927 0.659 0.0
224092496466 predicted protein [Populus trichocarpa] 0.679 0.935 0.559 1e-169
359485959 1028 PREDICTED: probable LRR receptor-like se 0.934 0.583 0.488 1e-155
296081493 2193 unnamed protein product [Vitis vinifera] 0.934 0.273 0.480 1e-152
225447810 1031 PREDICTED: probable LRR receptor-like se 0.939 0.584 0.478 1e-151
224096626 1036 predicted protein [Populus trichocarpa] 0.940 0.583 0.461 1e-148
359485957 1031 PREDICTED: probable LRR receptor-like se 0.931 0.580 0.477 1e-148
>gi|296082046|emb|CBI21051.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/649 (74%), Positives = 556/649 (85%), Gaps = 21/649 (3%)

Query: 9   LLTVS---LSLLQLVSAQTSTDSAEVDALNKLIDYWNLRSKINLTTIDPCTRNASWASEN 65
           +LTVS   L +++LV+AQT+TD  EV ALNKLIDYWNLRS +N ++IDPCT+NA+WAS++
Sbjct: 3   VLTVSFFVLCIIELVAAQTTTDRDEVAALNKLIDYWNLRS-LN-SSIDPCTQNATWASKD 60

Query: 66  ANPRVACDCTSNSCHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQ 125
           ANPRVACDCTSN+CHITHLKIYALDI GE+P ELF+L+KL+DLNLGQNVL+G IPAEIGQ
Sbjct: 61  ANPRVACDCTSNTCHITHLKIYALDISGEIPPELFVLKKLVDLNLGQNVLSGPIPAEIGQ 120

Query: 126 LSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSS 185
           LSN+QYLSLGINN TGRVP+ELGNLTKL+SLSF SNNFFGPLPKELG LTSLQQLYIDSS
Sbjct: 121 LSNLQYLSLGINNLTGRVPSELGNLTKLVSLSFGSNNFFGPLPKELGNLTSLQQLYIDSS 180

Query: 186 GVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRA 245
           GV+G IPQEFA LKSL+ILWASDNLFTGK+PEF GTL EL DLR++GTLLEGPIP SF A
Sbjct: 181 GVSGPIPQEFAGLKSLQILWASDNLFTGKLPEFIGTLIELRDLRVEGTLLEGPIPSSFGA 240

Query: 246 LNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFN 305
           L KLEDLRIGDL  +DS+LDFL SQ SLSILSLRNCRVSG+IPDQL TF KL+ LDLSFN
Sbjct: 241 LTKLEDLRIGDLRGQDSSLDFLGSQTSLSILSLRNCRVSGRIPDQLSTFTKLKYLDLSFN 300

Query: 306 KLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLPRNFAKG 365
           KLTG+I  S QD  +L+YLYLGNNNL+GELP NII+  LIALDVS+NPLSGNLP N AK 
Sbjct: 301 KLTGEILKSFQDFVSLEYLYLGNNNLNGELPANIISQELIALDVSFNPLSGNLPLNIAKV 360

Query: 366 GLSM---------------KALGMMQCLHSNTKCSNKVPSSSFSIKCGGTQIASASGIEF 410
           GLSM               KA GM+ CL  N KC+NK+PSSSFSIKCGGT+  SASG++F
Sbjct: 361 GLSMNVLGTSINANSLQDRKASGMLHCLQGNMKCTNKIPSSSFSIKCGGTEQRSASGVKF 420

Query: 411 DDDSKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARIS 470
           DDDS+ L AAS YTS   +WAVSNTG+FISNPNGP YIA+TDSQI GTL+SELYKTAR+S
Sbjct: 421 DDDSEILGAASLYTSPDYQWAVSNTGSFISNPNGPQYIAKTDSQIRGTLESELYKTARVS 480

Query: 471 PSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRVFDVYIQGERVLRDLNIKKEA 530
           PSSLRYYGLGL+NGKYR++LHFAEI MEDS+SWKGLGRR+FDVYIQGERVL   NI++EA
Sbjct: 481 PSSLRYYGLGLKNGKYRVELHFAEIAMEDSVSWKGLGRRLFDVYIQGERVLEGFNIQREA 540

Query: 531 GGSKRALVKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQV-STGNGSS 589
           GGSKRALVKT EANVTNTI+EIHF WAG+GTCCIPFQ TYGPLVSAIHA QV    + SS
Sbjct: 541 GGSKRALVKTLEANVTNTIMEIHFLWAGRGTCCIPFQSTYGPLVSAIHAYQVSDETSSSS 600

Query: 590 KGDKKHVGKIVGITVGCAAALVIISSVFYLWWTKDSSSHIRIFTDSPKQ 638
           + +KK +GK+VGI VGCA  +VIISS+FYLWW K++S H R+ T+SP++
Sbjct: 601 ESNKKRIGKVVGIVVGCAGGVVIISSIFYLWWKKEASGHTRVQTESPRK 649

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359476140|ref|XP_002282711.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548896|ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis] gi|223545448|gb|EEF46953.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224143160|ref|XP_002324865.1| predicted protein [Populus trichocarpa] gi|222866299|gb|EEF03430.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092496|ref|XP_002309634.1| predicted protein [Populus trichocarpa] gi|222855610|gb|EEE93157.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485959|ref|XP_002267672.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081493|emb|CBI20016.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447810|ref|XP_002267129.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130 [Vitis vinifera] gi|296081492|emb|CBI20015.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096626|ref|XP_002310677.1| predicted protein [Populus trichocarpa] gi|222853580|gb|EEE91127.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485957|ref|XP_002267620.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g56130-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query642
TAIR|locus:2205250 1032 AT1G56130 [Arabidopsis thalian 0.911 0.566 0.447 5.2e-129
TAIR|locus:2203718 1035 AT1G53440 [Arabidopsis thalian 0.873 0.542 0.359 5.3e-88
TAIR|locus:2009630 953 AT1G53420 [Arabidopsis thalian 0.760 0.512 0.389 2.2e-82
TAIR|locus:2019367 1078 AT1G29740 [Arabidopsis thalian 0.901 0.537 0.344 1.5e-81
TAIR|locus:2019317 969 AT1G29730 [Arabidopsis thalian 0.869 0.575 0.344 3e-78
TAIR|locus:2203847 1021 RKF1 "receptor-like kinase in 0.894 0.562 0.324 9.3e-75
TAIR|locus:2205260 1047 AT1G56120 [Arabidopsis thalian 0.803 0.492 0.366 3.1e-74
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.476 0.277 0.343 3.6e-38
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.445 0.255 0.365 2.9e-37
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.443 0.285 0.354 4e-37
TAIR|locus:2205250 AT1G56130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1266 (450.7 bits), Expect = 5.2e-129, P = 5.2e-129
 Identities = 276/617 (44%), Positives = 380/617 (61%)

Query:    26 TDSAEVDALNKLIDYWNLRS--KINLTTIDPCTR---NASWASENA--NPRVACDCT-SN 77
             T   E  ALN +   W +++  + N++  + C+    +AS    N   NP + CDC+  N
Sbjct:    37 THPDEARALNSIFAAWKIQAPREWNISG-ELCSGAAIDASVLDSNPAYNPLIKCDCSFQN 95

Query:    78 S--CHITHLKIYALDIMGELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLG 135
             S  C IT++K+YA+D++G +P EL+ L  L +LNLGQNVL GS+P  IG L+ MQ+++ G
Sbjct:    96 STICRITNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFG 155

Query:   136 INNFTGRVPTELGNLTKLISLXXXXXXXXGPLPKELGKLTSLQQLYIDSSGVTGSIPQEF 195
             IN  +G VP E+G LT L  L        G +P E+G+ T LQQ+YIDSSG++G IP  F
Sbjct:   156 INALSGPVPKEIGLLTDLRLLGISSNNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSF 215

Query:   196 ANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIG 255
             ANL  L   W +D   T +IP+F G  T+L  LR+ GT L GPIP SF  L  L +LR+G
Sbjct:   216 ANLVQLEQAWIADLEVTDQIPDFIGDWTKLTTLRIIGTGLSGPIPSSFSNLTSLTELRLG 275

Query:   256 DLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSL 315
             D+S+  S+LDF++  KSLS+L LRN  ++G IP  +G  + L+ +DLSFNKL G IP SL
Sbjct:   276 DISSGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASL 335

Query:   316 QDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLSGNLP--------------RN 361
              +LS L +L+LGNN L+G  P      +L  +DVSYN LSG+LP               N
Sbjct:   336 FNLSQLTHLFLGNNTLNGSFPTQK-TQSLRNVDVSYNDLSGSLPSWVSLPSLKLNLVANN 394

Query:   362 FAKGGLSMKALGMMQCLHSNTKCSN-KVPSSSFSIKCGGTQIASASGIEFDDDSKTLEAA 420
             F   GL  + L  + CL  N  C+  K   S FSI CGG +  S +G  F+ + +    A
Sbjct:   395 FTLEGLDNRVLPGLNCLQKNFPCNRGKGIYSDFSINCGGPEKRSVTGALFEREDEDFGPA 454

Query:   421 SFYTSSGNRWAVSNTGNFISNPNGPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLG 480
             SF+ S+G RWA S+ G F  + N  +YIA + SQ   TLDSEL+++AR+S SS+RYYGLG
Sbjct:   455 SFFVSAGQRWAASSVGLFAGSSNN-IYIATSQSQFVNTLDSELFQSARLSASSVRYYGLG 513

Query:   481 LENGKYRIDLHFAEITMEDSLS--WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSK-RAL 537
             LENG Y + L FAEI +  S S  WKGLGRR FD+Y+QG  V +D ++++ AG S  RA+
Sbjct:   514 LENGGYTVTLQFAEIQILGSTSTTWKGLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAV 573

Query:   538 VKTFEANVTNTIIEIHFFWAGKGTCCIPFQGTYGPLVSAIHASQVSTGNGSSKGDKKHVG 597
              + ++ANV+   +E+H FWAGKGTCCIP QG YGPL+SA+ A+   T   ++K   K   
Sbjct:   574 QRVYKANVSENHLEVHLFWAGKGTCCIPIQGAYGPLISAVSATPDFTPTVANKPPSKGKN 633

Query:   598 KIVGITVGCAAALVIIS 614
             +  G  VG    + ++S
Sbjct:   634 R-TGTIVGVIVGVGLLS 649
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=ISS
TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019367 AT1G29740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019317 AT1G29730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203847 RKF1 "receptor-like kinase in flowers 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205260 AT1G56120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query642
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 4e-59
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-38
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-35
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-27
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 1e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information 
 Score =  195 bits (497), Expect = 4e-59
 Identities = 82/189 (43%), Positives = 103/189 (54%), Gaps = 29/189 (15%)

Query: 392 SFSIKCGGTQIASASGIEFDDD-SKTLEAASFYTSSGNRWAVSNTGNFISNPNGPLYIAQ 450
             +I CGG +   + GI ++ D   T  +A +Y S  N                      
Sbjct: 2   VLAINCGGPEHTDSDGITYEADTYFTGGSADYYVSDTNG--------------------- 40

Query: 451 TDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMEDSLSWKGLGRRV 510
             S I GT D ELY+T R SPSS  YY   LENG Y + LHFAEI   +     GLGRRV
Sbjct: 41  -SSSIAGTTDPELYQTERYSPSSFSYYIPCLENGNYTVILHFAEIYFGED----GLGRRV 95

Query: 511 FDVYIQGERVLRDLNIKKEAGGSKRALVKTF-EANVTNTIIEIHFFWAGKGTCCIPFQGT 569
           FDVY+QG+ VL+D +I  EAGG  +   K +    VT+  +EIHF+WAGKGT  IPF+G 
Sbjct: 96  FDVYVQGKLVLKDFDIVAEAGGKGKTAHKEYIPVTVTDGTLEIHFYWAGKGTLLIPFRGV 155

Query: 570 YG-PLVSAI 577
           YG P +SAI
Sbjct: 156 YGNPKISAI 164

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. Length = 164
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 642
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PLN032101153 Resistant to P. syringae 6; Provisional 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
PLN03150623 hypothetical protein; Provisional 99.66
PLN03150 623 hypothetical protein; Provisional 99.56
PF12819347 Malectin_like: Carbohydrate-binding protein of the 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
PF12819 347 Malectin_like: Carbohydrate-binding protein of the 98.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
KOG3593355 consensus Predicted receptor-like serine/threonine 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.8
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.41
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.2
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.62
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 96.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.77
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 95.51
KOG4341483 consensus F-box protein containing LRR [General fu 95.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.03
KOG4308478 consensus LRR-containing protein [Function unknown 95.02
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 95.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.59
KOG4308478 consensus LRR-containing protein [Function unknown 93.75
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 93.54
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 93.52
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.38
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 92.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.52
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 89.36
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.12
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 85.92
PHA03265402 envelope glycoprotein D; Provisional 82.7
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 82.63
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 82.49
smart0037026 LRR Leucine-rich repeats, outliers. 81.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.44
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.92
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-40  Score=396.55  Aligned_cols=332  Identities=32%  Similarity=0.520  Sum_probs=293.7

Q ss_pred             CCHHHHHHHHHHHHhcCCC----CCCCCCCCCCCCCCCCCCCCCCCCCeEeecCCCCCceeEEEEeCCCCCCCCchhhcC
Q 006515           26 TDSAEVDALNKLIDYWNLR----SKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMGELPSELFM  101 (642)
Q Consensus        26 ~~~~~~~aL~~~~~~~~~~----~~w~~~~~d~C~~~~~w~~~~~~~gv~C~~~~~~~~v~~L~l~~~~l~g~ip~~l~~  101 (642)
                      .+++|++||++||+.+..+    .+|+.. .|||.    |      .||+|+.   ..+|+.|+++++.+.|.+|+.+..
T Consensus        26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~-~~~c~----w------~gv~c~~---~~~v~~L~L~~~~i~~~~~~~~~~   91 (968)
T PLN00113         26 LHAEELELLLSFKSSINDPLKYLSNWNSS-ADVCL----W------QGITCNN---SSRVVSIDLSGKNISGKISSAIFR   91 (968)
T ss_pred             CCHHHHHHHHHHHHhCCCCcccCCCCCCC-CCCCc----C------cceecCC---CCcEEEEEecCCCccccCChHHhC
Confidence            4678999999999998643    568755 68997    8      6999973   458999999999999999999999


Q ss_pred             CCCCCEEEccCCCCCCCCchhhc-CCCCCcEEEcccCCCCCCCCccccCCCCCcEEEeecccCCCCCchhhcCCCCCCEE
Q 006515          102 LRKLMDLNLGQNVLNGSIPAEIG-QLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQL  180 (642)
Q Consensus       102 l~~L~~L~Ls~n~l~g~~p~~l~-~l~~L~~L~Ls~n~l~g~ip~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  180 (642)
                      +++|++|+|++|.+.|.+|..+. .+++|++|+|++|.+++.+|.  +.+++|++|+|++|.+++.+|..++++++|++|
T Consensus        92 l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L  169 (968)
T PLN00113         92 LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVL  169 (968)
T ss_pred             CCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEE
Confidence            99999999999999999998765 899999999999999988886  568899999999999998899999999999999


Q ss_pred             EeccCCCCCCCchhhcCCCCCcEEEecCCcCCCCCchhccCcccccEEEccCCCCCCCchhhhhcCCCCCeEEcCCCCCC
Q 006515          181 YIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDLSAE  260 (642)
Q Consensus       181 ~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~g~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~~~~~  260 (642)
                      +|++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|++|+|++|.+++.+|..++++++|++|++++|.+.
T Consensus       170 ~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~  249 (968)
T PLN00113        170 DLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLT  249 (968)
T ss_pred             ECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998888


Q ss_pred             CCchhhhhcCCCCCeeecccccCCCCCchhhcCCcccceecccccccCCCcchhhcCCCCCcEEECcCCcCCCCCCcccC
Q 006515          261 DSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNII  340 (642)
Q Consensus       261 ~~~~~~l~~~~~L~~L~L~~n~l~~~ip~~~~~l~~L~~L~Ls~N~l~g~~p~~l~~l~~L~~L~L~~N~l~g~~p~~~~  340 (642)
                      ...+..+.++++|++|+|++|.+.+.+|..+..+++|+.|++++|++.+.+|..+.++++|+.|++++|.+++.+|..+.
T Consensus       250 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~  329 (968)
T PLN00113        250 GPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALT  329 (968)
T ss_pred             cccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHh
Confidence            77788888889999999999999888888888889999999999999888888888899999999999999888886553


Q ss_pred             -CCCccEEEccCCcCCccCCccccC-CCceeeecC
Q 006515          341 -APNLIALDVSYNPLSGNLPRNFAK-GGLSMKALG  373 (642)
Q Consensus       341 -~~~L~~L~Ls~N~l~g~ip~~~~~-~~l~~~~~~  373 (642)
                       +++|+.|++++|.+++.+|..+.. .+|+.+.++
T Consensus       330 ~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls  364 (968)
T PLN00113        330 SLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLS  364 (968)
T ss_pred             cCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECC
Confidence             688889999999988888877766 777777766

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PHA03265 envelope glycoprotein D; Provisional Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query642
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-22
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-18
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 4e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 4e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 95/321 (29%), Positives = 150/321 (46%), Gaps = 31/321 (9%)
Query: 93  GELPSELFMLRKLMDLNLGQNVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTK 152
           G++P  L    +L+ L+L  N L+G+IP+ +G LS ++ L L +N   G +P EL  +  
Sbjct: 405 GKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT 464
Query: 153 LISLXXXXXXXXGPLPKELGKLTSLQQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFT 212
           L +L        G +P  L   T+L  + + ++ +TG IP+    L++L IL  S+N F+
Sbjct: 465 LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS 524
Query: 213 GKIPEFFGTLTELADLRLQGTLLEGPIPRS-----------FRALNKLEDLRIGDLSAE- 260
           G IP   G    L  L L   L  G IP +           F A  +   ++   +  E 
Sbjct: 525 GNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC 584
Query: 261 DSTLDFLESQ----KSLSILSLRN-CRVS-----GKIPDQLGTFAKLQLLDLSFNKLTGQ 310
               + LE Q    + L+ LS RN C ++     G           +  LD+S+N L+G 
Sbjct: 585 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGY 644
Query: 311 IPTSLQDLSTLQYLYLGNNNLSGELPVNI-IAPNLIALDVSYNPLSGNLPRNFAKGGLSM 369
           IP  +  +  L  L LG+N++SG +P  +     L  LD+S N L G +P+       +M
Sbjct: 645 IPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQ-------AM 697
Query: 370 KALGMMQCLH-SNTKCSNKVP 389
            AL M+  +  SN   S  +P
Sbjct: 698 SALTMLTEIDLSNNNLSGPIP 718
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query642
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-67
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 2e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  225 bits (577), Expect = 6e-69
 Identities = 79/293 (26%), Positives = 124/293 (42%), Gaps = 31/293 (10%)

Query: 70  VACDCTSNSCHITHLKIYALDIMGE--LPSELFMLRKLMDLNL-GQNVLNGSIPAEIGQL 126
           V CD  + +  + +L +  L++     +PS L  L  L  L + G N L G IP  I +L
Sbjct: 41  VLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKL 100

Query: 127 SNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQQLYIDSSG 186
           + + YL +   N +G +P  L  +  L++L FS N   G LP  +  L +L  +  D + 
Sbjct: 101 TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR 160

Query: 187 VTGSIPQEFANLKSL-RILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRA 245
           ++G+IP  + +   L   +  S N  TGKIP  F  L  LA + L   +LEG     F +
Sbjct: 161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGS 219

Query: 246 LNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFN 305
                                    K+   + L    ++  +  ++G    L  LDL  N
Sbjct: 220 D------------------------KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNN 254

Query: 306 KLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNP-LSGN 357
           ++ G +P  L  L  L  L +  NNL GE+P             + N  L G+
Sbjct: 255 RIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGS 307
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 642
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 90.5 bits (223), Expect = 1e-20
 Identities = 59/280 (21%), Positives = 102/280 (36%), Gaps = 11/280 (3%)

Query: 118 SIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSL 177
            +P ++    +   L L  N  T     +  NL  L +L   +N      P     L  L
Sbjct: 24  KVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKL 81

Query: 178 QQLYIDSSGVTGSIPQEFANLKSLRILWASDNLFTGKIPEFFGTLTELADLRLQGTLLE- 236
           ++LY+  + +   +P++         L   +N  T      F  L ++  + L    L+ 
Sbjct: 82  ERLYLSKNQLK-ELPEKMPKTLQE--LRVHENEITKVRKSVFNGLNQMIVVELGTNPLKS 138

Query: 237 -GPIPRSFRALNKLEDLRIGDLSAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFA 295
            G    +F+ + KL  +RI D +             SL+ L L   +++      L    
Sbjct: 139 SGIENGAFQGMKKLSYIRIADTNITTIPQGLP---PSLTELHLDGNKITKVDAASLKGLN 195

Query: 296 KLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPVNIIAPNLIALDVSYNPLS 355
            L  L LSFN ++     SL +   L+ L+L NN L            +  + +  N +S
Sbjct: 196 NLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNIS 255

Query: 356 GNLPRNFAKGGLSMKALGMMQ-CLHSNTKCSNKVPSSSFS 394
                +F   G + K        L SN     ++  S+F 
Sbjct: 256 AIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFR 295
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query642
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.98
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.88
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.86
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.77
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.76
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.72
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 98.64
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.27
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=0  Score=283.67  Aligned_cols=298  Identities=28%  Similarity=0.437  Sum_probs=238.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCC--CCCHHH
Q ss_conf             89988999999999952789---9999999999999988788899998375069997736699981788787--772432
Q 006515           25 STDSAEVDALNKLIDYWNLR---SKINLTTIDPCTRNASWASENANPRVACDCTSNSCHITHLKIYALDIMG--ELPSEL   99 (642)
Q Consensus        25 ~~~~~~~~al~~~~~~~~~~---~~w~~~~~d~c~~~~~w~~~~~~~~v~C~~~~~~~~i~~L~l~~~~l~~--~lp~~l   99 (642)
                      .|.++|++||++||+.+..+   .+|+.. .|||.  ..|      .||+|+..+...||+.|++.++++.+  .+|+++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~~-~d~C~--~~w------~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l   72 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLPT-TDCCN--RTW------LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSL   72 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCTT-SCTTT--TCS------TTEEECCSSSCCCEEEEEEECCCCSSCEECCGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCC-CCCCC--CCC------CCEEEECCCCCEEEEEEECCCCCCCCCCCCCHHH
T ss_conf             98989999999999977999867788999-99988--948------8969748999479889989899888888798478


Q ss_pred             CCCCCCCEEECCC-CCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCHHHCCCCCCC
Q ss_conf             0999997998669-989988844222998886898105779887881236999986899224338999952005999999
Q 006515          100 FMLRKLMDLNLGQ-NVLNGSIPAEIGQLSNMQYLSLGINNFTGRVPTELGNLTKLISLSFSSNNFFGPLPKELGKLTSLQ  178 (642)
Q Consensus       100 ~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  178 (642)
                      .++++|++|+|++ |.+.|.+|..|+++++|++|++++|.+.+..+..+..+.+|+.+++++|...+.+|..+..++.|+
T Consensus        73 ~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~  152 (313)
T d1ogqa_          73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLV  152 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCC
T ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHCCCCCCC
T ss_conf             46753352020265433300243114542001102035643443322222011100111122455556851220674000


Q ss_pred             EEEECCCCCCCCCCHHHCCCCCC-CEEEECCCCCCCCCCHHCCCCCCCCEEECCCCCCCCCCHHHHHCCCCCCEEECCCC
Q ss_conf             89823678999881111299887-47870377478888400069553248980698798986154315999996884899
Q 006515          179 QLYIDSSGVTGSIPQEFANLKSL-RILWASDNLFTGKIPEFFGTLTELADLRLQGTLLEGPIPRSFRALNKLEDLRIGDL  257 (642)
Q Consensus       179 ~L~Ls~n~l~~~~p~~l~~l~~L-~~L~l~~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~~  257 (642)
                      .+++++|.+.+.+|..+..+.++ +.++++.|++.+..+..+..+..+ .+++..+...+.+|..+..+           
T Consensus       153 ~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~-----------  220 (313)
T d1ogqa_         153 GITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSD-----------  220 (313)
T ss_dssp             EEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTT-----------
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCC-----------
T ss_conf             000235533562031214431123231022464353324332222222-33333343322222222222-----------


Q ss_pred             CCCCCCHHHHHCCCCCCEEECCCCCCCCCCCHHHCCCCCCCEECCCCCCCCCCCCHHHCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             99997605541287877662446547888921124885554521224204798612213999996998758859987896
Q 006515          258 SAEDSTLDFLESQKSLSILSLRNCRVSGKIPDQLGTFAKLQLLDLSFNKLTGQIPTSLQDLSTLQYLYLGNNNLSGELPV  337 (642)
Q Consensus       258 ~~~~~~~~~l~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~  337 (642)
                                   ++++.+++.++.+.+.++ .+..+++|+.|++++|++++.+|..+..+++|+.|+|++|+++|.+|.
T Consensus       221 -------------~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         221 -------------KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             -------------SCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             -------------CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEECCCCCHHHHCCCCCCEEECCCCCCCCCCCC
T ss_conf             -------------221112222222222222-222455444444765706660876884799999897958835166898


Q ss_pred             CCCCCCCCEEECCCCC-CCCC
Q ss_conf             6679985399910796-9866
Q 006515          338 NIIAPNLIALDVSYNP-LSGN  357 (642)
Q Consensus       338 ~~~~~~L~~LdLs~N~-l~g~  357 (642)
                      ...+++|+.+++++|+ +.|.
T Consensus       287 ~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         287 GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             STTGGGSCGGGTCSSSEEEST
T ss_pred             CCCCCCCCHHHHCCCCCCCCC
T ss_conf             666799897886889500198
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure