Citrus Sinensis ID: 006518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640--
MSRPLLRGVSGMRISGNGHDPWDLEMKERNEKEDLEKDHSTDQSYLALSSGTPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
ccccccccccccEEcccccccccHHHHHcccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccEEEcccEEEEccccccccccHHHHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHccccEEEEEccccccHHHHHHHHHcccccEEEcccccccccccccEEEEEEcccccccccccccHHHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHccccccccHHHHHHHcccccEEEEEEccccccccccEEccccccEEcccccccccccccHHHHccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccc
cccccccccEEEEEcccccccccccccccccHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcccccccccccccccccccccccccccccccccHHcccccccHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccEEEHccccccccHHHHEEcccccEEEEcccEEEccccccccccHHHHHHHHHHHcccccccccccccEEEEEEcccccccHHHHHHcccEEEEEEcccccHHHHHHHHHHccccEEEEEHcccccccccccEcEHHHccccccccccccEEEEEEcEEEccccEEEEEcccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHccccccccccccccccccccEcccHHccccccccccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEHHcHHHccHHHHHHHHHccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHcHHHcHHHHHHccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHEccc
msrpllrgvsgmrisgnghdpwdleMKERNekedlekdhstdqsylalssgtprsrqnFTMLFLKFSLIAIVFLALTGSFWWTISistssrghiyhgYRRLQEQLVSDLWDigeislgssrskdlefcsedfenyvpcfnesrnlalgysngdevdrhcGQELkqhclvlppvkyriplrwptgrdviwvSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIgcgygsfgahlFSKELLTMCIANYEASGSQVQLTLERglpamigsfaskqlpypslsfdmlhcarcgvdwdqkdgILLLEVDrvlkpggyfvwtspltnpqaflrnkenQKRWNFVRDFVENLCWELVSQQDETVVWKktskascyssrkpgsgpsicskgndvespyyrplqpciggtrnrrwipieerrnwpsranlnknelavygvhpeefaedtENWKTAVGNFWSllsplifsdhpkrpgdedpsppynmvrnvldmnahfggfNSALLEKGKSVWVMNvvptigtnhlpmildrGFVGVLHDWceafptyprtydLVHAEGLLslesghrhrcstlDIFTEIdrilrpevsksnspistchICLLCLFTSVLKINC
msrpllrgvsgmrisgnghdpwdlEMKERNEKEdlekdhstdqsylalssgtprsRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKqhclvlppvkyriplrwptgrdviwvsnvkitaqevlssgslTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKktskascyssrkpgsgpsicskgndvespyyrplqpciggtrnrrwipieerrnwpsranlNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIfteidrilrpevsksnspistchiCLLCLFTSVLKINC
MSRPLLRGVSGMRISGNGHDPWDLEMKERNEKEDLEKDHSTDQSYLALSSGTPRSRQNFTMLFLKFSLIAIVFLALTGSFwwtisistssRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
*********************************************************NFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKT**************************PYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIF*****************MVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKI**
*************************************************************LFLKFSLIAIVFLALTGSFWW******************************************LEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKTS*****************SKGNDVESPYYRPLQPCIG*********************************PEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
MSRPLLRGVSGMRISGNGHDPWDLEMKERN********************GTPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDE**********************SICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
*******************************************************RQNFTMLFLKFSLIAIVFLALTGSFWWTISIST*********************************SKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRPLLRGVSGMRISGNGHDPWDLEMKERNEKEDLEKDHSTDQSYLALSSGTPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPEVSKSNSPISTCHICLLCLFTSVLKINC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query642 2.2.26 [Sep-21-2011]
Q9C9Q8684 Probable pectin methyltra yes no 0.950 0.891 0.717 0.0
Q8GYW9603 Probable methyltransferas no no 0.833 0.887 0.550 1e-176
Q3EC77606 Probable methyltransferas no no 0.780 0.826 0.579 1e-171
Q8H118611 Probable methyltransferas no no 0.716 0.752 0.376 5e-97
Q93YV7608 Probable methyltransferas no no 0.711 0.751 0.377 8e-97
Q940J9623 Probable methyltransferas no no 0.727 0.749 0.38 3e-95
Q8VZV7612 Probable methyltransferas no no 0.814 0.854 0.361 4e-95
Q9FG39682 Probable methyltransferas no no 0.705 0.664 0.374 1e-90
O22285694 Probable methyltransferas no no 0.718 0.664 0.352 3e-89
Q94KE1655 Probable methyltransferas no no 0.705 0.691 0.361 3e-87
>sp|Q9C9Q8|PMTT_ARATH Probable pectin methyltransferase QUA2 OS=Arabidopsis thaliana GN=QUA2 PE=1 SV=2 Back     alignment and function desciption
 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/637 (71%), Positives = 523/637 (82%), Gaps = 27/637 (4%)

Query: 1   MSRPLLRGVSGMRISGNGHDPWDLEMKERNEKEDLEKDHS-----------TDQSYLALS 49
           MS PL RG+SG+R+S +  D  D +MK++ E+    ++++           ++QS     
Sbjct: 1   MSMPLQRGISGVRVSDSSDDLRDSQMKDKTERARSTENNNLTLRFPFGFLFSNQSSSKHG 60

Query: 50  SG----------TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYR 99
            G          + RSR    +LFLK SL+ IV +AL GSFWWTISISTSSRGH+YH YR
Sbjct: 61  GGGENGFSADPYSARSRHRLMLLFLKISLVLIVVIALAGSFWWTISISTSSRGHVYHNYR 120

Query: 100 RLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHC 159
           RLQEQLVSDLWDIGEISLG +R K+LE+C+ + EN+VPCFN S NLALGYSNGDE DR C
Sbjct: 121 RLQEQLVSDLWDIGEISLGPNRWKELEYCNIESENFVPCFNVSENLALGYSNGDENDRFC 180

Query: 160 GQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQIS 219
           G   KQ CL LPPVKYR+PLRWPTG+D+IW SNVKITAQEV+SSGS+TKRMMM+E++QIS
Sbjct: 181 GPGSKQECLELPPVKYRVPLRWPTGKDIIWHSNVKITAQEVVSSGSITKRMMMMEDDQIS 240

Query: 220 FRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTM 279
           FRSAS + D VEDYSHQIAEMIG++ + NFI AGVRTILDIGCGYGSFGAHL SK++LTM
Sbjct: 241 FRSASPMSDEVEDYSHQIAEMIGIKKD-NFIEAGVRTILDIGCGYGSFGAHLLSKQILTM 299

Query: 280 CIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLL 339
           CIANYEASGSQVQLTLERGLPAMIGSF SKQLPYPSLSFDMLHC RCG+DWDQKDG+LL+
Sbjct: 300 CIANYEASGSQVQLTLERGLPAMIGSFISKQLPYPSLSFDMLHCLRCGIDWDQKDGLLLV 359

Query: 340 EVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKK 399
           E+DRVLKPGGYFVWTSPLTNP    RNK++ KRWNFV DF E++CW L++QQDETVVWKK
Sbjct: 360 EIDRVLKPGGYFVWTSPLTNP----RNKDHLKRWNFVHDFAESICWTLLNQQDETVVWKK 415

Query: 400 TSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANL 459
           T    CYSSRKPG GPS+C+KG+DVESPYYRPLQ CIGGTR+RRWIPIE R  WPSR+N+
Sbjct: 416 TINTKCYSSRKPGVGPSVCTKGHDVESPYYRPLQMCIGGTRSRRWIPIEGRTRWPSRSNM 475

Query: 460 NKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNV 519
           NK EL++YG+HPE   ED ENWK  V  +WSLLSPLIFSDHPKRPGDEDPSPPYNM+RNV
Sbjct: 476 NKTELSLYGLHPEVLGEDAENWKITVREYWSLLSPLIFSDHPKRPGDEDPSPPYNMLRNV 535

Query: 520 LDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRT 579
           LDMNA FGG NSALLE  KSVWVMNVVPT G NHLPMILDRGFVGVLH+WCE FPTYPRT
Sbjct: 536 LDMNAQFGGLNSALLEARKSVWVMNVVPTAGPNHLPMILDRGFVGVLHNWCEPFPTYPRT 595

Query: 580 YDLVHAEGLLSLESGH-RHRCSTLDIFTEIDRILRPE 615
           YDLVHA+ LLSL++   R  C  +DIFTEIDR+LRPE
Sbjct: 596 YDLVHADNLLSLQTSQPRKTCLLIDIFTEIDRLLRPE 632
May be involved in the synthesis of homogalacturonan. Required for normal cell adhesion and plant development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8GYW9|PMT4_ARATH Probable methyltransferase PMT4 OS=Arabidopsis thaliana GN=At1g13860 PE=2 SV=2 Back     alignment and function description
>sp|Q3EC77|PMT5_ARATH Probable methyltransferase PMT5 OS=Arabidopsis thaliana GN=At2g03480 PE=2 SV=2 Back     alignment and function description
>sp|Q8H118|PMT1_ARATH Probable methyltransferase PMT1 OS=Arabidopsis thaliana GN=At3g23300 PE=1 SV=2 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description
>sp|Q940J9|PMT8_ARATH Probable methyltransferase PMT8 OS=Arabidopsis thaliana GN=At1g04430 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZV7|PMT9_ARATH Probable methyltransferase PMT9 OS=Arabidopsis thaliana GN=At5g14430 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE1|PMTA_ARATH Probable methyltransferase PMT10 OS=Arabidopsis thaliana GN=At1g77260 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query642
225459280696 PREDICTED: probable pectin methyltransfe 0.957 0.883 0.751 0.0
449437010690 PREDICTED: probable pectin methyltransfe 0.948 0.882 0.717 0.0
297842599683 hypothetical protein ARALYDRAFT_895718 [ 0.950 0.893 0.723 0.0
356515784690 PREDICTED: probable pectin methyltransfe 0.951 0.885 0.705 0.0
255545748656 S-adenosylmethionine-dependent methyltra 0.895 0.876 0.725 0.0
356508083690 PREDICTED: probable pectin methyltransfe 0.951 0.885 0.702 0.0
356552890693 PREDICTED: probable pectin methyltransfe 0.950 0.880 0.727 0.0
42563316684 putative pectin methyltransferase QUA2 [ 0.950 0.891 0.717 0.0
356547964694 PREDICTED: probable pectin methyltransfe 0.950 0.878 0.717 0.0
357489679675 hypothetical protein MTR_5g064080 [Medic 0.937 0.891 0.699 0.0
>gi|225459280|ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera] gi|302141967|emb|CBI19170.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/644 (75%), Positives = 548/644 (85%), Gaps = 29/644 (4%)

Query: 1   MSRPLLRGVSGMRISGNGHDPWDLEMKERNEKEDLEKDHSTDQSYLAL------------ 48
           MSR + RGVSG+RISGN HD  D +MK + EKED EK+ S+D + L+             
Sbjct: 1   MSRAMHRGVSGLRISGNSHDSRDSQMKVKTEKEDSEKNRSSDHTCLSFKFPSVPFPDNSS 60

Query: 49  ---------------SSGTPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGH 93
                          S+G+PRSR   TML LK SL+ IV LALTGSF WTISI+TSSRG 
Sbjct: 61  SKHGISENGFASDTFSAGSPRSRHKLTMLVLKLSLVLIVVLALTGSFLWTISITTSSRGQ 120

Query: 94  IYH--GYRRLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSN 151
           I+H  GYRRL EQLVSDLWDIGE+SLG +R K++EFC  ++EN+VPCFN S +LALGYS+
Sbjct: 121 IFHSHGYRRLYEQLVSDLWDIGELSLGPARLKEVEFCPLEYENHVPCFNVSESLALGYSD 180

Query: 152 GDEVDRHCGQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMM 211
           G+E++R CG  ++Q+CL  PPV YRIPLRWPTGRD+IWV+NVKITAQEVLSSGSLTKRMM
Sbjct: 181 GEELNRRCGHGIRQNCLFPPPVNYRIPLRWPTGRDIIWVANVKITAQEVLSSGSLTKRMM 240

Query: 212 MLEEEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHL 271
           MLEEEQISFRSASL+FDGVEDYSHQIAEMIGLRNESNFI AGVRTILDIGCGYGSFGAHL
Sbjct: 241 MLEEEQISFRSASLMFDGVEDYSHQIAEMIGLRNESNFIQAGVRTILDIGCGYGSFGAHL 300

Query: 272 FSKELLTMCIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWD 331
           FSKE+LTMCIA+YEASGSQVQLTLERGLPAMIGSF SKQ+PYP LSFDM+HCARCG+DWD
Sbjct: 301 FSKEILTMCIASYEASGSQVQLTLERGLPAMIGSFTSKQMPYPYLSFDMVHCARCGIDWD 360

Query: 332 QKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQ 391
           QKDGILL+EVDRVL+PGGYFVWTSPLTN Q FLRNKE QKRWNFVR+F ENLCWE++SQQ
Sbjct: 361 QKDGILLIEVDRVLRPGGYFVWTSPLTNAQRFLRNKEMQKRWNFVRNFAENLCWEMLSQQ 420

Query: 392 DETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERR 451
           DET VWKKTSK SCY+SRKPGSGPSICSK +D ESPYYRPL+ CIGGT++ RWIPI+ R 
Sbjct: 421 DETAVWKKTSKKSCYASRKPGSGPSICSKRHDGESPYYRPLEACIGGTQSSRWIPIKART 480

Query: 452 NWPSRANLNKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSP 511
            WPSRA LN +EL +Y +H EEFAEDT++W  A+ N+WSLLSPLIFSDHPKRPGDEDPSP
Sbjct: 481 TWPSRAKLNSSELQIYDLHSEEFAEDTQHWNLAIRNYWSLLSPLIFSDHPKRPGDEDPSP 540

Query: 512 PYNMVRNVLDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCE 571
           P+NM+RNVLDMNAH GGFNSALLE GKSVWVMNVVPTIG N+LP+ILDRGFVGVLHDWCE
Sbjct: 541 PFNMLRNVLDMNAHLGGFNSALLEAGKSVWVMNVVPTIGHNYLPLILDRGFVGVLHDWCE 600

Query: 572 AFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIFTEIDRILRPE 615
           AFPTYPRTYD+VHA GLLSLE+  + RC+ LD+FTEIDR+LRPE
Sbjct: 601 AFPTYPRTYDMVHAAGLLSLETSQQRRCTMLDLFTEIDRLLRPE 644

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449437010|ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis sativus] gi|449496983|ref|XP_004160281.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297842599|ref|XP_002889181.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. lyrata] gi|297335022|gb|EFH65440.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356515784|ref|XP_003526578.1| PREDICTED: probable pectin methyltransferase QUA2-like [Glycine max] Back     alignment and taxonomy information
>gi|255545748|ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] gi|223547020|gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356508083|ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356552890|ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|42563316|ref|NP_177948.3| putative pectin methyltransferase QUA2 [Arabidopsis thaliana] gi|238479105|ref|NP_001154475.1| putative pectin methyltransferase QUA2 [Arabidopsis thaliana] gi|292630946|sp|Q9C9Q8.2|PMTT_ARATH RecName: Full=Probable pectin methyltransferase QUA2; AltName: Full=Protein OVERSENSITIVE TO SUGAR 1; AltName: Full=Protein QUASIMODO 2; AltName: Full=Protein TUMOROUS SHOOT DEVELOPMENT 2 gi|332197964|gb|AEE36085.1| putative pectin methyltransferase QUA2 [Arabidopsis thaliana] gi|332197965|gb|AEE36086.1| putative pectin methyltransferase QUA2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356547964|ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|357489679|ref|XP_003615127.1| hypothetical protein MTR_5g064080 [Medicago truncatula] gi|355516462|gb|AES98085.1| hypothetical protein MTR_5g064080 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query642
TAIR|locus:2032130684 TSD2 "TUMOROUS SHOOT DEVELOPME 0.950 0.891 0.704 2.8e-247
TAIR|locus:2063798606 QUL2 "QUASIMODO2 LIKE 2" [Arab 0.601 0.636 0.547 3.3e-171
TAIR|locus:2014789603 QUL1 "QUASIMODO2 LIKE 1" [Arab 0.827 0.880 0.548 9e-164
TAIR|locus:2145658612 AT5G14430 [Arabidopsis thalian 0.580 0.609 0.361 6e-97
TAIR|locus:2018329623 AT1G04430 [Arabidopsis thalian 0.577 0.595 0.348 2.1e-94
TAIR|locus:2090935611 AT3G23300 [Arabidopsis thalian 0.565 0.594 0.354 1.4e-93
TAIR|locus:2129660608 AT4G14360 [Arabidopsis thalian 0.563 0.595 0.356 1.8e-93
TAIR|locus:2195955655 AT1G77260 [Arabidopsis thalian 0.540 0.529 0.341 1.2e-85
TAIR|locus:2150670600 AT5G04060 [Arabidopsis thalian 0.546 0.585 0.349 1.2e-81
TAIR|locus:2076264591 AT3G10200 [Arabidopsis thalian 0.546 0.593 0.356 1.2e-81
TAIR|locus:2032130 TSD2 "TUMOROUS SHOOT DEVELOPMENT 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2382 (843.6 bits), Expect = 2.8e-247, P = 2.8e-247
 Identities = 449/637 (70%), Positives = 512/637 (80%)

Query:     1 MSRPLLRGVSGMRISGNGHDPWDLEMKERNEK-EDLEKDHST----------DQSYLALS 49
             MS PL RG+SG+R+S +  D  D +MK++ E+    E ++ T          +QS     
Sbjct:     1 MSMPLQRGISGVRVSDSSDDLRDSQMKDKTERARSTENNNLTLRFPFGFLFSNQSSSKHG 60

Query:    50 SG----------TPRSRQNFTMLFLKFSLIAIVFLALTGSFXXXXXXXXXXRGHIYHGYR 99
              G          + RSR    +LFLK SL+ IV +AL GSF          RGH+YH YR
Sbjct:    61 GGGENGFSADPYSARSRHRLMLLFLKISLVLIVVIALAGSFWWTISISTSSRGHVYHNYR 120

Query:   100 RLQEQLVSDLWDIGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGYSNGDEVDRHC 159
             RLQEQLVSDLWDIGEISLG +R K+LE+C+ + EN+VPCFN S NLALGYSNGDE DR C
Sbjct:   121 RLQEQLVSDLWDIGEISLGPNRWKELEYCNIESENFVPCFNVSENLALGYSNGDENDRFC 180

Query:   160 GQELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRMMMLEEEQIS 219
             G   KQ CL LPPVKYR+PLRWPTG+D+IW SNVKITAQEV+SSGS+TKRMMM+E++QIS
Sbjct:   181 GPGSKQECLELPPVKYRVPLRWPTGKDIIWHSNVKITAQEVVSSGSITKRMMMMEDDQIS 240

Query:   220 FRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTM 279
             FRSAS + D VEDYSHQIAEMIG++ + NFI AGVRTILDIGCGYGSFGAHL SK++LTM
Sbjct:   241 FRSASPMSDEVEDYSHQIAEMIGIKKD-NFIEAGVRTILDIGCGYGSFGAHLLSKQILTM 299

Query:   280 CIANYEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLL 339
             CIANYEASGSQVQLTLERGLPAMIGSF SKQLPYPSLSFDMLHC RCG+DWDQKDG+LL+
Sbjct:   300 CIANYEASGSQVQLTLERGLPAMIGSFISKQLPYPSLSFDMLHCLRCGIDWDQKDGLLLV 359

Query:   340 EVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDETVVWKK 399
             E+DRVLKPGGYFVWTSPLTNP    RNK++ KRWNFV DF E++CW L++QQDETVVWKK
Sbjct:   360 EIDRVLKPGGYFVWTSPLTNP----RNKDHLKRWNFVHDFAESICWTLLNQQDETVVWKK 415

Query:   400 TSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNRRWIPIEERRNWPSRANL 459
             T    CYSSRKPG GPS+C+KG+DVESPYYRPLQ CIGGTR+RRWIPIE R  WPSR+N+
Sbjct:   416 TINTKCYSSRKPGVGPSVCTKGHDVESPYYRPLQMCIGGTRSRRWIPIEGRTRWPSRSNM 475

Query:   460 NKNELAVYGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNV 519
             NK EL++YG+HPE   ED ENWK  V  +WSLLSPLIFSDHPKRPGDEDPSPPYNM+RNV
Sbjct:   476 NKTELSLYGLHPEVLGEDAENWKITVREYWSLLSPLIFSDHPKRPGDEDPSPPYNMLRNV 535

Query:   520 LDMNAHFGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRT 579
             LDMNA FGG NSALLE  KSVWVMNVVPT G NHLPMILDRGFVGVLH+WCE FPTYPRT
Sbjct:   536 LDMNAQFGGLNSALLEARKSVWVMNVVPTAGPNHLPMILDRGFVGVLHNWCEPFPTYPRT 595

Query:   580 YDLVHAEGLLSLESGH-RHRCSTLDIFTEIDRILRPE 615
             YDLVHA+ LLSL++   R  C  +DIFTEIDR+LRPE
Sbjct:   596 YDLVHADNLLSLQTSQPRKTCLLIDIFTEIDRLLRPE 632
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008168 "methyltransferase activity" evidence=IEA;IMP
GO:0009735 "response to cytokinin stimulus" evidence=IMP
GO:0048367 "shoot system development" evidence=IMP
GO:0010289 "homogalacturonan biosynthetic process" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2063798 QUL2 "QUASIMODO2 LIKE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014789 QUL1 "QUASIMODO2 LIKE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145658 AT5G14430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018329 AT1G04430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090935 AT3G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150670 AT5G04060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076264 AT3G10200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C9Q8PMTT_ARATH2, ., 1, ., 1, ., -0.71740.95010.8918yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query642
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 1e-159
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 7e-06
smart00828224 smart00828, PKS_MT, Methyltransferase in polyketid 4e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 6e-05
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 1e-04
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 2e-04
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 0.003
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information 
 Score =  467 bits (1205), Expect = e-159
 Identities = 197/500 (39%), Positives = 269/500 (53%), Gaps = 58/500 (11%)

Query: 134 NYVPCF--NESRNLALGYSNGDEVDRHC-GQELKQHCLVLPPVKYRIPLRWPTGRDVIWV 190
           +Y+PC   + +    L     +  +RHC   E K  CLV PP  Y+ P+ WP  RD +W 
Sbjct: 1   DYIPCLDNDRAIKFLLSRERMEHRERHCPPSEEKLRCLVPPPDGYKTPIPWPKSRDKVWY 60

Query: 191 SNVKITAQEVLSSGSLTKRMMMLEEEQISFRSASLIFD-GVEDYSHQIAEMIGLRNESNF 249
           +NV  T       G   +  + +E ++  F      F  G + Y   +A+MI        
Sbjct: 61  ANVPHTKLAEEKGG---QNWVKVEGDKFRFPGGGTQFPHGADAYIDFLAQMIPDIAWG-- 115

Query: 250 ILAGVRTILDIGCGYGSFGAHLFSKELLTMCIA---NYEASGSQVQLTLERGLPAMIGSF 306
               VRT LD+GCG  SFGA+L S+++LTM  A    +EA   QVQ  LERG+PAM+G  
Sbjct: 116 --GRVRTALDVGCGVASFGAYLLSRDVLTMSFAPKDVHEA---QVQFALERGVPAMLGVL 170

Query: 307 ASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRN 366
            +++LPYPS SFDM HC+RC + W   DGILLLEVDRVL+PGGYFV + P    +     
Sbjct: 171 GTRRLPYPSRSFDMAHCSRCLIPWHANDGILLLEVDRVLRPGGYFVLSGPPVYARD---E 227

Query: 367 KENQKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVES 426
           ++ Q+ W  +    ++LCW+LV+++ +  +W+K    SCY+ R+PG  P +C   +D ++
Sbjct: 228 EDLQEEWKAMEALAKSLCWKLVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDA 287

Query: 427 PYYRPLQPCI------GGTRNRRWIPIEERRNWPSRANLNK-----NELAVYGVHPEEFA 475
            +Y P++ CI             W+       WP R  L           + GV  E F 
Sbjct: 288 AWYVPMEACITPLPEVSHEVGGGWLE-----KWPER--LTAVPPRLASGQIGGVSAEAFK 340

Query: 476 EDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAHFGGFNSALLE 535
            DTE WK  V  +  LL  LI                   VRNV+DMNA FGGF +AL++
Sbjct: 341 ADTELWKRRVSKYKRLLKLLIDKGR---------------VRNVMDMNAGFGGFAAALID 385

Query: 536 KGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGH 595
               VWVMNVVP    + LP+I DRG +G+ HDWCE F TYPRTYDL+HA+ L SL    
Sbjct: 386 DP--VWVMNVVPVDSPDTLPVIYDRGLIGIYHDWCEPFSTYPRTYDLLHADHLFSLY--- 440

Query: 596 RHRCSTLDIFTEIDRILRPE 615
           + RC+  DI  E+DRILRP 
Sbjct: 441 KKRCNLEDILLEMDRILRPG 460

This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|214839 smart00828, PKS_MT, Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 642
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 99.92
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.75
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.71
PLN02336475 phosphoethanolamine N-methyltransferase 99.68
PLN02233261 ubiquinone biosynthesis methyltransferase 99.66
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.66
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.65
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.52
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.52
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.51
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.51
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.51
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.51
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.5
PLN02244340 tocopherol O-methyltransferase 99.5
PRK05785226 hypothetical protein; Provisional 99.48
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.48
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.46
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.45
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 99.45
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.45
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.44
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.43
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.41
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.41
PRK08317241 hypothetical protein; Provisional 99.41
PLN02490340 MPBQ/MSBQ methyltransferase 99.4
PRK11207197 tellurite resistance protein TehB; Provisional 99.38
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.38
PLN02336475 phosphoethanolamine N-methyltransferase 99.36
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.36
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.36
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.35
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.34
KOG4300252 consensus Predicted methyltransferase [General fun 99.31
TIGR00452314 methyltransferase, putative. Known examples to dat 99.3
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.3
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.27
PRK12335287 tellurite resistance protein TehB; Provisional 99.26
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.26
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.26
PRK06922677 hypothetical protein; Provisional 99.26
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.25
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.24
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.23
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.22
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.21
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.21
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.2
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.2
PRK06202232 hypothetical protein; Provisional 99.16
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.15
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.15
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.15
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.15
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.12
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.12
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.12
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 99.11
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.08
KOG3010261 consensus Methyltransferase [General function pred 99.07
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.07
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.06
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.05
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.04
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.03
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.02
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.01
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.01
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.01
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.0
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.99
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.99
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.98
PLN03075296 nicotianamine synthase; Provisional 98.97
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.97
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.96
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.95
PLN02232160 ubiquinone biosynthesis methyltransferase 98.95
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.95
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.94
TIGR03438301 probable methyltransferase. This model represents 98.94
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.93
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.92
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.91
PRK04266226 fibrillarin; Provisional 98.9
PRK14967223 putative methyltransferase; Provisional 98.89
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.88
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.87
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.87
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.86
PTZ00146293 fibrillarin; Provisional 98.85
KOG3987288 consensus Uncharacterized conserved protein DREV/C 98.84
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.84
KOG2361264 consensus Predicted methyltransferase [General fun 98.84
TIGR00438188 rrmJ cell division protein FtsJ. 98.83
PRK14968188 putative methyltransferase; Provisional 98.82
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.82
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.81
KOG2940325 consensus Predicted methyltransferase [General fun 98.78
PRK07402196 precorrin-6B methylase; Provisional 98.76
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.75
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.72
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.71
PRK10901427 16S rRNA methyltransferase B; Provisional 98.71
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.68
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.68
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.67
PRK00811283 spermidine synthase; Provisional 98.66
KOG1271227 consensus Methyltransferases [General function pre 98.65
PRK14901434 16S rRNA methyltransferase B; Provisional 98.64
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.64
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.62
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.61
PRK14904445 16S rRNA methyltransferase B; Provisional 98.61
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.6
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.58
PHA03411279 putative methyltransferase; Provisional 98.58
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.58
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.58
PRK14903431 16S rRNA methyltransferase B; Provisional 98.56
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.56
PRK04457262 spermidine synthase; Provisional 98.56
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.55
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.54
COG4123248 Predicted O-methyltransferase [General function pr 98.54
PRK01581374 speE spermidine synthase; Validated 98.52
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.48
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.44
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.44
PRK14902444 16S rRNA methyltransferase B; Provisional 98.43
PRK03612521 spermidine synthase; Provisional 98.39
PHA03412241 putative methyltransferase; Provisional 98.38
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.38
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.37
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.37
PLN02366308 spermidine synthase 98.36
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.36
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.36
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.34
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.34
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.34
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.31
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.31
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.28
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.25
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.25
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.24
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.19
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.18
COG2890280 HemK Methylase of polypeptide chain release factor 98.17
KOG2899288 consensus Predicted methyltransferase [General fun 98.12
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.12
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.11
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.09
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.09
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.06
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.05
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.01
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.0
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.99
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 97.99
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.92
PLN02672 1082 methionine S-methyltransferase 97.91
PLN02476278 O-methyltransferase 97.91
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.9
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.86
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.85
PRK04148134 hypothetical protein; Provisional 97.84
COG4122219 Predicted O-methyltransferase [General function pr 97.83
COG1041347 Predicted DNA modification methylase [DNA replicat 97.82
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.81
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.78
PLN02823336 spermine synthase 97.77
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.77
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.76
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.75
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.75
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.75
COG2521287 Predicted archaeal methyltransferase [General func 97.72
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.7
KOG2904328 consensus Predicted methyltransferase [General fun 97.67
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.65
KOG1499346 consensus Protein arginine N-methyltransferase PRM 97.65
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.64
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.63
KOG1331293 consensus Predicted methyltransferase [General fun 97.57
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.57
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.55
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.54
PLN02589247 caffeoyl-CoA O-methyltransferase 97.53
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.44
PRK00536262 speE spermidine synthase; Provisional 97.4
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.38
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.37
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.37
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.35
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.34
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.23
KOG1500517 consensus Protein arginine N-methyltransferase CAR 97.21
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.19
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.18
PLN02244340 tocopherol O-methyltransferase 97.16
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.14
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.12
PLN02233261 ubiquinone biosynthesis methyltransferase 97.1
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.08
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.06
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.06
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.05
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.05
KOG2352482 consensus Predicted spermine/spermidine synthase [ 97.03
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.03
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.01
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.94
PRK11207197 tellurite resistance protein TehB; Provisional 96.93
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.92
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 96.92
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.91
KOG3201201 consensus Uncharacterized conserved protein [Funct 96.86
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.83
COG2520341 Predicted methyltransferase [General function pred 96.79
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.78
PRK08317241 hypothetical protein; Provisional 96.76
PRK12335287 tellurite resistance protein TehB; Provisional 96.74
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 96.73
COG1092393 Predicted SAM-dependent methyltransferases [Genera 96.72
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 96.71
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 96.63
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 96.62
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.61
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.6
TIGR00452314 methyltransferase, putative. Known examples to dat 96.57
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 96.54
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 96.52
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.51
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.49
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.48
KOG3420185 consensus Predicted RNA methylase [Translation, ri 96.47
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.46
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.45
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.43
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.4
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.36
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.34
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.31
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 96.3
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.27
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.27
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.24
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.19
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 96.1
PTZ00146293 fibrillarin; Provisional 96.1
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.09
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.08
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.07
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.04
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 95.98
COG2265432 TrmA SAM-dependent methyltransferases related to t 95.97
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 95.96
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.95
PRK05785226 hypothetical protein; Provisional 95.88
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 95.81
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.81
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 95.77
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.76
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 95.71
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.71
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.68
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.63
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 95.35
COG3897218 Predicted methyltransferase [General function pred 95.34
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 95.32
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 95.32
PF13679141 Methyltransf_32: Methyltransferase domain 95.31
TIGR00740239 methyltransferase, putative. A simple BLAST search 95.27
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 95.22
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 95.1
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 95.09
PLN02490 340 MPBQ/MSBQ methyltransferase 95.09
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 95.06
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.05
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.0
TIGR00438188 rrmJ cell division protein FtsJ. 94.97
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 94.89
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 94.86
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 94.84
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 94.72
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 94.72
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 94.68
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 94.63
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 94.62
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 94.56
PLN02668386 indole-3-acetate carboxyl methyltransferase 94.55
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 94.42
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 94.41
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 94.28
COG4798238 Predicted methyltransferase [General function pred 94.23
COG4262508 Predicted spermidine synthase with an N-terminal m 94.23
PRK14968188 putative methyltransferase; Provisional 94.22
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 94.15
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 93.95
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 93.87
PRK06922 677 hypothetical protein; Provisional 93.86
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 93.74
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 93.68
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 93.68
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 93.51
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 93.49
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 93.47
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 93.31
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 93.24
PRK06202232 hypothetical protein; Provisional 93.2
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 93.2
PRK04266226 fibrillarin; Provisional 93.09
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 92.92
COG4076252 Predicted RNA methylase [General function predicti 92.81
PRK14902444 16S rRNA methyltransferase B; Provisional 92.77
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 92.72
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 92.62
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 92.53
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 92.53
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 92.12
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 92.01
KOG3115249 consensus Methyltransferase-like protein [General 91.82
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 91.78
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 91.71
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 91.67
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 91.57
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 91.54
PRK14967223 putative methyltransferase; Provisional 91.47
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 91.46
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 91.44
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 91.15
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 90.87
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.52
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 90.24
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 90.06
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 90.0
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 89.92
cd04789102 HTH_Cfa Helix-Turn-Helix DNA binding domain of the 89.71
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 89.69
PRK10901427 16S rRNA methyltransferase B; Provisional 89.48
PRK14903431 16S rRNA methyltransferase B; Provisional 89.34
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 89.32
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 89.28
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 89.25
PRK14901434 16S rRNA methyltransferase B; Provisional 89.24
TIGR03438 301 probable methyltransferase. This model represents 89.22
PRK13699227 putative methylase; Provisional 89.2
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 89.1
PRK14904445 16S rRNA methyltransferase B; Provisional 89.09
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 88.75
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 88.49
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 88.36
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 88.02
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 88.01
PRK09880343 L-idonate 5-dehydrogenase; Provisional 87.78
PRK04457262 spermidine synthase; Provisional 87.54
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 87.5
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 87.23
PRK07402196 precorrin-6B methylase; Provisional 87.14
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 86.97
KOG3010 261 consensus Methyltransferase [General function pred 86.83
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 86.77
TIGR00536284 hemK_fam HemK family putative methylases. The gene 86.17
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 85.53
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 85.51
cd04790172 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma 85.4
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.3
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 85.3
cd04775102 HTH_Cfa-like Helix-Turn-Helix DNA binding domain o 85.08
KOG2920282 consensus Predicted methyltransferase [General fun 84.93
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 84.62
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 84.34
KOG1562337 consensus Spermidine synthase [Amino acid transpor 84.05
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 83.73
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 83.72
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 83.45
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 83.11
KOG3045325 consensus Predicted RNA methylase involved in rRNA 83.07
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 82.64
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 82.61
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 82.22
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 81.76
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 81.7
COG0286489 HsdM Type I restriction-modification system methyl 81.62
COG2384226 Predicted SAM-dependent methyltransferase [General 81.6
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 81.46
PRK11524284 putative methyltransferase; Provisional 81.05
KOG2730263 consensus Methylase [General function prediction o 80.87
PF03269177 DUF268: Caenorhabditis protein of unknown function 80.83
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 80.55
KOG2198375 consensus tRNA cytosine-5-methylases and related e 80.42
PHA01634156 hypothetical protein 80.38
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 80.3
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information 
Probab=100.00  E-value=2.5e-135  Score=1098.45  Aligned_cols=458  Identities=44%  Similarity=0.878  Sum_probs=430.4

Q ss_pred             CccccCCchhhhhh--ccccccccccCCCC-cCccccccCCCCCCCCCCCCCCCcccccccCccchhhhhhcccccccch
Q 006518          134 NYVPCFNESRNLAL--GYSNGDEVDRHCGQ-ELKQHCLVLPPVKYRIPLRWPTGRDVIWVSNVKITAQEVLSSGSLTKRM  210 (642)
Q Consensus       134 ~y~pC~d~~~~~~~--~~~r~~~~er~C~~-~~r~rCL~~~p~gy~~P~~WP~srd~~W~~nvp~t~~~~ls~~k~~q~W  210 (642)
                      |||||+|+++++++  .++|++|+|||||+ +++.+||+|+|+||+.|++||+|||++||+|+||++   |+.+|..|||
T Consensus         1 dy~PC~D~~~~~~~~~~~~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~---L~~~K~~qnW   77 (506)
T PF03141_consen    1 DYIPCLDNSRAIKFLLSRERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTK---LAEEKADQNW   77 (506)
T ss_pred             CCcCCCCHHHHHhhccCcccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchH---Hhhhcccccc
Confidence            79999999999999  89999999999999 669999999999999999999999999999999999   6789999999


Q ss_pred             hcccccccccccccccc-cchhhhHHHHHHHHhhcccccccccCCCeEEEECCCCchHHHHHhhcCCceeEEEEecCCHH
Q 006518          211 MMLEEEQISFRSASLIF-DGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGS  289 (642)
Q Consensus       211 ~~~dk~~~~F~~~~~~y-d~~~~y~~~i~e~L~~~~g~~l~~~~~~~VLDIGCGtG~~a~~La~~g~~~~sV~giD~S~~  289 (642)
                      ++.+++.+.|++++++| +++.+|++++.++++...    .....+++||||||+|+|+++|+++++.++++++.|.++.
T Consensus        78 v~~~gd~~~FPgggt~F~~Ga~~Yid~i~~~~~~~~----~~g~iR~~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~  153 (506)
T PF03141_consen   78 VRVEGDKFRFPGGGTMFPHGADHYIDQIAEMIPLIK----WGGGIRTALDVGCGVASFGAYLLERNVTTMSFAPNDEHEA  153 (506)
T ss_pred             eeecCCEEEeCCCCccccCCHHHHHHHHHHHhhccc----cCCceEEEEeccceeehhHHHHhhCCceEEEcccccCCch
Confidence            99999999999999999 689999999999998621    1136789999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCceEEeecccCCCCCCCCccEEEeccccccccccHHHHHHHHHhcccCCcEEEEEeCCCCchhhhhhHHh
Q 006518          290 QVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKEN  369 (642)
Q Consensus       290 ml~~A~ergl~~~~~~~da~~Lpfpd~SFDlV~~s~~ll~~~~d~~~~L~Ei~RvLKPGG~Lvis~p~~~~~~~lr~~e~  369 (642)
                      ++|+|.|||+++.+..+...+|||++++||+|||+.|++.|.++.+.+|.|++|+|||||+|+++.+..+.   ..+++.
T Consensus       154 qvqfaleRGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~---r~~~~~  230 (506)
T PF03141_consen  154 QVQFALERGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQ---RTDEDL  230 (506)
T ss_pred             hhhhhhhcCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceEEecCCcccc---cchHHH
Confidence            99999999999999888899999999999999999999999998889999999999999999999998762   234567


Q ss_pred             HhhhhhhhhhhhccceEEeeecCceEEEEecCcccccccCCCCCCCCCCCCCCCCCCCccccCCceeccCCCC-cccCCc
Q 006518          370 QKRWNFVRDFVENLCWELVSQQDETVVWKKTSKASCYSSRKPGSGPSICSKGNDVESPYYRPLQPCIGGTRNR-RWIPIE  448 (642)
Q Consensus       370 ~~~w~~l~~l~~~lcW~ll~~~~~~~IwqK~~~~~C~~~R~~~~~p~lC~~~~d~~~~wY~~l~~Ci~~~~~~-~~~~~~  448 (642)
                      .+.|+.|+.+++++||++++++.+++|||||.+++||.+|+....|++|+..+|++++||++|++||+++++. .+++++
T Consensus       231 ~~~~~~~~~l~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~  310 (506)
T PF03141_consen  231 EEEWNAMEDLAKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPGKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGG  310 (506)
T ss_pred             HHHHHHHHHHHHHHHHHHheeeCCEEEEeccCCchhhhhccCCCCCCCCCCCCCCcchhhcchhhhcCcCCccccccccc
Confidence            7899999999999999999999999999999999999999998889999999999999999999999999865 467889


Q ss_pred             ccCCCCcccccCCCcccc---ccCCccchhhhhhhHHHHHHHHHHhhcccccCCCCCCCCCCCCCCCCCcceEEEecCcC
Q 006518          449 ERRNWPSRANLNKNELAV---YGVHPEEFAEDTENWKTAVGNFWSLLSPLIFSDHPKRPGDEDPSPPYNMVRNVLDMNAH  525 (642)
Q Consensus       449 ~~~~wP~rl~~~p~~~~~---~~~~~~~f~~d~~~w~~~v~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~rnv~Dm~~~  525 (642)
                      .+++||+||+++|+|+..   .|.++|+|.+|+++||++|++||++++..+               ++++||||||||||
T Consensus       311 ~~~~WP~RL~~~P~rl~~~~~~g~~~e~F~~Dt~~Wk~~V~~Y~~l~~~~i---------------~~~~iRNVMDMnAg  375 (506)
T PF03141_consen  311 WLPKWPERLNAVPPRLSSGSIPGISPEEFKEDTKHWKKRVSHYKKLLGLAI---------------KWGRIRNVMDMNAG  375 (506)
T ss_pred             CCCCChhhhccCchhhhcCCcCCCCHHHHHHHHHHHHHHHHHHHHhhcccc---------------cccceeeeeeeccc
Confidence            999999999999999874   899999999999999999999999886444               46789999999999


Q ss_pred             chhhhhhhhccCCCcEEEEeecCCCCCchhhhhccccccccccccccCCCCCCcccccccccccccccCCCCCCCchhhh
Q 006518          526 FGGFNSALLEKGKSVWVMNVVPTIGTNHLPMILDRGFVGVLHDWCEAFPTYPRTYDLVHAEGLLSLESGHRHRCSTLDIF  605 (642)
Q Consensus       526 ~g~faa~l~~~~~~vwvmnv~p~~~~~~l~~i~~RGl~g~~~~~ce~~~typrtydl~h~~~~~~~~~~~~~~c~~~~~~  605 (642)
                      ||||||||++  +|||||||||+.++|||++||||||||+||||||+|||||||||||||++|||.++   +||+|++||
T Consensus       376 ~GGFAAAL~~--~~VWVMNVVP~~~~ntL~vIydRGLIG~yhDWCE~fsTYPRTYDLlHA~~lfs~~~---~rC~~~~il  450 (506)
T PF03141_consen  376 YGGFAAALID--DPVWVMNVVPVSGPNTLPVIYDRGLIGVYHDWCEAFSTYPRTYDLLHADGLFSLYK---DRCEMEDIL  450 (506)
T ss_pred             ccHHHHHhcc--CCceEEEecccCCCCcchhhhhcccchhccchhhccCCCCcchhheehhhhhhhhc---ccccHHHHH
Confidence            9999999987  89999999999999999999999999999999999999999999999999999999   999999999


Q ss_pred             hhhccccCCCceeeec
Q 006518          606 TEIDRILRPEVSKSNS  621 (642)
Q Consensus       606 ~e~dRilrP~g~~~~~  621 (642)
                      +||||||||||+++.-
T Consensus       451 lEmDRILRP~G~~iiR  466 (506)
T PF03141_consen  451 LEMDRILRPGGWVIIR  466 (506)
T ss_pred             HHhHhhcCCCceEEEe
Confidence            9999999999999864

; GO: 0008168 methyltransferase activity
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query642
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 2e-09
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 6e-09
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-08
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 5e-08
3f4k_A257 Putative methyltransferase; structural genomics, P 2e-07
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 7e-07
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 1e-06
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 1e-06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 1e-06
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 2e-06
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 2e-06
3ege_A261 Putative methyltransferase from antibiotic biosyn 4e-06
3cc8_A230 Putative methyltransferase; structural genomics, j 5e-06
3m33_A226 Uncharacterized protein; structural genomics, PSI- 5e-06
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 6e-06
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 6e-06
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 6e-06
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 8e-06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 9e-06
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 9e-06
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 1e-05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 2e-05
3gu3_A284 Methyltransferase; alpha-beta protein, structural 3e-05
1vlm_A219 SAM-dependent methyltransferase; possible histamin 3e-05
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 4e-05
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 5e-05
3i9f_A170 Putative type 11 methyltransferase; structural gen 5e-05
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 7e-05
1xxl_A239 YCGJ protein; structural genomics, protein structu 8e-05
3ocj_A305 Putative exported protein; structural genomics, PS 8e-05
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 9e-05
3hnr_A220 Probable methyltransferase BT9727_4108; structural 1e-04
1vl5_A260 Unknown conserved protein BH2331; putative methylt 1e-04
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 1e-04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 2e-04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 2e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 3e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 4e-04
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 7e-04
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 9e-04
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 9e-04
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
 Score = 57.9 bits (140), Expect = 2e-09
 Identities = 32/176 (18%), Positives = 53/176 (30%), Gaps = 41/176 (23%)

Query: 215 EEQISFRSASLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSK 274
              +S   A+      +  + ++  ++ +R       +G R +LD+GCG G     L   
Sbjct: 37  GADVSVDDAT------DRLTDEMIALLDVR-------SGDR-VLDVGCGIGKPAVRL--- 79

Query: 275 ELLTMCIANYEA-------SGSQV----QLTLERGLPAMI----GSFASKQLPYPSLSFD 319
                     +        S  QV          GL   +           LP+   SFD
Sbjct: 80  ------ATARDVRVTGISISRPQVNQANARATAAGLANRVTFSYADAM--DLPFEDASFD 131

Query: 320 MLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNF 375
            +           +    L E+ RVL+PGG       +         KE    +  
Sbjct: 132 AVWALESLHHMPDRGR-ALREMARVLRPGGTVAIADFVLLAPVEGAKKEAVDAFRA 186
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 642
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 6e-08
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 2e-07
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 7e-06
d2avna1246 c.66.1.41 (A:1-246) Hypothetical methyltransferase 1e-05
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 2e-04
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 2e-04
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 7e-04
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 8e-04
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 9e-04
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 0.001
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.001
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 0.002
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 0.003
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 0.003
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 0.004
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: CAC2371-like
domain: Hypothetical methyltransferase PH1305
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 52.0 bits (123), Expect = 6e-08
 Identities = 26/173 (15%), Positives = 54/173 (31%), Gaps = 8/173 (4%)

Query: 224 SLIFDGVEDYSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIAN 283
           ++    +E    +I  +  +  E       VR +LD+ CG G     L  +    + +  
Sbjct: 14  TIYRRRIERVKAEIDFVEEIFKE--DAKREVRRVLDLACGTGIPTLELAERGYEVVGLDL 71

Query: 284 YEASGSQVQLTLERGLPAMIGSFASKQLPYPSLSFDMLHCARCGVD--WDQKDGILLLEV 341
           +E      +   +     +               FD +      +    ++    L  +V
Sbjct: 72  HEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKV 131

Query: 342 DRVLKPGGYFVWTSPLTNPQAFLRNKENQKRWNFVRDFVENLCWELVSQQDET 394
              LKPGG F+       P  F   ++    WN  +   + +  +    +   
Sbjct: 132 AEALKPGGVFI----TDFPCWFYGGRDGPVVWNEQKGEEKLVIMDWREVEPAV 180
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Length = 246 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query642
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.85
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.84
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.83
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.81
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.79
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.79
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.79
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.76
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.75
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.74
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.72
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.71
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.71
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.7
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.7
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.68
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.67
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.64
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.63
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.62
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.62
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.62
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.61
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.61
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.61
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.57
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.55
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.54
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.53
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.53
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.5
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.49
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.48
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.48
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.47
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.46
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.46
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.45
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.43
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.42
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.41
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.41
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.39
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.37
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.37
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.36
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.36
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.32
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.24
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.03
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.02
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.01
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.99
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.97
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.97
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.83
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.8
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.79
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.77
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.74
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.74
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.69
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.67
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.63
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.56
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.53
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.53
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.5
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.5
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.45
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.42
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.37
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.35
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.35
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.34
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.3
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.29
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.28
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.25
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.22
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.21
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.2
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.19
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.19
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.13
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.13
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.11
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.1
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.06
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.05
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.05
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.01
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.0
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.99
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.97
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.95
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.94
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.93
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.85
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.82
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.8
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.8
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.78
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.78
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.77
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.71
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.68
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.64
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.61
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.6
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.6
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.6
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.53
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.5
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.47
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.47
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.46
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.44
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.39
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.37
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 97.33
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.33
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.16
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.16
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.05
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.02
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.94
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 96.85
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 96.74
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.71
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.64
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 96.36
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.22
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 96.21
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.84
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 95.67
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.51
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.49
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 95.36
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.3
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 94.98
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 94.92
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.83
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.75
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 94.15
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.14
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.12
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 93.66
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.52
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 93.12
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 92.69
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.14
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.98
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 91.83
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 91.48
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.14
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 90.4
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.23
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 90.13
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.04
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.28
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 88.13
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 87.96
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 87.91
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 87.8
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 86.82
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 85.1
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 84.58
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 84.28
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 83.81
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 82.31
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 80.82
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 80.75
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 80.44
d1q06a_127 Transcriptional regulator CueR {Escherichia coli [ 80.06
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]

Probab=99.85  E-value=1.4e-20  Score=140.63  Aligned_cols=115  Identities=23%  Similarity=0.298  Sum_probs=98.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHC----CC-CCEEEEEC
Q ss_conf             69999999720245421125777599979998468999822489232899953999999999980----99-92697302
Q 006518          233 YSHQIAEMIGLRNESNFILAGVRTILDIGCGYGSFGAHLFSKELLTMCIANYEASGSQVQLTLER----GL-PAMIGSFA  307 (642)
Q Consensus       233 y~~~i~~lL~l~~g~~l~~~~~r~VLDIGCG~G~~a~~La~~g~~~~sV~giD~s~~~i~~A~er----gl-~~~~~~~d  307 (642)
                      ..+.+.+...++++        .+|||||||+|.++..+++++   .+|+|+|+|+.|++.|+++    +. ++.+.+++
T Consensus         4 ~~~~l~~~~~~~~~--------~rILDiGcGtG~~~~~la~~~---~~v~gvD~S~~~l~~A~~~~~~~~~~~~~~~~~d   72 (234)
T d1xxla_           4 SLGLMIKTAECRAE--------HRVLDIGAGAGHTALAFSPYV---QECIGVDATKEMVEVASSFAQEKGVENVRFQQGT   72 (234)
T ss_dssp             HHHHHHHHHTCCTT--------CEEEEESCTTSHHHHHHGGGS---SEEEEEESCHHHHHHHHHHHHHHTCCSEEEEECB
T ss_pred             HHHHHHHHHCCCCC--------CEEEEECCCCCHHHHHHHHHC---CEEEEEECCHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             99999997589998--------989995781849999999829---9699994871430233310000123322233332


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCC
Q ss_conf             4579899998008994554443454689999999750467919999958999
Q 006518          308 SKQLPYPSLSFDMLHCARCGVDWDQKDGILLLEVDRVLKPGGYFVWTSPLTN  359 (642)
Q Consensus       308 a~~LPfpd~SFDlV~s~~~l~~~~~d~~~lL~Ei~RVLKPGG~Lvis~~~~~  359 (642)
                      ++.+||++++||+|+|..+ ++|.+++..++.++.|+|||||+++++++...
T Consensus        73 ~~~~~~~~~~fD~v~~~~~-l~~~~d~~~~l~~~~r~LkpgG~~~~~~~~~~  123 (234)
T d1xxla_          73 AESLPFPDDSFDIITCRYA-AHHFSDVRKAVREVARVLKQDGRFLLVDHYAP  123 (234)
T ss_dssp             TTBCCSCTTCEEEEEEESC-GGGCSCHHHHHHHHHHHEEEEEEEEEEEECBC
T ss_pred             CCCCCCCCCCCCEEEEECE-EECCCCHHHHHHHHHHEECCCCEEEEEECCCC
T ss_conf             2223455545433321010-31156899999999774587818999984788
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1q06a_ a.6.1.3 (A:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure