Citrus Sinensis ID: 006548


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-
MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDTDVEVRVEEGGDSINAATTPASPSLSKLNSGSLPSPPLPEGAAVARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEEEEEEEEEEEEccccccccccccccEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEEEEEcccccccccccEEEEEccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHcEEEEccccEEEEccccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcc
cHHHHHHHcccccccccccccHccccHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEccccccEEEEEccccccEcccEEEEEEccccccHHHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEEccccccccEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHcccccccccEEcccccccEEEEEHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHcccccccccccHHHHHHHccccHHHHcccccccccccccHHHHcccHHHHHHHHHHHHHccccccHHccHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcHccccHHHEcccHEHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccEcccccccccEEEEEHccHHHHHHHHHHHc
meeiqsqsdnyrsssssasspasrvpssnffylrkpgslrqpisfedspewedtdVEVRVEeggdsinaattpaspslsklnsgslpspplpegAAVARKIAGASVVWKDLTVTikgkrrysdkvvkssngyalpgtmtvimgpaksgkSTLLRAIAGrlphsarmyGEVFVngaksempygsygfveretTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGghcymkglpcgerRRVRIARELvmrphvlfideplyhldSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICllsngntlffGETLACLQHfsnagfpcpimqspsdHFLRAINTDFDRIIAMCKSwqddhgdfssvNMDTAVAIRTLEATYQSSADAAAVETMILRLTekegpflkskgkassaTRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFrirnalpgpvwtypisYVAFHTYSIKACI
meeiqsqsdnyrsssssasspasrvpSSNFFYlrkpgslrqpisfedspewedTDVEVRVEEggdsinaattpaspslsklnSGSLPSPPLPEGAAVARKIagasvvwkdltvtikgkrrysdkvvkssngyalpgtmtVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKegpflkskgkassatrvavLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
MEEIqsqsdnyrsssssasspasrvpssnFFYLRKPGSLRQPISFEDSPEWEDTDVEVRVEEGGDSINAATTPAspslsklnsgslpspplpEGAAVARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQllssipflflisissslvfyflVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
************************************************************************************************VARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTE**************ATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKAC*
*******************************************************************************************************ASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGF**QRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKS*****************AI************************************ASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
*************************PSSNFFYLRKPGSLRQPISFEDSPEWEDTDVEVRVEEGGDSINAAT************************AVARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKEGPF**********TRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
***********************************************************************************************AVARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADA***E*******EKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDTDVEVRVEEGGDSINAATTPASPSLSKLNSGSLPSPPLPEGAAVARKIAGASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query641 2.2.26 [Sep-21-2011]
Q9ZUU9730 ABC transporter G family yes no 1.0 0.878 0.839 0.0
Q8RXN0 703 ABC transporter G family no no 0.833 0.759 0.386 1e-109
Q8RWI9 691 ABC transporter G family no no 0.843 0.782 0.368 1e-103
Q9C8K2 687 ABC transporter G family no no 0.859 0.802 0.361 4e-98
Q9C8J8 678 ABC transporter G family no no 0.840 0.794 0.342 2e-86
P45843666 Protein scarlet OS=Drosop yes no 0.842 0.810 0.275 9e-48
Q9H222651 ATP-binding cassette sub- yes no 0.772 0.760 0.287 3e-47
Q80W57657 ATP-binding cassette sub- yes no 0.848 0.828 0.269 3e-45
Q4GZT4655 ATP-binding cassette sub- no no 0.803 0.786 0.262 3e-45
Q8MIB3656 ATP-binding cassette sub- yes no 0.850 0.830 0.270 9e-45
>sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 Back     alignment and function desciption
 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/649 (83%), Positives = 596/649 (91%), Gaps = 8/649 (1%)

Query: 1   MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDT-DVEVR 59
           MEEIQSQSD YRSSSSSASSP SRVPSS+FFY+RKPGSLRQPISFEDSPEWEDT DV++R
Sbjct: 1   MEEIQSQSDLYRSSSSSASSPTSRVPSSHFFYVRKPGSLRQPISFEDSPEWEDTPDVDLR 60

Query: 60  VEE---GGDSIN-AATTPASPSLSKLNSGSLPSPPLPEGAA---VARKIAGASVVWKDLT 112
           +E+   GGDSIN A TTP SPSLSK+NSGS+ SPP+PEG A   V RKIAGAS+ WKDLT
Sbjct: 61  MEDEAGGGDSINDATTTPVSPSLSKMNSGSMASPPVPEGGAGTGVVRKIAGASIAWKDLT 120

Query: 113 VTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFV 172
           VT+KGKR+YSDKVVKSSNGYA PGTMTVIMGPAKSGKSTLLRA+AGRLP SA+MYGEVFV
Sbjct: 121 VTMKGKRKYSDKVVKSSNGYAFPGTMTVIMGPAKSGKSTLLRALAGRLPPSAKMYGEVFV 180

Query: 173 NGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLS 232
           NG+KS MPYGSYGFVERET LIGSLTVRE+LYYSALLQLPGF  Q+++VVEDAI AMSLS
Sbjct: 181 NGSKSHMPYGSYGFVERETQLIGSLTVREFLYYSALLQLPGFLFQKRSVVEDAIQAMSLS 240

Query: 233 DYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKK 292
           DYANKLIGGHCYMKGL  GERRRV IARELVMRPH+LFIDEPLYHLDSVSALLMMVTLKK
Sbjct: 241 DYANKLIGGHCYMKGLRSGERRRVSIARELVMRPHILFIDEPLYHLDSVSALLMMVTLKK 300

Query: 293 LASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP 352
           LAS GCTL+FTI QSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP
Sbjct: 301 LASMGCTLVFTIYQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP 360

Query: 353 SDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMI 412
           SDHFLRAINTDFDRIIAMCK+WQDD+GDFS+VNMDTAVAIRTLEATY+SSADA +VE MI
Sbjct: 361 SDHFLRAINTDFDRIIAMCKNWQDDNGDFSAVNMDTAVAIRTLEATYKSSADADSVEAMI 420

Query: 413 LRLTEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFS 472
           ++LTE+EG  LKSKGKA +ATRVAVLTWRSLL+MSREWKYYWLRLIL MILTL +GT++S
Sbjct: 421 IKLTEREGTQLKSKGKAGAATRVAVLTWRSLLVMSREWKYYWLRLILYMILTLSIGTLYS 480

Query: 473 GLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQL 532
           GLGHSLSSV TRVAA+FVFVSF SLL IAG+P+L+KEIK Y SE SN HSGA VFLLGQ 
Sbjct: 481 GLGHSLSSVATRVAAVFVFVSFASLLGIAGIPSLLKEIKIYRSEASNQHSGAFVFLLGQF 540

Query: 533 LSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVY 592
           L SIPFLFL+SISSSLVFYF+VGLRD+FSLLMYFVLNFFMCLLVNEGLML +A IW+DVY
Sbjct: 541 LGSIPFLFLMSISSSLVFYFMVGLRDDFSLLMYFVLNFFMCLLVNEGLMLFIACIWRDVY 600

Query: 593 WSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI 641
           WS LTLISVHV+MML+AG+FRIR ALP PVWTYP +Y++FHTYSI+  +
Sbjct: 601 WSTLTLISVHVIMMLAAGHFRIRTALPKPVWTYPFAYISFHTYSIEGLL 649





Arabidopsis thaliana (taxid: 3702)
>sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 Back     alignment and function description
>sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 Back     alignment and function description
>sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 Back     alignment and function description
>sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 Back     alignment and function description
>sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 Back     alignment and function description
>sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 Back     alignment and function description
>sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=2 SV=2 Back     alignment and function description
>sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
255565401722 ATP-binding cassette transporter, putati 0.998 0.886 0.903 0.0
225436522722 PREDICTED: ABC transporter G family memb 0.998 0.886 0.889 0.0
449459100721 PREDICTED: ABC transporter G family memb 1.0 0.889 0.879 0.0
449501234721 PREDICTED: ABC transporter G family memb 1.0 0.889 0.879 0.0
356550154724 PREDICTED: ABC transporter G family memb 1.0 0.885 0.879 0.0
356543496724 PREDICTED: ABC transporter G family memb 1.0 0.885 0.878 0.0
358348033725 White-brown-complex ABC transporter fami 1.0 0.884 0.861 0.0
30683745730 ABC-2 type transporter-like protein [Ara 1.0 0.878 0.839 0.0
297826143730 abc transporter family protein [Arabidop 1.0 0.878 0.839 0.0
4063751705 putative ABC transporter [Arabidopsis th 0.954 0.868 0.804 0.0
>gi|255565401|ref|XP_002523691.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223536995|gb|EEF38631.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/641 (90%), Positives = 618/641 (96%), Gaps = 1/641 (0%)

Query: 1   MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDTDVEVRV 60
           MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDTD++VR+
Sbjct: 1   MEEIQSQSDNYRSSSSSASSPASRVPSSNFFYLRKPGSLRQPISFEDSPEWEDTDIDVRM 60

Query: 61  EEGGDSINAATTPASPSLSKLNSGSLPSPPLPEGAAVARKIAGASVVWKDLTVTIKGKRR 120
           EEGGDSIN A TPASPSLSKLNSGSLPSPPLP+   VARKIAGASVVWKDLTVTIKGKR+
Sbjct: 61  EEGGDSINLAVTPASPSLSKLNSGSLPSPPLPDSTVVARKIAGASVVWKDLTVTIKGKRK 120

Query: 121 YSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSEMP 180
           YSDKVVKSS+GYALPGTMTVIMGPAKSGKSTLLRAIAGRL HSA+MYGEVFVNGAKS +P
Sbjct: 121 YSDKVVKSSSGYALPGTMTVIMGPAKSGKSTLLRAIAGRLHHSAKMYGEVFVNGAKSRLP 180

Query: 181 YGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIG 240
           YGSYGFVERETTLIGSLTV+EYLYYSALLQLPGFFC++K+VVEDAIHAMSL+DYANKLIG
Sbjct: 181 YGSYGFVERETTLIGSLTVQEYLYYSALLQLPGFFCKKKSVVEDAIHAMSLTDYANKLIG 240

Query: 241 GHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTL 300
           GHCYMKGL  GERRRV +ARELVMRPH+LFIDEPLYHLDSVSALLMMVTLKKLASTGCTL
Sbjct: 241 GHCYMKGLRNGERRRVSMARELVMRPHILFIDEPLYHLDSVSALLMMVTLKKLASTGCTL 300

Query: 301 LFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFLRAI 360
           +FTI QSSTEVFGLFDRICLLSNGNTLFFGETL+CLQHFSNAGFPCPIMQSPSDHFLRAI
Sbjct: 301 IFTIYQSSTEVFGLFDRICLLSNGNTLFFGETLSCLQHFSNAGFPCPIMQSPSDHFLRAI 360

Query: 361 NTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMILRLTEKEG 420
           NTDFDRIIAMCK+WQDD GDFSSVNMDTAVAIRTLEATY+SSADAAAVETM LRLTEKEG
Sbjct: 361 NTDFDRIIAMCKNWQDD-GDFSSVNMDTAVAIRTLEATYKSSADAAAVETMTLRLTEKEG 419

Query: 421 PFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSS 480
           P+LKSKGKASSATR+AVLTWRSLLIMSREWKYYWLRLILCM+LTLC+GTVFSGLGHSLSS
Sbjct: 420 PYLKSKGKASSATRIAVLTWRSLLIMSREWKYYWLRLILCMLLTLCIGTVFSGLGHSLSS 479

Query: 481 VVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLF 540
           VVTRVAAIFVFVSF SL+ IAGVP+L KEIK YASEESN HSGALVFLLGQLLSSIPFLF
Sbjct: 480 VVTRVAAIFVFVSFTSLIGIAGVPSLQKEIKIYASEESNRHSGALVFLLGQLLSSIPFLF 539

Query: 541 LISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVYWSILTLIS 600
           LISISSSLVFYFL+GLRDEFSLLMYFVLNFF+ LLVNEGLML++ S+W+ V+WSILT++S
Sbjct: 540 LISISSSLVFYFLIGLRDEFSLLMYFVLNFFISLLVNEGLMLLITSLWQHVFWSILTMVS 599

Query: 601 VHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI 641
           +HVVMMLSAGYFRIRNALPGPVWTYP+SY+AFHTYSI+  +
Sbjct: 600 IHVVMMLSAGYFRIRNALPGPVWTYPVSYIAFHTYSIQGLL 640




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225436522|ref|XP_002273792.1| PREDICTED: ABC transporter G family member 3 [Vitis vinifera] gi|297734935|emb|CBI17169.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449459100|ref|XP_004147284.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449501234|ref|XP_004161314.1| PREDICTED: ABC transporter G family member 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356550154|ref|XP_003543454.1| PREDICTED: ABC transporter G family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356543496|ref|XP_003540196.1| PREDICTED: ABC transporter G family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|358348033|ref|XP_003638054.1| White-brown-complex ABC transporter family [Medicago truncatula] gi|355503989|gb|AES85192.1| White-brown-complex ABC transporter family [Medicago truncatula] Back     alignment and taxonomy information
>gi|30683745|ref|NP_850111.1| ABC-2 type transporter-like protein [Arabidopsis thaliana] gi|334302769|sp|Q9ZUU9.2|AB3G_ARATH RecName: Full=ABC transporter G family member 3; Short=ABC transporter ABCG.3; Short=AtABCG3; AltName: Full=White-brown complex homolog protein 3; Short=AtWBC3 gi|330252981|gb|AEC08075.1| ABC-2 type transporter-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297826143|ref|XP_002880954.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297326793|gb|EFH57213.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|4063751|gb|AAC98459.1| putative ABC transporter [Arabidopsis thaliana] gi|20197954|gb|AAM15328.1| putative ABC transporter [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
TAIR|locus:2046203730 ABCG3 "ATP-binding cassette G3 1.0 0.878 0.756 1.4e-259
TAIR|locus:2030898 703 ABCG11 "ATP-binding cassette G 0.831 0.758 0.370 1.2e-95
TAIR|locus:2092960 691 ABCG15 "ATP-binding cassette G 0.828 0.768 0.357 4.6e-89
TAIR|locus:2033899 687 ABCG12 "ATP-binding cassette G 0.834 0.778 0.351 3.3e-86
TAIR|locus:2033939 678 ABCG13 "ATP-binding cassette G 0.828 0.783 0.334 1.8e-78
CGD|CAL0002254579 orf19.3120 [Candida albicans ( 0.435 0.481 0.33 2.9e-45
UNIPROTKB|Q5A0X6579 CaO19.10632 "Putative uncharac 0.435 0.481 0.33 2.9e-45
UNIPROTKB|F1N3L2649 ABCG5 "Uncharacterized protein 0.786 0.776 0.286 1e-43
UNIPROTKB|E1C5B1665 ABCG2 "Uncharacterized protein 0.797 0.768 0.261 6.5e-43
UNIPROTKB|E3LWM9654 Cre-wht-1 "CRE-WHT-1 protein" 0.787 0.772 0.253 8.6e-43
TAIR|locus:2046203 ABCG3 "ATP-binding cassette G3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2498 (884.4 bits), Expect = 1.4e-259, P = 1.4e-259
 Identities = 491/649 (75%), Positives = 536/649 (82%)

Query:     1 MEEIXXXXXXXXXXXXXXXXXXXXXXXXXFFYLRKPGSLRQPISFEDSPEWEDT-DVEVR 59
             MEEI                         FFY+RKPGSLRQPISFEDSPEWEDT DV++R
Sbjct:     1 MEEIQSQSDLYRSSSSSASSPTSRVPSSHFFYVRKPGSLRQPISFEDSPEWEDTPDVDLR 60

Query:    60 VEE---GGDSIN-AATTPAXXXXXXXXXXXXXXXXXXEGAA---VARKIAGASVVWKDLT 112
             +E+   GGDSIN A TTP                   EG A   V RKIAGAS+ WKDLT
Sbjct:    61 MEDEAGGGDSINDATTTPVSPSLSKMNSGSMASPPVPEGGAGTGVVRKIAGASIAWKDLT 120

Query:   113 VTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFV 172
             VT+KGKR+YSDKVVKSSNGYA PGTMTVIMGPAKSGKSTLLRA+AGRLP SA+MYGEVFV
Sbjct:   121 VTMKGKRKYSDKVVKSSNGYAFPGTMTVIMGPAKSGKSTLLRALAGRLPPSAKMYGEVFV 180

Query:   173 NGAKSEMPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLS 232
             NG+KS MPYGSYGFVERET LIGSLTVRE+LYYSALLQLPGF  Q+++VVEDAI AMSLS
Sbjct:   181 NGSKSHMPYGSYGFVERETQLIGSLTVREFLYYSALLQLPGFLFQKRSVVEDAIQAMSLS 240

Query:   233 DYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKK 292
             DYANKLIGGHCYMKGL  GERRRV IARELVMRPH+LFIDEPLYHLDSVSALLMMVTLKK
Sbjct:   241 DYANKLIGGHCYMKGLRSGERRRVSIARELVMRPHILFIDEPLYHLDSVSALLMMVTLKK 300

Query:   293 LASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP 352
             LAS GCTL+FTI QSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP
Sbjct:   301 LASMGCTLVFTIYQSSTEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSP 360

Query:   353 SDHFLRAINTDFDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQSSADAAAVETMI 412
             SDHFLRAINTDFDRIIAMCK+WQDD+GDFS+VNMDTAVAIRTLEATY+SSADA +VE MI
Sbjct:   361 SDHFLRAINTDFDRIIAMCKNWQDDNGDFSAVNMDTAVAIRTLEATYKSSADADSVEAMI 420

Query:   413 LRLTEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFS 472
             ++LTE+EG  LKSKGKA +ATRVAVLTWRSLL+MSREWKYYWLRLIL MILTL +GT++S
Sbjct:   421 IKLTEREGTQLKSKGKAGAATRVAVLTWRSLLVMSREWKYYWLRLILYMILTLSIGTLYS 480

Query:   473 GLGHSLSSVVTRVAAIFVFVSFNSLLNIAGVPALMKEIKTYASEESNMHSGALVFLLGQX 532
             GLGHSLSSV TRVAA+FVFVSF SLL IAG+P+L+KEIK Y SE SN HSGA VFLLGQ 
Sbjct:   481 GLGHSLSSVATRVAAVFVFVSFASLLGIAGIPSLLKEIKIYRSEASNQHSGAFVFLLGQF 540

Query:   533 XXXXXXXXXXXXXXXXXXXXXVGLRDEFSLLMYFVLNFFMCLLVNEGLMLVVASIWKDVY 592
                                  VGLRD+FSLLMYFVLNFFMCLLVNEGLML +A IW+DVY
Sbjct:   541 LGSIPFLFLMSISSSLVFYFMVGLRDDFSLLMYFVLNFFMCLLVNEGLMLFIACIWRDVY 600

Query:   593 WSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKACI 641
             WS LTLISVHV+MML+AG+FRIR ALP PVWTYP +Y++FHTYSI+  +
Sbjct:   601 WSTLTLISVHVIMMLAAGHFRIRTALPKPVWTYPFAYISFHTYSIEGLL 649




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0016020 "membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
TAIR|locus:2030898 ABCG11 "ATP-binding cassette G11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092960 ABCG15 "ATP-binding cassette G15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033899 ABCG12 "ATP-binding cassette G12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033939 ABCG13 "ATP-binding cassette G13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0002254 orf19.3120 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A0X6 CaO19.10632 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3L2 ABCG5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5B1 ABCG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E3LWM9 Cre-wht-1 "CRE-WHT-1 protein" [Caenorhabditis remanei (taxid:31234)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZUU9AB3G_ARATHNo assigned EC number0.83971.00.8780yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-75
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 6e-70
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-50
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 2e-47
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-43
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-42
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 3e-42
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-36
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-31
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-27
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-24
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 4e-23
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-23
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 1e-22
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 6e-22
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 2e-21
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-21
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-21
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 5e-21
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 6e-21
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 1e-20
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-20
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-19
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-19
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-19
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 1e-18
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-18
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-18
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-18
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-18
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 4e-18
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-17
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-17
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-17
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 4e-17
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 4e-17
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 7e-17
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-16
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 2e-16
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-16
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 5e-16
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 6e-16
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 7e-16
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 7e-16
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 8e-16
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-15
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-15
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-15
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-15
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 2e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 3e-15
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 5e-15
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 6e-15
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 7e-15
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-14
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 4e-14
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 4e-14
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 5e-14
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 6e-14
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 7e-14
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 7e-14
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-14
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-13
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-13
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 2e-13
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-13
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 3e-13
COG4988559 COG4988, CydD, ABC-type transport system involved 4e-13
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 5e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 7e-13
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 8e-13
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 8e-13
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 8e-13
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-12
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-12
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 2e-12
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-12
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-12
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 3e-12
COG4133209 COG4133, CcmA, ABC-type transport system involved 4e-12
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 6e-12
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 6e-12
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 7e-12
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 8e-12
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 8e-12
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 8e-12
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 1e-11
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-11
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-11
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-11
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 3e-11
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-11
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 4e-11
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 4e-11
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 6e-11
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 7e-11
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-10
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 1e-10
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 2e-10
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 3e-10
COG4148352 COG4148, ModC, ABC-type molybdate transport system 3e-10
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-10
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 4e-10
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 4e-10
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 5e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 5e-10
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 6e-10
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 6e-10
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 6e-10
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 7e-10
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 8e-10
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 1e-09
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-09
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-09
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-09
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 1e-09
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-09
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 2e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-09
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-09
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-09
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 4e-09
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 4e-09
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 5e-09
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 6e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-09
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 9e-09
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 1e-08
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-08
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-08
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 2e-08
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 2e-08
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 3e-08
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 4e-08
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 5e-08
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 5e-08
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 6e-08
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 7e-08
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 7e-08
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 7e-08
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 7e-08
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 7e-08
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 7e-08
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 1e-07
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-07
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 1e-07
COG4598256 COG4598, HisP, ABC-type histidine transport system 2e-07
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 2e-07
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 4e-07
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 4e-07
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 5e-07
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 5e-07
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 5e-07
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 6e-07
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 6e-07
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 7e-07
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 8e-07
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 9e-07
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 9e-07
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 1e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-06
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-06
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 1e-06
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 1e-06
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-06
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-06
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-06
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-06
COG1117253 COG1117, PstB, ABC-type phosphate transport system 2e-06
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 4e-06
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 4e-06
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 5e-06
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 5e-06
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 6e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 6e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 6e-06
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 7e-06
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 7e-06
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 7e-06
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 7e-06
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 7e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 7e-06
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 8e-06
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 8e-06
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 8e-06
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 9e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 9e-06
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-05
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-05
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 1e-05
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-05
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-05
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-05
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-05
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-05
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-05
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 3e-05
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 3e-05
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 3e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 4e-05
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 4e-05
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 5e-05
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 5e-05
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 6e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 7e-05
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 7e-05
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 7e-05
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 7e-05
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 7e-05
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 7e-05
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 8e-05
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 8e-05
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 9e-05
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-04
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 1e-04
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 1e-04
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 1e-04
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 2e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 2e-04
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 2e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-04
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 2e-04
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 2e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-04
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-04
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 3e-04
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 3e-04
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 3e-04
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 3e-04
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 3e-04
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 3e-04
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-04
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-04
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 5e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 6e-04
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 6e-04
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 7e-04
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 0.001
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 0.001
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 0.001
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 0.001
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.001
smart00382148 smart00382, AAA, ATPases associated with a variety 0.001
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 0.001
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 0.001
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 0.001
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 0.001
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 0.001
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 0.002
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 0.002
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 0.002
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 0.002
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 0.002
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 0.003
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 0.003
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 0.003
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 0.003
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 0.003
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 0.003
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 0.004
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 0.004
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.004
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 0.004
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 0.004
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
 Score =  238 bits (611), Expect = 3e-75
 Identities = 87/231 (37%), Positives = 129/231 (55%), Gaps = 40/231 (17%)

Query: 103 GASVVWKDLTVTIKGKR-RYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLP 161
           G ++ +++LTVT+K    +   +++K+ +G A PG +T IMGP+ +GKSTLL A+AGR  
Sbjct: 1   GVTLSFRNLTVTVKSSPSKSGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALAGRR- 59

Query: 162 HSARMYGEVFVNGAKSEM--PYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRK 219
               + GEV +NG   +        G+V ++  L  +LTVRE L ++A L          
Sbjct: 60  TGLGVSGEVLINGRPLDKRSFRKIIGYVPQDDILHPTLTVRETLMFAAKL---------- 109

Query: 220 NVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLD 279
                                     +GL  GER+RV IA ELV  P +LF+DEP   LD
Sbjct: 110 --------------------------RGLSGGERKRVSIALELVSNPSLLFLDEPTSGLD 143

Query: 280 SVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFG 330
           S SAL +M  L++LA TG T++ +I+Q S+E+F LFD++ LLS G  ++FG
Sbjct: 144 SSSALQVMSLLRRLADTGRTIICSIHQPSSEIFELFDKLLLLSQGRVIYFG 194


ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Length = 194

>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 641
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protei 100.0
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
COG1119257 ModF ABC-type molybdenum transport system, ATPase 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PTZ002431560 ABC transporter; Provisional 100.0
COG4674249 Uncharacterized ABC-type transport system, ATPase 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 100.0
COG4586325 ABC-type uncharacterized transport system, ATPase 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
COG4167267 SapF ABC-type antimicrobial peptide transport syst 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG1101263 PhnK ABC-type uncharacterized transport system, AT 100.0
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 100.0
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 100.0
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
KOG0059885 consensus Lipid exporter ABCA1 and related protein 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4136213 ABC-type uncharacterized transport system, ATPase 100.0
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 100.0
COG4133209 CcmA ABC-type transport system involved in cytochr 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 99.97
PLN03073718 ABC transporter F family; Provisional 99.97
COG0488530 Uup ATPase components of ABC transporters with dup 99.97
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.97
KOG00541381 consensus Multidrug resistance-associated protein/ 99.97
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.97
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.97
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.97
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.96
COG0488530 Uup ATPase components of ABC transporters with dup 99.96
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.96
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.96
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.95
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.95
COG4178604 ABC-type uncharacterized transport system, permeas 99.94
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.94
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.94
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.93
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.93
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.93
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.92
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.92
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.91
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.91
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.9
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.9
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.9
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.9
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.89
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.88
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.88
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.86
KOG0062582 consensus ATPase component of ABC transporters wit 99.85
PF01061210 ABC2_membrane: ABC-2 type transporter; InterPro: I 99.85
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.84
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.84
KOG0062582 consensus ATPase component of ABC transporters wit 99.83
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.83
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.81
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.8
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.8
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.8
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.77
PRK006351809 excinuclease ABC subunit A; Provisional 99.76
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.76
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.75
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.75
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.75
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.73
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.72
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.71
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.7
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.67
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.64
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.62
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.6
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.57
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.5
PRK00064361 recF recombination protein F; Reviewed 99.46
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.44
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.41
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.37
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 99.37
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.3
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.3
TIGR01247236 drrB daunorubicin resistance ABC transporter membr 99.29
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.29
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.28
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.27
PRK10869553 recombination and repair protein; Provisional 99.23
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.23
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 99.22
PHA02562562 46 endonuclease subunit; Provisional 99.21
PRK00409782 recombination and DNA strand exchange inhibitor pr 99.19
PRK07721438 fliI flagellum-specific ATP synthase; Validated 99.19
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 99.16
cd01128249 rho_factor Transcription termination factor rho is 99.16
TIGR03861253 phenyl_ABC_PedC alcohol ABC transporter, permease 99.16
PRK13695174 putative NTPase; Provisional 99.14
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.13
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 99.1
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 99.1
TIGR00025232 Mtu_efflux ABC transporter efflux protein, DrrB fa 99.07
PRK03918880 chromosome segregation protein; Provisional 99.06
TIGR01291253 nodJ ABC-2 type transporter, NodJ family. Nearly a 99.06
PRK06793432 fliI flagellum-specific ATP synthase; Validated 99.06
PRK102461047 exonuclease subunit SbcC; Provisional 99.03
PRK13830818 conjugal transfer protein TrbE; Provisional 99.02
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 99.01
COG3910233 Predicted ATPase [General function prediction only 98.96
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.94
PRK01156895 chromosome segregation protein; Provisional 98.93
PRK06067234 flagellar accessory protein FlaH; Validated 98.89
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.84
TIGR03062208 pip_yhgE_Cterm YhgE/Pip C-terminal domain. This fa 98.83
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.79
PRK15066257 inner membrane transport permease; Provisional 98.77
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.76
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.76
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.75
PRK02224880 chromosome segregation protein; Provisional 98.73
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.69
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.65
smart00382148 AAA ATPases associated with a variety of cellular 98.63
PRK13891852 conjugal transfer protein TrbE; Provisional 98.62
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.54
PRK07196434 fliI flagellum-specific ATP synthase; Validated 98.5
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 98.49
TIGR00611365 recf recF protein. All proteins in this family for 98.48
PRK14079349 recF recombination protein F; Provisional 98.47
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.43
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.39
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.38
PRK06002450 fliI flagellum-specific ATP synthase; Validated 98.35
TIGR01248152 drrC daunorubicin resistance protein C. The model 98.33
PRK05399854 DNA mismatch repair protein MutS; Provisional 98.33
PRK13898800 type IV secretion system ATPase VirB4; Provisional 98.32
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 98.31
PRK13873811 conjugal transfer ATPase TrbE; Provisional 98.23
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.23
COG0842286 ABC-type multidrug transport system, permease comp 98.2
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.15
PRK09825176 idnK D-gluconate kinase; Provisional 98.15
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 98.15
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.14
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 98.06
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.05
PF1355562 AAA_29: P-loop containing region of AAA domain 98.04
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 98.0
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.0
PRK13764602 ATPase; Provisional 97.97
TIGR03518240 ABC_perm_GldF gliding motility-associated ABC tran 97.94
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.93
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 97.92
PRK06315442 type III secretion system ATPase; Provisional 97.91
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 97.91
PRK08149428 ATP synthase SpaL; Validated 97.91
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.91
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 97.89
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=2.1e-98  Score=852.05  Aligned_cols=514  Identities=32%  Similarity=0.536  Sum_probs=451.1

Q ss_pred             CceEEEEeEEEEEecccccccceeeceeeEEeCCcEEEEECCCCCcHHHHHHHHHcCCCCCCCceeEEEECCEeCC--CC
Q 006548          103 GASVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSE--MP  180 (641)
Q Consensus       103 ~~~l~~~~ls~~~~~~~~~~~~iL~~vs~~i~~Ge~~aIiGpsGsGKSTLl~~LaG~~~~~~~~~G~I~~~G~~~~--~~  180 (641)
                      +..+.|+|++++.+++....+++|+|||+.++|||++||||||||||||||++|+|+.+.+...+|+|++||++..  ..
T Consensus        23 ~~~~~~~~~~~~~~~~~~~~k~iL~~vsg~~~~Gel~AimG~SGsGKtTLL~~Lagr~~~~~~~~G~ilvNG~~~~~~~~  102 (613)
T KOG0061|consen   23 PVKLSFRNLTLSSKEKSKKTKTILKGVSGTAKPGELLAIMGPSGSGKTTLLNALAGRLNGGLKLSGEILLNGRPRDSRSF  102 (613)
T ss_pred             cceeEEEEEEEEecCCCCccceeeeCcEEEEecCeEEEEECCCCCCHHHHHHHHhccccCCCcceEEEEECCccCchhhh
Confidence            4578999999998765435689999999999999999999999999999999999999876568999999996543  23


Q ss_pred             CceEEEEcCCCccCCCCCHHHHHHHHHHhcCCCc--cchHHHHHHHHHHHcCCchHHhhhhcCCCCCCCCCHHHHHHHHH
Q 006548          181 YGSYGFVERETTLIGSLTVREYLYYSALLQLPGF--FCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRRVRI  258 (641)
Q Consensus       181 ~~~~~yv~Q~~~l~~~lTV~E~l~~~~~~~~~~~--~~~~~~~v~~~l~~lgL~~~~~~~ig~~~~~~~LSGGerqRv~I  258 (641)
                      ++.+|||.|+|.++|++||+|+|.|.+.+++|..  ..+++++|+++++++||.+++|+++| +...+++||||||||+|
T Consensus       103 ~~~s~yV~QdD~l~~~LTV~EtL~f~A~lrlp~~~~~~~k~~~V~~vi~~LgL~~~~~t~ig-~~~~rgiSGGErkRvsi  181 (613)
T KOG0061|consen  103 RKISGYVQQDDVLLPTLTVRETLRFSALLRLPSSLSKEEKRERVEEVISELGLEKCADTLIG-NPGIRGLSGGERKRVSI  181 (613)
T ss_pred             hheeEEEcccccccccccHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHcCChhhccceec-CCCCCccccchhhHHHH
Confidence            4679999999999999999999999999999874  33478899999999999999999998 55559999999999999


Q ss_pred             HHHHHhCCcEEEEeCCCCCCCHHHHHHHHHHHHHHHHcCCEEEEEEeCChHHHHhcCCEEEEEeCCeEEEEeChhHHHHH
Q 006548          259 ARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQH  338 (641)
Q Consensus       259 A~aL~~~P~iLlLDEPtsgLD~~~~~~i~~~L~~l~~~g~tvi~t~h~~~~~i~~~~D~v~vL~~G~iv~~G~~~~~~~~  338 (641)
                      |.+|++||.||||||||||||+.++.++++.|+++|++|+|||+|+|||+.+++++||++++|.+|+++|+|+++++.++
T Consensus       182 a~Ell~~P~iLflDEPTSGLDS~sA~~vv~~Lk~lA~~grtVi~tIHQPss~lf~lFD~l~lLs~G~~vy~G~~~~~~~f  261 (613)
T KOG0061|consen  182 ALELLTDPSILFLDEPTSGLDSFSALQVVQLLKRLARSGRTVICTIHQPSSELFELFDKLLLLSEGEVVYSGSPRELLEF  261 (613)
T ss_pred             HHHHHcCCCEEEecCCCCCcchhhHHHHHHHHHHHHhCCCEEEEEEeCCcHHHHHHHhHhhhhcCCcEEEecCHHHHHHH
Confidence            99999999999999999999999999999999999988999999999999999999999999999999999999999999


Q ss_pred             hhhcCCCCCCCCCchHHHHHHHhcc--hhHHHHhhhccccCCCCCCccccChHHHHHHHHHHHhc-CHHHHHHHHHHHhh
Q 006548          339 FSNAGFPCPIMQSPSDHFLRAINTD--FDRIIAMCKSWQDDHGDFSSVNMDTAVAIRTLEATYQS-SADAAAVETMILRL  415 (641)
Q Consensus       339 f~~~g~~~~~~~~~~d~~l~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-s~~~~~~~~~~~~~  415 (641)
                      |++.|++||...||+|+++++++.+  .+.....                   .........++. ....+.........
T Consensus       262 f~~~G~~~P~~~Npadf~l~l~s~~~~~~~~~~~-------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~  322 (613)
T KOG0061|consen  262 FSSLGFPCPELENPADFLLDLLSVDSGTRELEEA-------------------VRIAKLINKFSQTDNLKKTLEALEKSL  322 (613)
T ss_pred             HHhCCCCCCCcCChHHHHHHHHccCCCchhHHhH-------------------HHHHHHhhhccccchhhhhHHHHhhhc
Confidence            9999999999999999999988743  1111000                   011111222221 11111110000000


Q ss_pred             hhccCCCcCCCCCCCHHHHHHHHHHHHHHHHhhChHHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHH
Q 006548          416 TEKEGPFLKSKGKASSATRVAVLTWRSLLIMSREWKYYWLRLILCMILTLCVGTVFSGLGHSLSSVVTRVAAIFVFVSFN  495 (641)
Q Consensus       416 ~~~~~~~~~~~~~~s~~~Q~~~l~~R~~~~~~Rd~~~~~~r~~~~~~~~l~~G~~f~~l~~~~~~~~~r~g~lff~~~~~  495 (641)
                      .+.  ...+.....+||.|++.|++|.+++.+|||.+.+.|+++.+++|+++|++||+++++..++++|.|++||.+.+.
T Consensus       323 ~~~--~~~~~~~~~s~~~q~~~L~~R~~~~~~R~~~~~~~r~~~~~~~~~~lg~~~~~~~~~~~~~~~~~g~~~~~~~~~  400 (613)
T KOG0061|consen  323 STS--KKVEIGTSPSWWTQFKILLKRSLKNIRRDPSLLLLRLIQSLVTGLLLGLLYLNLGNDAKGIQNRLGLFFFILSFM  400 (613)
T ss_pred             ccc--cccccccCCcHHHHHHHHHHHHhHHHhhcHHHHHHHHHHHHHHHHHHHHHhhCCCCchHHHHHHHHHHHHHHHHH
Confidence            011  111112278999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHh-hHHHHHhhHhHHHhhccCCCcchHHHHHHHHHHHHHHHHHHHHhhhhhhhccccccccHHHHHHHHHHHHHHH
Q 006548          496 SLLNIA-GVPALMKEIKTYASEESNMHSGALVFLLGQLLSSIPFLFLISISSSLVFYFLVGLRDEFSLLMYFVLNFFMCL  574 (641)
Q Consensus       496 ~~~~~~-~v~~~~~er~vf~rE~~~~~Y~~~~y~la~~l~elP~~~~~~~if~~i~Y~m~Gl~~~~~~F~~f~l~l~l~~  574 (641)
                      .|.++. +++.|+.||++|.||+.+|+|+.++|++|++++++|+.++.+++|++|+|||+|++++..+|++|++++++..
T Consensus       401 ~f~~~~~~i~~f~~e~~~f~rE~~~~~Y~~s~y~la~~l~~lP~~~i~~~if~~i~Y~m~gl~~~~~~f~~~~l~~~~~~  480 (613)
T KOG0061|consen  401 TFLSMFGAVPVFPQERPIFLRETSSGLYRLSSYYLAKTLAELPFLLVLSIIFSSIVYWMVGLNPGLSRFLYFLLIILLSS  480 (613)
T ss_pred             HHHHHHhHHHHhHHHHHHHHHHHhcCchhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhccCCcchHHHHHHHHHHHHHH
Confidence            888876 6899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhceecCCCCCCccccccccccccHHHHHhhhc
Q 006548          575 LVNEGLMLVVASIWKDVYWSILTLISVHVVMMLSAGYFRIRNALPGPVWTYPISYVAFHTYSIKAC  640 (641)
Q Consensus       575 ~~~~sl~~~i~~~~~~~~~a~~~~~~~~~~~~lf~Gf~i~~~~ip~~~W~~w~~yis~~~Ya~e~~  640 (641)
                      ++++++++++++++||...|+.++++++++|+||+|||++.+.||+  |++|++|+|+++|+|||+
T Consensus       481 ~~a~s~~~~i~~~~~~~~~a~~~~~~~~~~f~l~~G~fi~~~~ip~--~~~w~~~~S~~ry~~e~l  544 (613)
T KOG0061|consen  481 LVAESLGLFISAIVPNLSLATSLGPVLLLPFLLFGGFFINFDSIPK--YFRWISYLSYFRYAFEAL  544 (613)
T ss_pred             HHHHHHHHHHHHhccchhheeehHHHHHHHHHHHhhhhcCcccccH--HHHHHHHHhHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999995  556799999999999996



>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01247 drrB daunorubicin resistance ABC transporter membrane protein Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03861 phenyl_ABC_PedC alcohol ABC transporter, permease protein Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>TIGR00025 Mtu_efflux ABC transporter efflux protein, DrrB family Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR01291 nodJ ABC-2 type transporter, NodJ family Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR03062 pip_yhgE_Cterm YhgE/Pip C-terminal domain Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK15066 inner membrane transport permease; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01248 drrC daunorubicin resistance protein C Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>COG0842 ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03518 ABC_perm_GldF gliding motility-associated ABC transporter permease protein GldF Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 4e-14
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 4e-14
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 8e-14
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 8e-13
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 3e-12
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 2e-10
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 2e-10
1g29_1372 Malk Length = 372 3e-10
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 6e-10
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 1e-09
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 4e-09
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 6e-09
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 9e-09
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 1e-08
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-08
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 3e-08
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 3e-08
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-08
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 7e-08
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 8e-08
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 9e-08
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 1e-07
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 2e-07
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 5e-07
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 9e-07
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-06
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 6e-06
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 6e-06
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 7e-06
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 8e-06
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 9e-06
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 1e-05
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 1e-05
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 1e-05
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 1e-05
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 1e-05
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 2e-05
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-05
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-05
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 4e-05
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 5e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 7e-05
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-04
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 4e-04
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 4e-04
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 7e-04
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 9e-04
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 67/229 (29%), Positives = 100/229 (43%), Gaps = 22/229 (9%) Query: 136 GTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAK-SEMPYGS--YGFVERETT 192 G V +GP+ GKSTLLR IAG G++F+ + ++ P G V + Sbjct: 29 GEFVVFVGPSGCGKSTLLRMIAGL---ETITSGDLFIGEKRMNDTPPAERGVGMVFQSYA 85 Query: 193 LIGSLTVREYLYYSALLQLPG----FFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGL 248 L L+V E + + L+L G QR N V + + L D K + G Sbjct: 86 LYPHLSVAENMSFG--LKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG------- 136 Query: 249 PCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSS 308 G+R+RV I R LV P V +DEPL +LD+ + M + + +L + + Sbjct: 137 --GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQ 194 Query: 309 TEVFGLFDRICLLSNGNTLFFGETLACLQHFSNAGFPCPIMQSPSDHFL 357 E L D+I +L G G+ L L H+ F + SP +FL Sbjct: 195 VEAMTLADKIVVLDAGRVAQVGKPLE-LYHYPADRFVAGFIGSPKMNFL 242
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-23
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-21
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 4e-21
1sgw_A214 Putative ABC transporter; structural genomics, P p 4e-21
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-20
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 9e-20
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 6e-17
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 5e-08
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-16
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 4e-10
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-16
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-11
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-15
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-10
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-13
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 4e-13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 7e-13
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 7e-13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 9e-12
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-09
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-09
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 6e-09
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 9e-09
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 2e-08
1g6h_A257 High-affinity branched-chain amino acid transport 3e-08
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-08
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1b0u_A262 Histidine permease; ABC transporter, transport pro 1e-06
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-06
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 3e-06
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 4e-06
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-05
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 7e-06
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 8e-06
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 3e-05
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 3e-05
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 4e-05
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 4e-05
1ji0_A240 ABC transporter; ATP binding protein, structural g 6e-05
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-04
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-04
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 3e-04
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 3e-04
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 5e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 98.4 bits (246), Expect = 4e-23
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 35/196 (17%)

Query: 143 GPAKSGKSTLLRAIAGRLPHSARMYGEVFVNG---------AKSEMPYGSYGFVERETTL 193
           GP  +GK+T LR I+  +  S+   G V V G          +  +      ++  E   
Sbjct: 48  GPNGAGKTTTLRIISTLIKPSS---GIVTVFGKNVVEEPHEVRKLI-----SYLPEEAGA 99

Query: 194 IGSLTVREYL-YYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGE 252
             ++   EYL + +          + + +VE A     L +     +    Y KG+    
Sbjct: 100 YRNMQGIEYLRFVAGFYASSS--SEIEEMVERATEIAGLGEKIKDRVST--YSKGM---- 151

Query: 253 RRRVRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLASTGCTLLFTINQSST--- 309
            R++ IAR L++ P +  +DEP   LD ++A  +   LK+ +  G T+L +     +   
Sbjct: 152 VRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVS-----SHNM 206

Query: 310 -EVFGLFDRICLLSNG 324
            EV  L DRI L+ NG
Sbjct: 207 LEVEFLCDRIALIHNG 222


>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 641
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 4e-27
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-26
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-25
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 7e-25
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 4e-24
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 4e-24
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-24
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 4e-23
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-22
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 1e-22
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-22
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-22
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-21
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-21
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 9e-21
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 1e-19
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-19
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-18
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 6e-17
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-16
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 7e-09
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-05
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-05
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-05
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.003
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  107 bits (270), Expect = 4e-27
 Identities = 55/233 (23%), Positives = 96/233 (41%), Gaps = 19/233 (8%)

Query: 113 VTIKG-KRRYSD-KVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEV 170
           V ++   +R+ +   V   N     G   V++GP+  GK+T LR IAG    +    G +
Sbjct: 7   VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTE---GRI 63

Query: 171 FVNGAKSEMPYGSY---GFVERETTLIGSLTVREYLYYSALLQ-LPGFFCQRKNVVEDAI 226
           +                  V +   +   +TV E + +   ++  P    +    V  A 
Sbjct: 64  YFGDRDVTYLPPKDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPK--DEIDKRVRWAA 121

Query: 227 HAMSLSDYANKLIGGHCYMKGLPCGERRRVRIARELVMRPHVLFIDEPLYHLDSVSALLM 286
             + + +  N+      Y   L  G+R+RV +AR +V+ P VL +DEPL +LD+   + M
Sbjct: 122 ELLQIEELLNR------YPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAM 175

Query: 287 MVTLKKLA-STGCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLACLQH 338
              +KKL      T ++ +     E   + DRI +++ G  L  G        
Sbjct: 176 RAEIKKLQQKLKVTTIY-VTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLR 227


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.83
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.49
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.13
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.95
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.88
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 98.08
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 98.05
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 98.02
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.63
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.48
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.36
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.33
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.29
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 97.12
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.11
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.1
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.03
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.98
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.95
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.95
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.94
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.93
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.75
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.68
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.62
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.57
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.57
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.5
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.48
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.48
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.48
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.46
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.46
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.45
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.43
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.43
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.4
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.37
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.29
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.29
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.25
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.19
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.18
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.17
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.16
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.14
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.12
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.09
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.08
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.08
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.08
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.06
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.03
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.02
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.01
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.95
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.9
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.88
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.86
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.86
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.86
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.82
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.8
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.8
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.78
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.75
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.71
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.67
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.66
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.6
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.56
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.56
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.52
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.51
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.5
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.49
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.48
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.48
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.43
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.41
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.4
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.38
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.38
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.36
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.34
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.33
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.32
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.28
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.27
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 95.2
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.15
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.14
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.13
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.13
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.08
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.05
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.02
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.01
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.0
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.95
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.95
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.87
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.87
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.85
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.81
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.77
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.68
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.66
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.62
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.62
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.61
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.58
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.52
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.47
d1okkd2207 GTPase domain of the signal recognition particle r 94.37
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.32
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 94.28
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 94.15
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.14
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.07
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.04
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.99
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 93.98
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.95
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.94
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.93
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.9
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.88
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.88
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.84
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.82
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.82
d1vmaa2213 GTPase domain of the signal recognition particle r 93.81
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.64
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.6
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.6
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.59
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.56
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.56
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.53
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.49
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.49
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.43
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 93.4
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.39
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.39
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.31
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.27
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.23
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.21
d2qy9a2211 GTPase domain of the signal recognition particle r 93.19
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.18
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.16
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 93.08
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.07
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 93.06
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.04
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.01
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.88
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.77
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.77
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.75
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.7
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 92.67
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.63
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.62
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.61
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.61
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.47
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.45
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.3
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.29
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.24
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.13
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.11
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.04
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.04
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.01
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.94
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.93
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.92
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.89
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 91.89
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.87
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.86
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.77
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.76
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.61
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.56
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.42
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.07
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.89
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 90.87
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 90.57
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 90.53
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.37
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 90.22
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.19
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 90.06
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 88.78
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.76
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 88.71
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.48
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.21
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.03
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.96
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 87.47
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 87.35
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.26
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.1
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 86.52
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.25
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 85.93
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 85.8
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 84.98
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 84.98
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 84.64
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 84.34
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.2
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 83.61
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 83.39
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 83.27
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 83.1
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.09
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 82.27
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 81.59
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 80.96
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 80.83
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=100.00  E-value=0  Score=361.02  Aligned_cols=217  Identities=24%  Similarity=0.345  Sum_probs=193.1

Q ss_pred             EEEEEEEEEEEECCCCCCCCEEECEEEEEECCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEEEEECCEECC------
Q ss_conf             59999479999123334651000202488089299998799972999999997399999982019999997279------
Q 006548          105 SVVWKDLTVTIKGKRRYSDKVVKSSNGYALPGTMTVIMGPAKSGKSTLLRAIAGRLPHSARMYGEVFVNGAKSE------  178 (641)
Q Consensus       105 ~l~~~~ls~~~~~~~~~~~~iL~~vs~~~~~Ge~~aIiGpsGsGKSTLl~~LaG~~~~~~~~~G~I~i~G~~~~------  178 (641)
                      .+.++||++.|.     ...+|+|+|+.+++||+++|+||||||||||+++|+|+.+|++   |+|.++|.+..      
T Consensus         3 ~i~v~nl~k~yg-----~~~al~~vsl~i~~Ge~~~liG~sGaGKSTll~~i~gl~~p~s---G~I~~~g~~i~~~~~~~   74 (240)
T d1g2912           3 GVRLVDVWKVFG-----EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSR---GQIYIGDKLVADPEKGI   74 (240)
T ss_dssp             EEEEEEEEEEET-----TEEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHHTSSCCSE---EEEEETTEEEEEGGGTE
T ss_pred             CEEEEEEEEEEC-----CEEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCC---CEEEECCEEECCCCHHH
T ss_conf             189986999989-----9999856066886998999999999809999999964878898---98999999803566444


Q ss_pred             ---CCCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             ---99850899828876699999999999999802998500079999999999399058753305887778889899999
Q 006548          179 ---MPYGSYGFVERETTLIGSLTVREYLYYSALLQLPGFFCQRKNVVEDAIHAMSLSDYANKLIGGHCYMKGLPCGERRR  255 (641)
Q Consensus       179 ---~~~~~~~yv~Q~~~l~~~lTV~E~l~~~a~l~~~~~~~~~~~~v~~~l~~lgL~~~~~~~igg~~~~~gLSGGqrqR  255 (641)
                         ..++.+|||+|++.++|.+||+||+.++..++.. ...+.+++++++++.++|.+..++.+.      .||||||||
T Consensus        75 ~~~~~~r~ig~v~Q~~~L~~~ltV~eni~~~~~~~~~-~~~e~~~~v~~~l~~~~l~~~~~~~p~------~LSGGqkQR  147 (240)
T d1g2912          75 FVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKV-PRQEIDQRVREVAELLGLTELLNRKPR------ELSGGQRQR  147 (240)
T ss_dssp             ECCGGGSSEEEECSCCCCCTTSCHHHHHHHHHHHTTC-CHHHHHHHHHHHHHHHTCGGGTTCCGG------GSCHHHHHH
T ss_pred             HCCCCCCCCEECCCCHHHCCHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHCCCHHHHCCCHH------HCCHHHHHH
T ss_conf             2453225512002212223101166763306877299-989999999999987599667629933------499999999


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHC-CCEEEEEEECCHHHHHHCCCEEEEEECCEEEEEECHHH
Q ss_conf             99999997199688993999999999999999999999875-98799999379388982087899982994889809257
Q 006548          256 VRIARELVMRPHVLFIDEPLYHLDSVSALLMMVTLKKLAST-GCTLLFTINQSSTEVFGLFDRICLLSNGNTLFFGETLA  334 (641)
Q Consensus       256 v~IA~aL~~~P~iLllDEPTsgLD~~s~~~i~~~L~~l~~~-g~tvi~tih~~~~~i~~~~D~v~lL~~G~iv~~G~~~~  334 (641)
                      ++|||||+.+|++|+|||||+|||+.++..+++.|+++.++ |.|+|+++|+ ..++..+|||+++|++|++++.|++++
T Consensus       148 v~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~~~~g~tvi~vTHd-~~~~~~~~drv~vm~~G~iv~~G~~~e  226 (240)
T d1g2912         148 VALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHD-QVEAMTMGDRIAVMNRGVLQQVGSPDE  226 (240)
T ss_dssp             HHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESC-HHHHHHHCSEEEEEETTEEEEEECHHH
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCC-HHHHHHHCCEEEEEECCEEEEECCHHH
T ss_conf             9999998269988982588765698999899999999986369889999599-999999699999998999999859999


Q ss_pred             HHH
Q ss_conf             988
Q 006548          335 CLQ  337 (641)
Q Consensus       335 ~~~  337 (641)
                      ++.
T Consensus       227 l~~  229 (240)
T d1g2912         227 VYD  229 (240)
T ss_dssp             HHH
T ss_pred             HHH
T ss_conf             982



>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure