Citrus Sinensis ID: 006638

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------

MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPCPTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFLSRGSTREIKASQDSELSEDIQLKNEEDTEIEIQKMEEIRKTEKDAPFTEEKPSSGRASLMGINDASDEFFDVPEAYSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWEELFGDSN

ccccccccEEEEEEEEEEEccccEEEccEEEEEEEcEEEEEEEEccccccccccEEEEEEcEEEEEcccccEEcccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEEccccccEEcccccEEEEEEEEcccHHHHHHHHHccccccccccccccEEEEEEEcccccEEEEEEEEEcccccccccccEEEEEEEEEccccEEEEEEEEEccccccccccEEEEEEEccEEEEEccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccEEEEccccccccccccccccccEEEEEEEEccccccHHHHcccccHHHHHHccccccEEEEEEEEccccccccccccccccccccccccccccccccccccc

cccccccccEEEEEEEEccccccccccccEEEEEccHHHHHEccccccccccccEEEEEcccEEEEEcccEEEcccEEEEEEEEccccccccEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEcccccccccccccccEEEEEEEEEccHHHHHHHHHccccccccHcHHHccccEEEEEccccEEEEEEEcccccccccccccEEEEEEEEEcccccEEEEEEEcccccccccccEEEEEEEcccEEEEEccccccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccHHHHHHHHccHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHEEHHHHcccccHHHHHcccccHHHHHHHcccccEEEEEEEEccccccccccHccccccccccccHHHHHHHHHccccc

mgiarnesKIEGWLYAILVNRIGMQISRKRYFILLDNclngykmvpssekeepvksaMIHSCIRVTDNGRESINRKVLFVFTLYNsldhneklklgarspEEAAKWIRSLQEAAvkecpcptynfvavskrrwpslrlyvskrsdykysgdwtlgssirseatasdviapspwkifgcqngLRLFKEakdwdsrgrhwddhpaimavgvvdgTSEAIFQTLMSlgssrsewdfcfyrgcvvehldghSDVVHKLLysdwlpwgmqrRDLLVRRYwrreddgtYVILYHSvnhkkcpkqkgyVRACLksggfvitpsnqgkqSIVKHMLAVDWKYWklylrpssarSITIRMLERVAALRELFQAkagntsseflsrgstreikasqdselsediqlkneedTEIEIQKMEEIRktekdapfteekpssgraslmgindasdeffdvpeaysdhmendwslevspelqplsapqskLASAAGFVKKLHDLAVHkkgctdlqevpnedekswsygatlqtdssftspcswaaadpstflirGENYLKDHRKIKADGTLMQMIGADWLrsnkrednlaarpcslvqkyaagggpefFFVVNIqfpgvmdsqaeCWEDGLLAGASTRSQLLSWEELFGDSN

mgiarneskieGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPCPTynfvavskrrwpslrlyvskrsdykysgdWTLGSSIRSEAtasdviapspwKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLysdwlpwgmqRRDLLVRRYWRREDDGTYVILYhsvnhkkcpkqKGYVRACLKSGGfvitpsnqgkqSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFqakagntsseflsrgstreikasqdselsediqlkneedteieIQKMeeirktekdapfteekpssgraslMGINDASDEFFDVPEAYSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRsqllsweelfgdsn

MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPCPTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQrrdllvrrywrrEDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFLSRGSTREIKASQDSELSEDIQLKNEEDTEIEIQKMEEIRKTEKDAPFTEEKPSSGRASLMGINDASDEFFDVPEAYSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWEELFGDSN

*********IEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMV***********AMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLG******AAKWIRSLQEAAVKECPCPTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQ********************************************************************************************************************AGFVKKLHDLAVHKKGCTDL**********WSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWE*******

***********GWLYAILVNRIGMQISRKRYFILLDNCLNGY***************MIHSCIRVTDNGRESINRKVLFVFTLYNSL*********************************************************************************APSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFL*R************************************************************************************************************************************************SFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAAR************GPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWEELFG***

MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVP**********AMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPCPTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAG************************EDIQLKNEEDTEIEIQKMEEIRKT**************RASLMGINDASDEFFDVPEAYSDHMENDWSLEVS*************ASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWEELFGDSN

*******SKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKE************************************************DVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAG*****************************************************************************************************************GFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGVMDSQAECWEDGLLAGASTRSQLLSWEELFGDS*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		637
224097876		734	predicted protein [Populus trichocarpa]	0.929	0.806	0.639	0.0
297746269		734	unnamed protein product [Vitis vinifera]	0.926	0.803	0.641	0.0
356533967		746	PREDICTED: uncharacterized protein LOC10	0.921	0.786	0.628	0.0
449464402		733	PREDICTED: uncharacterized protein LOC10	0.926	0.804	0.642	0.0
224113047		725	predicted protein [Populus trichocarpa]	0.913	0.802	0.655	0.0
225449034		737	PREDICTED: uncharacterized protein LOC10	0.930	0.804	0.615	0.0
297816772		732	hypothetical protein ARALYDRAFT_485890 [	0.916	0.797	0.607	0.0
30694123		733	Pleckstrin homology (PH) and lipid-bindi	0.916	0.796	0.612	0.0
296086010		728	unnamed protein product [Vitis vinifera]	0.916	0.802	0.619	0.0
26451069		733	unknown protein [Arabidopsis thaliana] g	0.916	0.796	0.609	0.0

>gi\|224097876\|ref\|XP_002311087.1\| predicted protein [Populus trichocarpa] gi\|222850907\|gb\|EEE88454.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/608 (63%), Positives = 467/608 (76%), Gaps = 16/608 (2%)

Query: 1   MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIH 60
           MG+  N+ K+EGWL+ I  +R G+Q SR+RYFIL +N L  YK  P S++EEP++SA I 
Sbjct: 1   MGVPPNDGKMEGWLFIIRSHRFGLQFSRRRYFILQENYLRCYKTKPISQEEEPLRSAKID 60

Query: 61  SCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPC 120
           S IR+TDNGRESINRKV F+F LYN L+ N+ LKLGA   E+A +WIRSLQ A +KECP 
Sbjct: 61  SYIRITDNGRESINRKVFFIFALYNILNENDHLKLGASGSEDAGRWIRSLQNAVLKECPN 120

Query: 121 PTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQN 180
           P   F++ SK+ W   R   +KR+  + S D+   S + +EA  SDVIAPSPWKIFGCQN
Sbjct: 121 PEKEFMSFSKKNWLPSRFGSAKRAHRQRSIDYY--SFLHNEAVTSDVIAPSPWKIFGCQN 178

Query: 181 GLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCV 240
           GLRLFKEAKDWDSRGRHWDDHPAIMAVGV++GT EAIF TLMSLG+SRSEWDFCFYRG V
Sbjct: 179 GLRLFKEAKDWDSRGRHWDDHPAIMAVGVLNGTPEAIFHTLMSLGASRSEWDFCFYRGSV 238

Query: 241 VEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKKCPKQKG 300
           VEHLDGH+D++H  LYS+WLPWGM RRD L+RRYWRRE+DGTYVILYHSV HKKCP Q G
Sbjct: 239 VEHLDGHTDILHAKLYSNWLPWGMMRRDFLLRRYWRREEDGTYVILYHSVIHKKCPPQNG 298

Query: 301 YVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRE 360
           YVRACLKSGG+VITP N+G++S+VKHMLAV+WK+WK+YLR  S RSITIRMLER+AALRE
Sbjct: 299 YVRACLKSGGYVITPVNKGRESLVKHMLAVNWKFWKVYLRQPSGRSITIRMLERLAALRE 358

Query: 361 LFQAKAGNTSSEFLSRGSTREIKASQDSELSEDIQLKNEEDTEIEIQKMEEIRKTEKDAP 420
           +FQAKAGN  S+F S  S  +I   QD    EDI  K+E+ ++   QK E     E+D  
Sbjct: 359 MFQAKAGNYPSDFSSADSEVKIMLPQDE--VEDI--KSEDKSQ---QKFELNADLEEDEA 411

Query: 421 FTEEKPSSGRASLMGINDASDEFFDVPEAYS----DHMENDWSLEVSPELQPLSAPQSKL 476
              EK +SGR SLM +NDASDEFFDVP++      DH+EN W  EVS E    +  Q +L
Sbjct: 412 ---EKTTSGRRSLMSLNDASDEFFDVPDSGEVIAFDHLENGWFPEVSQEWPASNMSQPRL 468

Query: 477 ASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKSWSYGATLQTDSSFTSPCSWAAADPSTF 536
           +SAA FVKKLHDLAV KKG  D QE+  E+  + S+G TLQ DS+ + PCSWA ADP+TF
Sbjct: 469 SSAAVFVKKLHDLAVQKKGYMDFQELAKEENVATSFGNTLQKDSACSLPCSWATADPTTF 528

Query: 537 LIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFV 596
           LIRGENY KD+ KIKA GTLMQM+GADWLRS++RED+L +R  S+VQK+AA G PEFFF+
Sbjct: 529 LIRGENYFKDNLKIKATGTLMQMVGADWLRSDRREDDLGSRAESIVQKFAAQGRPEFFFI 588

Query: 597 VNIQFPGV 604
           VNIQ PGV
Sbjct: 589 VNIQVPGV 596

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|297746269\|emb\|CBI16325.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356533967\|ref\|XP_003535529.1\| PREDICTED: uncharacterized protein LOC100802528 [Glycine max]	Back alignment and taxonomy information

>gi\|449464402\|ref\|XP_004149918.1\| PREDICTED: uncharacterized protein LOC101207368 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224113047\|ref\|XP_002316372.1\| predicted protein [Populus trichocarpa] gi\|222865412\|gb\|EEF02543.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225449034\|ref\|XP_002274053.1\| PREDICTED: uncharacterized protein LOC100259813 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297816772\|ref\|XP_002876269.1\| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. lyrata] gi\|297322107\|gb\|EFH52528.1\| hypothetical protein ARALYDRAFT_485890 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|30694123|ref|NP_191040.2| Pleckstrin homology (PH) and lipid-binding START domain-containing protein [Arabidopsis thaliana] gi|79315061|ref|NP_001030862.1| Pleckstrin homology (PH) and lipid-binding START domain-containing protein [Arabidopsis thaliana] gi|222424068|dbj|BAH19994.1| AT3G54800 [Arabidopsis thaliana] gi|332645768|gb|AEE79289.1| Pleckstrin homology (PH) and lipid-binding START domain-containing protein [Arabidopsis thaliana] gi|332645769|gb|AEE79290.1| Pleckstrin homology (PH) and lipid-binding START domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|296086010\|emb\|CBI31451.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|26451069\|dbj\|BAC42639.1\| unknown protein [Arabidopsis thaliana] gi\|29028904\|gb\|AAO64831.1\| At3g54800 [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		637
TAIR\|locus:2102465		733	AT3G54800 [Arabidopsis thalian	0.708	0.615	0.588	5.9e-198
TAIR\|locus:2057547		737	AT2G28320 [Arabidopsis thalian	0.910	0.786	0.566	1.1e-176
TAIR\|locus:2163548		719	AT5G45560 [Arabidopsis thalian	0.329	0.292	0.350	1.5e-48
TAIR\|locus:2117134		724	EDR2 "ENHANCED DISEASE RESISTA	0.329	0.290	0.359	3.2e-48
TAIR\|locus:2182417		811	AT5G35180 [Arabidopsis thalian	0.160	0.125	0.271	2.1e-23
TAIR\|locus:2198866		313	AT1G06050 "AT1G06050" [Arabido	0.158	0.322	0.279	0.00014
TAIR\|locus:2183705		302	AT5G10750 "AT5G10750" [Arabido	0.158	0.334	0.305	0.00016

TAIR\|locus:2102465 AT3G54800 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1394 (495.8 bits), Expect = 5.9e-198, Sum P(2) = 5.9e-198
 Identities = 280/476 (58%), Positives = 344/476 (72%)

Query:     1 MGIARNESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIH 60
             MG+++ + ++EGWLY I  NR G+Q SRKRYF+L +N L  +K VPS   EEP + A + 
Sbjct:     1 MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLHENNLTSFKSVPSDHNEEPERRASLD 60

Query:    61 SCIRVTDNGRESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKWIRSLQEAAVKECPC 120
              CIRVTDNGRES +RK+LF+FTLYN+ +H ++LKLGA SPEEAAKWIRSLQ+A+ K  P 
Sbjct:    61 CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPI 120

Query:   121 PTYNFVAVSKRRWPSLRLYVSKRSDYKYSGDWTLGSSIRSEAT--------ASDVIAPSP 172
             P   F  VS      ++L VSKR+  K S DWT  SS    +T        A DVIAPSP
Sbjct:   121 PDCEFF-VSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETNVAPDVIAPSP 179

Query:   173 WKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWD 232
             WKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGV+DGTSE IF TLMSLG  RSEWD
Sbjct:   180 WKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWD 239

Query:   233 FCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQXXXXXXXXXXXXEDDGTYVILYHSVNH 292
             FCFY+G VVEHLDGH+D++H  LYSDWLPWGM             EDDGTYVIL HSV H
Sbjct:   240 FCFYKGNVVEHLDGHTDIIHLQLYSDWLPWGMNRRDLLLRRYWRREDDGTYVILCHSVYH 299

Query:   293 KKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRML 352
             K CP +KGYVRAC+KSGG+V+TP+N GKQS+VKHM+A+DW+ W LY+RPSSARSITIR++
Sbjct:   300 KNCPPKKGYVRACVKSGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIRVV 359

Query:   353 ERVAALRELFQAKAGNTSSEFLSRGSTREIKASQDSELSEDIQLKNE-EDTEIEIQKMEE 411
             ERVAALRE+F+AK G+  +EF+S G   + K    S+++  + LK E ++ ++E    EE
Sbjct:   360 ERVAALREMFKAKQGHGFTEFVS-GEFLDTKPCL-SKINT-MPLKTEAKEVDLETMHAEE 416

Query:   412 IRKTEKDAPFTEEKPSSGRASLMGINDASDEFFDVPEAYSDHMENDWSLEVSPELQ 467
             +           +KP+S R SLM +NDASDEFFDVPE  ++  E D  ++ SP  Q
Sbjct:   417 M-----------DKPTSARNSLMDLNDASDEFFDVPEP-NESTEFDSFIDSSPYSQ 460

GO:0005543 "phospholipid binding" evidence=IEA

GO:0007165 "signal transduction" evidence=ISS

GO:0035091 "phosphatidylinositol binding" evidence=ISS

TAIR\|locus:2057547 AT2G28320 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163548 AT5G45560 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2117134 EDR2 "ENHANCED DISEASE RESISTANCE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2182417 AT5G35180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2198866 AT1G06050 "AT1G06050" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2183705 AT5G10750 "AT5G10750" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00080329	hypothetical protein (734 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		637
PLN00188		719	PLN00188, PLN00188, enhanced disease resistance pr	2e-67
cd00177		193	cd00177, START, Lipid-binding START domain of mamm	3e-39
pfam07059		215	pfam07059, DUF1336, Protein of unknown function (D	2e-22
smart00234		205	smart00234, START, in StAR and phosphatidylcholine	3e-18
pfam01852		205	pfam01852, START, START domain	2e-15
cd08871		222	cd08871, START_STARD10-like, Lipid-binding START d	1e-11
smart00233		102	smart00233, PH, Pleckstrin homology domain	2e-09
cd08868		208	cd08868, START_STARD1_3_like, Cholesterol-binding	8e-07
pfam00169		101	pfam00169, PH, PH domain	1e-06
cd08876		195	cd08876, START_1, Uncharacterized subgroup of the	2e-05
cd13248		104	cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate	5e-05
cd08909		205	cd08909, START_STARD13-like, C-terminal lipid-bind	1e-04
cd08911		207	cd08911, START_STARD7-like, Lipid-binding START do	3e-04
cd00821		92	cd00821, PH, Pleckstrin homology (PH) domain	5e-04
cd13298		106	cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin	0.003

>gnl\|CDD\|215094 PLN00188, PLN00188, enhanced disease resistance protein (EDR2); Provisional	Back alignment and domain information

 Score =  233 bits (595), Expect = 2e-67
 Identities = 178/635 (28%), Positives = 284/635 (44%), Gaps = 109/635 (17%)

Query: 11  EGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGR 70
           EGW+      +IG      RYF+L    L  YK  P  + + P+K+ +I    RV D G 
Sbjct: 7   EGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQ-DNQVPIKTLLIDGNCRVEDRGL 65

Query: 71  ESINRKVLFVFTLYNSLDHNEKLKLGARSPEEAAKW-------IRSLQEAAVKECPCPTY 123
           ++ +  +++V ++YN  +   ++ + A + +EA  W       I   Q++ V     P  
Sbjct: 66  KTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQV-----PNG 120

Query: 124 NFVAVS--KRRWPSLRLYVSKRSDYKYSG--------------------------DWT-- 153
           N  A    K    + R   S   + ++S                           DWT  
Sbjct: 121 NKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDLLRRTTIGNGPPDSVLDWTKE 180

Query: 154 LGSSIRSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGT 213
             S + ++ + +   +   W++  CQNGLR+F+E  + D   R      A+ AVGVV+ T
Sbjct: 181 FDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSR--AMKAVGVVEAT 238

Query: 214 SEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRR 273
            E IF+ +MS+  +R EWD  F  G +VE +DGH+ +++  L  DW P  +  RDL   R
Sbjct: 239 CEEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVR 298

Query: 274 YWRREDDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITP---SNQGKQSIVKHMLAV 330
           YWRR DDG+YV+L+ S  H+ C  Q G+VRA L+SGGF I+P    N   ++ V+H++ +
Sbjct: 299 YWRRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNISPLKPRNGRPRTQVQHLMQI 358

Query: 331 DWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSSEFLSRGSTREIKASQDSEL 390
           D K W +   PS  +   ++ML  VA LRE F        S+   RG+   I        
Sbjct: 359 DLKGWGVGYIPSFQQHCLLQMLNSVAGLREWF--------SQTDERGAPPRIPV------ 404

Query: 391 SEDIQLKNEEDTEIEIQKMEEIRKTEKDAPFTEEKPSSGRASLMGINDAS--DEFFDVPE 448
                + N     +  +K    +K ++ +P  ++  ++ R S+M +++ S  DE F +PE
Sbjct: 405 -----MVNMASASVSSKKN---QKPQESSPSLDQTNAASRNSVM-MDEDSDDDEEFQIPE 455

Query: 449 AYSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEK 508
           +           E  PE        + +                       +E  ++ + 
Sbjct: 456 S-----------EQEPETTKNETKDTAME----------------------EEPQDKIDL 482

Query: 509 SWSYGATLQTDSSFTSPCSWAAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSN 568
           S   G   + D      C W  +D + F +R +N+  D  KI A   LM ++  DW +  
Sbjct: 483 SCFSGNLRRDDRDKARDC-WRISDGNNFKVRSKNFCYDKSKIPAGKHLMDLVAVDWFKDT 541

Query: 569 KREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPG 603
           KR D++A R     Q  A  G   F FVVN+Q PG
Sbjct: 542 KRMDHVARRKGCAAQVAAEKG--LFSFVVNLQVPG 574

Length = 719

>gnl\|CDD\|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins	Back alignment and domain information

>gnl\|CDD\|219281 pfam07059, DUF1336, Protein of unknown function (DUF1336)	Back alignment and domain information

>gnl\|CDD\|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein	Back alignment and domain information

>gnl\|CDD\|216740 pfam01852, START, START domain	Back alignment and domain information

>gnl\|CDD\|176880 cd08871, START_STARD10-like, Lipid-binding START domain of mammalian STARD10 and related proteins	Back alignment and domain information

>gnl\|CDD\|214574 smart00233, PH, Pleckstrin homology domain	Back alignment and domain information

>gnl\|CDD\|176877 cd08868, START_STARD1_3_like, Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins	Back alignment and domain information

>gnl\|CDD\|215766 pfam00169, PH, PH domain	Back alignment and domain information

>gnl\|CDD\|176885 cd08876, START_1, Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family	Back alignment and domain information

>gnl\|CDD\|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|176918 cd08909, START_STARD13-like, C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain	Back alignment and domain information

>gnl\|CDD\|176920 cd08911, START_STARD7-like, Lipid-binding START domain of mammalian STARD7 and related proteins	Back alignment and domain information

>gnl\|CDD\|241231 cd00821, PH, Pleckstrin homology (PH) domain	Back alignment and domain information

>gnl\|CDD\|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		637
PLN00188		719	enhanced disease resistance protein (EDR2); Provis	100.0
cd08914		236	START_STARD15-like Lipid-binding START domain of m	100.0
cd08913		240	START_STARD14-like Lipid-binding START domain of m	100.0
cd08873		235	START_STARD14_15-like Lipid-binding START domain o	100.0
cd08904		204	START_STARD6-like Lipid-binding START domain of ma	100.0
cd08868		208	START_STARD1_3_like Cholesterol-binding START doma	100.0
cd08906		209	START_STARD3-like Cholesterol-binding START domain	100.0
cd08869		197	START_RhoGAP C-terminal lipid-binding START domain	100.0
cd08903		208	START_STARD5-like Lipid-binding START domain of ma	100.0
cd08874		205	START_STARD9-like C-terminal START domain of mamma	100.0
cd08867		206	START_STARD4_5_6-like Lipid-binding START domain o	100.0
cd08902		202	START_STARD4-like Lipid-binding START domain of ma	100.0
cd08909		205	START_STARD13-like C-terminal lipid-binding START	100.0
cd08871		222	START_STARD10-like Lipid-binding START domain of m	99.98
cd08905		209	START_STARD1-like Cholesterol-binding START domain	99.98
smart00234		206	START in StAR and phosphatidylcholine transfer pro	99.97
cd08872		235	START_STARD11-like Ceramide-binding START domain o	99.97
cd08907		205	START_STARD8-like C-terminal lipid-binding START d	99.97
cd08911		207	START_STARD7-like Lipid-binding START domain of ma	99.97
PF01852		206	START: START domain; InterPro: IPR002913 START (St	99.96
cd08910		207	START_STARD2-like Lipid-binding START domain of ma	99.96
cd08908		204	START_STARD12-like C-terminal lipid-binding START	99.96
cd08870		209	START_STARD2_7-like Lipid-binding START domain of	99.96
cd00177		193	START Lipid-binding START domain of mammalian STAR	99.96
cd08876		195	START_1 Uncharacterized subgroup of the steroidoge	99.96
PF07059		227	DUF1336: Protein of unknown function (DUF1336); In	99.94
cd08877		215	START_2 Uncharacterized subgroup of the steroidoge	99.93
KOG2761		219	consensus START domain-containing proteins involve	99.88
KOG1739		611	consensus Serine/threonine protein kinase GPBP [Si	99.57
cd08875		229	START_ArGLABRA2_like C-terminal lipid-binding STAR	99.46
cd08864		208	SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-	99.38
cd01246		91	PH_oxysterol_bp Oxysterol binding protein (OSBP) P	98.88
smart00233		102	PH Pleckstrin homology domain. Domain commonly fou	98.8
cd07813		138	COQ10p_like Coenzyme Q-binding protein COQ10p and	98.8
PF00169		104	PH: PH domain; InterPro: IPR001849 The pleckstrin	98.73
cd01251		103	PH_centaurin_alpha Centaurin alpha Pleckstrin homo	98.7
cd08866		144	SRPBCC_11 Ligand-binding SRPBCC domain of an uncha	98.68
cd01260		96	PH_CNK Connector enhancer of KSR (Kinase suppresso	98.56
cd01238		106	PH_Tec Tec pleckstrin homology (PH) domain. Tec pl	98.52
cd01233		100	Unc104 Unc-104 pleckstrin homology (PH) domain. Un	98.47
cd01235		101	PH_SETbf Set binding factor Pleckstrin Homology (P	98.39
PF15413		112	PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE	98.39
cd01250		94	PH_centaurin Centaurin Pleckstrin homology (PH) do	98.38
cd01247		91	PH_GPBP Goodpasture antigen binding protein (GPBP)	98.38
cd01257		101	PH_IRS Insulin receptor substrate (IRS) pleckstrin	98.36
cd07819		140	SRPBCC_2 Ligand-binding SRPBCC domain of an unchar	98.35
cd00900		99	PH-like Pleckstrin homology-like domain. Pleckstri	98.35
cd01252		125	PH_cytohesin Cytohesin Pleckstrin homology (PH) do	98.34
cd01265		95	PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	98.34
PF11274		184	DUF3074: Protein of unknown function (DUF3074)	98.31
cd01266		108	PH_Gab Gab (Grb2-associated binder) pleckstrin hom	98.17
cd01219		101	PH_FGD FGD (faciogenital dysplasia protein) plecks	98.15
cd05018		144	CoxG Carbon monoxide dehydrogenase subunit G (CoxG	98.14
cd01244		98	PH_RasGAP_CG9209 RAS_GTPase activating protein (GA	98.14
cd00821		96	PH Pleckstrin homology (PH) domain. Pleckstrin hom	98.09
cd01241		102	PH_Akt Akt pleckstrin homology (PH) domain. Akt pl	98.04
cd01264		101	PH_melted Melted pleckstrin homology (PH) domain.	98.02
cd08861		142	OtcD1_ARO-CYC_like N-terminal and C-terminal aroma	97.96
cd01254		121	PH_PLD Phospholipase D (PLD) pleckstrin homology (	97.88
cd01220		99	PH_CDEP Chondrocyte-derived ezrin-like domain cont	97.86
PF15409		89	PH_8: Pleckstrin homology domain	97.82
PF03364		130	Polyketide_cyc: Polyketide cyclase / dehydrase and	97.79
cd01253		104	PH_beta_spectrin Beta-spectrin pleckstrin homology	97.77
cd01236		104	PH_outspread Outspread Pleckstrin homology (PH) do	97.75
cd08860		146	TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom	97.68
cd07821		140	PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1),	97.64
cd01256		110	PH_dynamin Dynamin pleckstrin homology (PH) domain	97.64
cd01237		106	Unc112 Unc-112 pleckstrin homology (PH) domain. Un	97.6
cd01263		122	PH_anillin Anillin Pleckstrin homology (PH) domain	97.59
cd07817		139	SRPBCC_8 Ligand-binding SRPBCC domain of an unchar	97.54
cd01245		98	PH_RasGAP_CG5898 RAS GTPase-activating protein (GA	97.47
KOG2200		674	consensus Tumour suppressor protein p122-RhoGAP/DL	97.42
PRK10724		158	hypothetical protein; Provisional	97.37
KOG0930		395	consensus Guanine nucleotide exchange factor Cytoh	97.15
PF10604		139	Polyketide_cyc2: Polyketide cyclase / dehydrase an	97.02
cd01230		117	PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6	96.87
cd08865		140	SRPBCC_10 Ligand-binding SRPBCC domain of an uncha	96.78
PF12814		123	Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin	96.6
cd07812		141	SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR	96.44
cd07823		146	SRPBCC_5 Ligand-binding SRPBCC domain of an unchar	96.24
cd01239		117	PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom	96.21
cd07824		146	SRPBCC_6 Ligand-binding SRPBCC domain of an unchar	96.21
cd07818		150	SRPBCC_1 Ligand-binding SRPBCC domain of an unchar	95.73
cd08862		138	SRPBCC_Smu440-like Ligand-binding SRPBCC domain of	95.65
PF06240		140	COXG: Carbon monoxide dehydrogenase subunit G (Cox	94.92
cd01224		109	PH_Collybistin Collybistin pleckstrin homology (PH	94.66
cd07822		141	SRPBCC_4 Ligand-binding SRPBCC domain of an unchar	94.55
cd01218		104	PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain	94.26
PF15410		119	PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN	93.73
COG2867		146	Oligoketide cyclase/lipid transport protein [Lipid	92.98
cd01223		116	PH_Vav Vav pleckstrin homology (PH) domain. Vav pl	92.98
cd07814		139	SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-	92.29
cd07825		144	SRPBCC_7 Ligand-binding SRPBCC domain of an unchar	91.3
KOG3845		241	consensus MLN, STAR and related lipid-binding prot	90.94
cd07816		148	Bet_v1-like Ligand-binding bet_v_1 domain of major	90.47
cd01261		112	PH_SOS Son of Sevenless (SOS) Pleckstrin homology	90.1
cd01249		104	PH_oligophrenin Oligophrenin Pleckstrin homology (	89.74
cd01259		114	PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr	89.62
cd01221		125	PH_ephexin Ephexin Pleckstrin homology (PH) domain	89.42
cd07820		137	SRPBCC_3 Ligand-binding SRPBCC domain of an unchar	89.41
KOG0690		516	consensus Serine/threonine protein kinase [Signal	88.33
cd01222		97	PH_clg Clg (common-site lymphoma/leukemia guanine	88.15
COG3427		146	Carbon monoxide dehydrogenase subunit G, CoxG [Ene	87.93
cd01242		112	PH_ROK Rok (Rho- associated kinase) pleckstrin hom	87.62
PF15408		104	PH_7: Pleckstrin homology domain	81.93
cd01243		122	PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin	80.55

>PLN00188 enhanced disease resistance protein (EDR2); Provisional	Back alignment and domain information

Probab=100.00  E-value=4.1e-137  Score=1146.86  Aligned_cols=564  Identities=29%  Similarity=0.491  Sum_probs=495.3

Q ss_pred             ccceeeEEEEEeecccccccccceeeEeecceeeeeecCCCCCCCccceeeeecCceEEecCCcceeeCceEEEEEEecC
Q 006638            7 ESKIEGWLYAILVNRIGMQISRKRYFILLDNCLNGYKMVPSSEKEEPVKSAMIHSCIRVTDNGRESINRKVLFVFTLYNS   86 (637)
Q Consensus         7 ~~~~egW~~~~~~~~lg~~~~~~Ryfvl~~~~~~~yKr~P~~~~~~pi~~~ii~~~~rVed~Gr~~~~~~~~~v~~~yn~   86 (637)
                      ..+|||||||||+||||++|||+|||||+|++|+||||+|+++ ++|||+|+||+||||||+||++|||++||||+|||+
T Consensus         3 ~~~~eGW~y~~g~~kig~~~~~~Ry~vl~~~~~~~yK~~P~~~-~~pirs~~id~~~rVed~Gr~~~~g~~~yvl~~Yn~   81 (719)
T PLN00188          3 KVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDN-QVPIKTLLIDGNCRVEDRGLKTHHGHMVYVLSVYNK   81 (719)
T ss_pred             cceEeeEEEEEcccccccccceeEEEEEecchhhhcccCCccc-cccceeeccCCCceEeecCceEEcCceEEEEEEecC
Confidence            4579999999999999999999999999999999999999999 999999999999999999999999999999999999


Q ss_pred             CCCcceeeeccCCHHHHHHHHHHHHHHHhhcC----CCCCC--cc-------------cccc-----------cccCccc
Q 006638           87 LDHNEKLKLGARSPEEAAKWIRSLQEAAVKEC----PCPTY--NF-------------VAVS-----------KRRWPSL  136 (637)
Q Consensus        87 ~~~~~~~~~~~~~~eea~~W~~~~~~a~~~~~----~~~~~--~~-------------~~~~-----------~~~~~~~  136 (637)
                      ++|++|++|||+|+|||++||+||++|++|+.    .+++.  ++             .+++           +.++.++
T Consensus        82 ~~~~~~~~~~a~~~eea~~W~~a~~~a~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~  161 (719)
T PLN00188         82 KEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQVPNGNKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDLL  161 (719)
T ss_pred             CCccccEEEecCCHHHHHHHHHHHHHHHhhhccccccccccccceeeccccccccccccccccccccccccccccCcccc
Confidence            99999999999999999999999999999752    11100  00             0111           2356778


Q ss_pred             eeeeccCCCCCcccCCCCCccc--cccccccccCCCCCCEEEEeeCCEEEEEEeecCCCCCccCCCCceEEEEEEecCCH
Q 006638          137 RLYVSKRSDYKYSGDWTLGSSI--RSEATASDVIAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTS  214 (637)
Q Consensus       137 r~~~~~~~~~~~s~~w~~~~~~--~n~~a~~dv~a~~~Wkl~~~knGVrIy~~~~~~~~~~~~~s~~~~~Ka~gvV~asp  214 (637)
                      |+++||+||+.+.++||.....  +|.++.+|+++.+.|+++.|+||+|||++..+.++.++  +..++||++|+|+++|
T Consensus       162 r~~tig~gp~~s~~~~t~~~~~~~~~~~~~~d~~~~~~Wr~~~c~NGlRiF~e~~~~~~~~~--~~~~~mKavGVV~asp  239 (719)
T PLN00188        162 RRTTIGNGPPDSVLDWTKEFDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPR--SCSRAMKAVGVVEATC  239 (719)
T ss_pred             eeeeccCCCcchhcccccccCccccccCCCccccccCCeEEEEeeccceeehhhhccccccc--cCCceeEEEEEecCCH
Confidence            9999999999999999876654  48899999999999999999999999999988887665  5569999999999999


Q ss_pred             HHHHHHHhcCCCCccccccccceeEEEEeecCceEEEEEEeecCCCCCCCCCceEEEEEEEEEcCCCeEEEEEeecCCCC
Q 006638          215 EAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDDGTYVILYHSVNHKK  294 (637)
Q Consensus       215 e~VfelL~D~~~~R~eWD~~~~~~~vVE~ID~~tdIvY~~~~~~~~P~pvs~RDFV~lR~wrr~~DGsyvI~~~SV~Hp~  294 (637)
                      ++||++||+++..|.+||.++.++++||+||+||+|+|.++++.|+|+.++|||||++|+|++.+||+|+|+++||+||+
T Consensus       240 E~Ifd~Vm~~~~~R~eWD~~~~~~~vIE~ID~htdI~Y~~~~~~~~~~~ispRDFV~~Rywrr~eDGsYvil~~Sv~Hp~  319 (719)
T PLN00188        240 EEIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYVVLFRSREHEN  319 (719)
T ss_pred             HHHHHHHhccCcccccchhcccceEEEEEecCCeEEEEEEeccccccCccCcceeEEEEEEEEcCCCcEEEeeeeeecCC
Confidence            99999999998779999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCeEEEEEeeeeEEEEeCC---CCCceEEEEEEEEeCCCccccccccchhhHHHHHHHHHHHHHHHHHhhcCCCCc
Q 006638          295 CPKQKGYVRACLKSGGFVITPSN---QGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAGNTSS  371 (637)
Q Consensus       295 ~Pp~~GyVRaei~~gG~vI~Pl~---~~~~~~VTyi~qvDpkGwip~~~~~~~~~i~~~ml~~va~LRe~~~~~~~~~~~  371 (637)
                      |||++|||||++++|||+|.|+.   +.++|+|+|++|+|+|||+|+|+++++++++++||++||+|||||.+++..++ 
T Consensus       320 cPP~kG~VRg~~~pGGwiIsPL~~~~g~~r~lv~~~lqtDlkGW~~~y~~s~~~~~~l~mL~~VAgLrE~~~~~~~~~~-  398 (719)
T PLN00188        320 CGPQPGFVRAHLESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYIPSFQQHCLLQMLNSVAGLREWFSQTDERGA-  398 (719)
T ss_pred             CCCCCCeEEEEEeCCEEEEEECCCCCCCCceEEEEEEEEccCccccccCccccccchHHHHHHHHHHHHHHhcCcccCc-
Confidence            99999999999999999999983   33699999999999999999999999999999999999999999999997766 


Q ss_pred             cccccCcccccccccccch--hhhhhhcccchhHHHHHHHHHhhhccCCCCCCCCCCCCCCCcccCCCCCCCcccCCccC
Q 006638          372 EFLSRGSTREIKASQDSEL--SEDIQLKNEEDTEIEIQKMEEIRKTEKDAPFTEEKPSSGRASLMGINDASDEFFDVPEA  449 (637)
Q Consensus       372 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~de~f~~~~~  449 (637)
                            .+|++++.+++..  .++.++..++                ...+.+.+...+..++++++++|+|||||+||+
T Consensus       399 ------~~~~~~~~~~~~~~~~~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~~dE~~~~~e~  456 (719)
T PLN00188        399 ------PPRIPVMVNMASASVSSKKNQKPQE----------------SSPSLDQTNAASRNSVMMDEDSDDDEEFQIPES  456 (719)
T ss_pred             ------cccceeecccccccccccccccccc----------------cccccccccccchhhhhhccccccchhccCCCc
Confidence                  7889999888765  3333322221                122233333445568899999999999999998


Q ss_pred             ccccccccccccCCCCCCCCCCcccccccccchhhhhhhhhhhccCcccccCCCCCCCCc-cccccccccCCCCCCCCce
Q 006638          450 YSDHMENDWSLEVSPELQPLSAPQSKLASAAGFVKKLHDLAVHKKGCTDLQEVPNEDEKS-WSYGATLQTDSSFTSPCSW  528 (637)
Q Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~a~~~~~~~~~~~~~~~~~i~-~~~~g~l~~~~~~~~~~~W  528 (637)
                      +++.+                  +.+ +.++.++                ..+.+++.+| ++|+|+|++++++++.+||
T Consensus       457 ~~~~~------------------~~k-~~~~~~~----------------~~~~~~~~~d~~~~~g~l~~~~~~~~~ncW  501 (719)
T PLN00188        457 EQEPE------------------TTK-NETKDTA----------------MEEEPQDKIDLSCFSGNLRRDDRDKARDCW  501 (719)
T ss_pred             ccccc------------------ccc-ccccccc----------------cccCCcccccccccccccccCCCCCCCCCc
Confidence            87210                  000 0000000                1345778899 9999999999999999999


Q ss_pred             eccCCCceEEecccccccCccccCCCCcceeeeeeeeecCCcchhhhcCCCchhHHhhhcCCCceEEEEEEEeCCC-Cce
Q 006638          529 AAADPSTFLIRGENYLKDHRKIKADGTLMQMIGADWLRSNKREDNLAARPCSLVQKYAAGGGPEFFFVVNIQFPGV-MDS  607 (637)
Q Consensus       529 s~p~~~~F~VRG~~Yl~Dk~Kvpa~~~l~~lvgvD~f~~~~~~dhia~~~~~~vq~~~~~~~~~f~fivNiqvPg~-~~s  607 (637)
                      ++|++++|+|||+|||+||+|||||++||+|+|||||++++|+||||+||+|++|.+.+++  ||+|||||||||+ +||
T Consensus       502 s~Pd~~~F~VRG~~Yl~Dk~KvPAg~~l~~lvgvDwfks~~ridhVa~r~~~~vq~a~~k~--~F~fiVNlQvPg~~~ys  579 (719)
T PLN00188        502 RISDGNNFKVRSKNFCYDKSKIPAGKHLMDLVAVDWFKDTKRMDHVARRKGCAAQVAAEKG--LFSFVVNLQVPGSTHYS  579 (719)
T ss_pred             cCCCCcceEEcCCCcccCCccccCCccceeeEEEEEEcCCchhhHhhcCCCchhhhhcccC--CcEEEEEEEccCCCceE
Confidence            9999999999999999999999999999999999999999999999999999999976665  6999999999999 999


Q ss_pred             eEEEecccccCCCchhhhhccccccc
Q 006638          608 QAECWEDGLLAGASTRSQLLSWEELF  633 (637)
Q Consensus       608 ~V~y~~~~~~~~~s~~~~~~~~~~~~  633 (637)
                      +|+||.......+|++.+|++=++-|
T Consensus       580 ~V~Yf~~~~l~~~sLl~rF~~GDD~f  605 (719)
T PLN00188        580 MVFYFVTKELVPGSLLQRFVDGDDEF  605 (719)
T ss_pred             EEEEEeccCCCCchHHHHhccCchhH
Confidence            99999988889999999999855544

>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins	Back alignment and domain information

>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins	Back alignment and domain information

>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins	Back alignment and domain information

>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins	Back alignment and domain information

>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins	Back alignment and domain information

>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins	Back alignment and domain information

>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain	Back alignment and domain information

>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins	Back alignment and domain information

>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding	Back alignment and domain information

>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins	Back alignment and domain information

>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins	Back alignment and domain information

>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain	Back alignment and domain information

>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins	Back alignment and domain information

>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins	Back alignment and domain information

>smart00234 START in StAR and phosphatidylcholine transfer protein	Back alignment and domain information

>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains	Back alignment and domain information

>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain	Back alignment and domain information

>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins	Back alignment and domain information

>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins []	Back alignment and domain information

>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins	Back alignment and domain information

>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain	Back alignment and domain information

>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins	Back alignment and domain information

>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins	Back alignment and domain information

>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family	Back alignment and domain information

>PF07059 DUF1336: Protein of unknown function (DUF1336); InterPro: IPR009769 This entry represents the C terminus (approximately 250 residues) of a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family	Back alignment and domain information

>KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism]	Back alignment and domain information

>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms]	Back alignment and domain information

>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins	Back alignment and domain information

>cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily	Back alignment and domain information

>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>smart00233 PH Pleckstrin homology domain	Back alignment and domain information

>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins	Back alignment and domain information

>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ]	Back alignment and domain information

>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain	Back alignment and domain information

>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01238 PH_Tec Tec pleckstrin homology (PH) domain	Back alignment and domain information

>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain	Back alignment and domain information

>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C	Back alignment and domain information

>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain	Back alignment and domain information

>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd00900 PH-like Pleckstrin homology-like domain	Back alignment and domain information

>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain	Back alignment and domain information

>PF11274 DUF3074: Protein of unknown function (DUF3074)	Back alignment and domain information

>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain	Back alignment and domain information

>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG)	Back alignment and domain information

>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain	Back alignment and domain information

>cd00821 PH Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01241 PH_Akt Akt pleckstrin homology (PH) domain	Back alignment and domain information

>cd01264 PH_melted Melted pleckstrin homology (PH) domain	Back alignment and domain information

>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains	Back alignment and domain information

>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain	Back alignment and domain information

>PF15409 PH_8: Pleckstrin homology domain	Back alignment and domain information

>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp	Back alignment and domain information

>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain	Back alignment and domain information

>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain	Back alignment and domain information

>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains	Back alignment and domain information

>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins	Back alignment and domain information

>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain	Back alignment and domain information

>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain	Back alignment and domain information

>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain	Back alignment and domain information

>KOG2200 consensus Tumour suppressor protein p122-RhoGAP/DLC1 [Signal transduction mechanisms]	Back alignment and domain information

>PRK10724 hypothetical protein; Provisional	Back alignment and domain information

>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis	Back alignment and domain information

>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain	Back alignment and domain information

>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis	Back alignment and domain information

>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily	Back alignment and domain information

>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain	Back alignment and domain information

>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu	Back alignment and domain information

>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster	Back alignment and domain information

>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain	Back alignment and domain information

>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain	Back alignment and domain information

>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A	Back alignment and domain information

>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism]	Back alignment and domain information

>cd01223 PH_Vav Vav pleckstrin homology (PH) domain	Back alignment and domain information

>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins	Back alignment and domain information

>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>KOG3845 consensus MLN, STAR and related lipid-binding proteins [Lipid transport and metabolism]	Back alignment and domain information

>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins	Back alignment and domain information

>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain	Back alignment and domain information

>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain	Back alignment and domain information

>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins	Back alignment and domain information

>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain	Back alignment and domain information

>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion]	Back alignment and domain information

>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain	Back alignment and domain information

>PF15408 PH_7: Pleckstrin homology domain	Back alignment and domain information

>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		637
3fo5_A		258	Thioesterase, adipose associated, isoform BFIT2; o	3e-35
3p0l_A		221	Steroidogenic acute regulatory protein, mitochond;	4e-34
1em2_A		229	MLN64 protein; beta barrel, lipid binding protein;	1e-33
2r55_A		231	STAR-related lipid transfer protein 5; alpha and b	2e-30
2pso_A		237	STAR-related lipid transfer protein 13; alpha and	3e-29
3qsz_A		189	STAR-related lipid transfer protein; structural ge	2e-25
2e3n_A		255	Lipid-transfer protein CERT; ceramide transfer, li	2e-25
1jss_A		224	Stard4, cholesterol-regulated start protein 4; sta	2e-25
1ln1_A		214	PC-TP, phosphatidylcholine transfer protein; start	3e-25
1v89_A		118	Hypothetical protein KIAA0053; pleckstrin homology	2e-07
3cxb_B		112	Pleckstrin homology domain-containing family M mem	2e-07
1upq_A		123	PEPP1; PH domain, phosphoinositide binding, signal	2e-07
2dkp_A		128	Pleckstrin homology domain-containing family A mem	3e-07
2d9y_A		117	Pleckstrin homology domain-containing protein fami	5e-07
2yry_A		122	Pleckstrin homology domain-containing family A mem	5e-07
2cof_A		107	Protein KIAA1914; PH domain, structural genomics,	6e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
1u5d_A		108	SKAP55, SRC kinase-associated phosphoprotein of 55	1e-06
2y7b_A		134	Actin-binding protein anillin; cell cycle; 1.90A {	2e-06
1pls_A		113	Pleckstrin homology domain; phosphorylation; NMR {	2e-06
1wgq_A		109	FYVE, rhogef and PH domain containing 6; ethanol d	3e-06
1u5f_A		148	SRC-associated adaptor protein; PH domain of SKAP-	4e-06
1x1f_A		149	Signal-transducing adaptor protein 1; docking prot	6e-06
4a6h_A		120	Phosphatidylinositol 4,5-bisphosphate-binding Pro	7e-06
1dyn_A		125	Dynamin; signal transduction protein; 2.20A {Homo	1e-05
1wi1_A		126	Calcium-dependent activator protein for secretion,	2e-05
2ys3_A		137	UNC-112-related protein 2; PH domain, kindlin-3, s	3e-05
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	3e-05
1eaz_A		125	Tandem PH domain containing protein-1; lipid-bindi	3e-05
1u5e_A		211	SRC-associated adaptor protein; novel dimerization	4e-05
2rsg_A		94	Collagen type IV alpha-3-binding protein; pleckstr	6e-05
2dtc_A		126	RAL guanine nucleotide exchange factor ralgps1A; P	7e-05
1fao_A		126	Dual adaptor of phosphotyrosine and 3- phosphoinos	1e-04
2dn6_A		115	KIAA0640 protein; PH domain, structural genomics,	2e-04
1x1g_A		129	Pleckstrin 2; PH domain, structural genomics, rike	2e-04
2d9w_A		127	Docking protein 2; PH domain, structural genomics,	3e-04
2da0_A		114	130-kDa phosphatidylinositol 4,5-biphosphate- depe	3e-04
1wg7_A		150	Dedicator of cytokinesis protein 9; pleckstrin hom	4e-04
2w2x_D		124	1-phosphatidylinositol-4,5-bisphosphate phosphodie	6e-04
2d9v_A		130	Pleckstrin homology domain-containing protein fami	7e-04
1v88_A		130	Oxysterol binding protein-related protein 8; vesic	8e-04

>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258	Back alignment and structure

 Score =  133 bits (335), Expect = 3e-35
 Identities = 43/242 (17%), Positives = 79/242 (32%), Gaps = 22/242 (9%)

Query: 127 AVSKRRWPSLRLYV--SKRSDYKYSGDWTLGSSIRSEATASDVIAPSPWKIFGCQNGLRL 184
           A ++++    R Y+   K+++   S  W   + +      ++V   S  K+   ++   L
Sbjct: 16  ASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSY--NNV---SSLKMLVAKDNWVL 70

Query: 185 FKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHL 244
             E           D   +     VV   +   F  L  L   R EWD  +    +V+ +
Sbjct: 71  SSEISQVRLYTLEDDKFLSFHMEMVVHVDAAQAFLLLSDL-RQRPEWDKHYRSVELVQQV 129

Query: 245 DGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRREDD--GTYVILYHSVNHKKCPKQKGYV 302
           D    + H  + S  L    + +D ++    R+  D    YVI   SV      +   Y 
Sbjct: 130 DEDDAIYH--VTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYR 187

Query: 303 RACLKSGGFVITPSNQGKQSIVKHMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELF 362
           R      GF +        + V +              P     +T  +    +     F
Sbjct: 188 RGETLCSGFCLWREGDQL-TKVSYYNQAT---------PGVLNYVTTNVAGLSSEFYTTF 237

Query: 363 QA 364
           +A
Sbjct: 238 KA 239

PyMOL of 3fo5

>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221	Back alignment and structure

>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229	Back alignment and structure

>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231	Back alignment and structure

>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237	Back alignment and structure

>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189	Back alignment and structure

>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Length = 255	Back alignment and structure

>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224	Back alignment and structure

>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214	Back alignment and structure

>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118	Back alignment and structure

>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112	Back alignment and structure

>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123	Back alignment and structure

>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128	Back alignment and structure

>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117	Back alignment and structure

>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122	Back alignment and structure

>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108	Back alignment and structure

>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134	Back alignment and structure

>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113	Back alignment and structure

>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109	Back alignment and structure

>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148	Back alignment and structure

>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149	Back alignment and structure

>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120	Back alignment and structure

>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125	Back alignment and structure

>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126	Back alignment and structure

>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137	Back alignment and structure

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228	Back alignment and structure

>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125	Back alignment and structure

>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211	Back alignment and structure

>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94	Back alignment and structure

>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126	Back alignment and structure

>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126	Back alignment and structure

>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115	Back alignment and structure

>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129	Back alignment and structure

>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127	Back alignment and structure

>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114	Back alignment and structure

>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150	Back alignment and structure

>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Length = 124	Back alignment and structure

>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130	Back alignment and structure

>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		637
3fo5_A		258	Thioesterase, adipose associated, isoform BFIT2; o	100.0
3p0l_A		221	Steroidogenic acute regulatory protein, mitochond;	100.0
2r55_A		231	STAR-related lipid transfer protein 5; alpha and b	100.0
1em2_A		229	MLN64 protein; beta barrel, lipid binding protein;	100.0
1jss_A		224	Stard4, cholesterol-regulated start protein 4; sta	100.0
2pso_A		237	STAR-related lipid transfer protein 13; alpha and	100.0
3qsz_A		189	STAR-related lipid transfer protein; structural ge	100.0
2e3n_A		255	Lipid-transfer protein CERT; ceramide transfer, li	99.97
1ln1_A		214	PC-TP, phosphatidylcholine transfer protein; start	99.97
2w2x_D		124	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.01
1v88_A		130	Oxysterol binding protein-related protein 8; vesic	98.83
4a6h_A		120	Phosphatidylinositol 4,5-bisphosphate-binding Pro	98.82
2dkp_A		128	Pleckstrin homology domain-containing family A mem	98.8
2dhk_A		119	TBC1 domain family member 2; PH domain, paris-1, s	98.8
1v89_A		118	Hypothetical protein KIAA0053; pleckstrin homology	98.79
1u5d_A		108	SKAP55, SRC kinase-associated phosphoprotein of 55	98.75
1wgq_A		109	FYVE, rhogef and PH domain containing 6; ethanol d	98.73
2d9y_A		117	Pleckstrin homology domain-containing protein fami	98.73
2cod_A		115	Centaurin-delta 1; ARF GAP and RHO GAP with ankyri	98.72
2yry_A		122	Pleckstrin homology domain-containing family A mem	98.71
3rcp_A		103	Pleckstrin homology domain-containing family A ME;	98.69
2dn6_A		115	KIAA0640 protein; PH domain, structural genomics,	98.69
2d9x_A		120	Oxysterol binding protein-related protein 11; PH d	98.69
2da0_A		114	130-kDa phosphatidylinositol 4,5-biphosphate- depe	98.69
2rsg_A		94	Collagen type IV alpha-3-binding protein; pleckstr	98.68
1unq_A		125	RAC-alpha serine/threonine kinase; transferase, pl	98.67
1wi1_A		126	Calcium-dependent activator protein for secretion,	98.66
1u5f_A		148	SRC-associated adaptor protein; PH domain of SKAP-	98.65
1v5u_A		117	SBF1, SET binding factor 1; MTMR5, the pleckstrin	98.62
2cof_A		107	Protein KIAA1914; PH domain, structural genomics,	98.61
1upq_A		123	PEPP1; PH domain, phosphoinositide binding, signal	98.59
2i5f_A		109	Pleckstrin; PH domain, protein-inositol phosphate	98.59
2y7b_A		134	Actin-binding protein anillin; cell cycle; 1.90A {	98.59
1eaz_A		125	Tandem PH domain containing protein-1; lipid-bindi	98.58
1fgy_A		127	GRP1; PH domain, signaling protein; HET: 4IP; 1.50	98.58
1fao_A		126	Dual adaptor of phosphotyrosine and 3- phosphoinos	98.58
1pls_A		113	Pleckstrin homology domain; phosphorylation; NMR {	98.55
3aj4_A		112	Pleckstrin homology domain-containing family B ME;	98.54
1wg7_A		150	Dedicator of cytokinesis protein 9; pleckstrin hom	98.54
1x05_A		129	Pleckstrin; PH domain, structural genomics, NPPSFA	98.53
1x1f_A		149	Signal-transducing adaptor protein 1; docking prot	98.53
1v5p_A		126	Pleckstrin homology domain-containing, family A; T	98.49
2d9v_A		130	Pleckstrin homology domain-containing protein fami	98.49
2lul_A		164	Tyrosine-protein kinase TEC; structural genomics,	98.48
1u5e_A		211	SRC-associated adaptor protein; novel dimerization	98.47
1btn_A		106	Beta-spectrin; signal transduction protein; HET: I	98.46
1btk_A		169	Bruton'S tyrosine kinase; transferase, PH domain,	98.44
2j59_M		168	RHO-GTPase activating protein 10; ARF, ARF1, ARFBD	98.41
2coc_A		112	FYVE, rhogef and PH domain containing protein 3; s	98.4
3tfm_A		228	Myosin X; split PH domain, motor protein; 2.53A {R	98.38
3cxb_B		112	Pleckstrin homology domain-containing family M mem	98.36
1dyn_A		125	Dynamin; signal transduction protein; 2.20A {Homo	98.36
1wjm_A		123	Beta-spectrin III; PH domain, signal transduction,	98.34
2fjl_A		150	1-phosphatidylinositol-4,5-bisphosphate phosphodie	98.32
2p0d_A		129	RHO GTPase-activating protein 9; protein-phosphoin	98.28
1x1g_A		129	Pleckstrin 2; PH domain, structural genomics, rike	98.28
2dtc_A		126	RAL guanine nucleotide exchange factor ralgps1A; P	98.17
2rlo_A		128	Centaurin-gamma 1; split PH domain, alternative sp	98.14
3tca_A		291	Amyloid beta A4 precursor protein-binding family 1	98.13
2r09_A		347	Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph	98.11
2rov_A		117	RHO-associated protein kinase 2; ATP-binding, coil	98.1
4h8s_A		407	DCC-interacting protein 13-beta; BAR domain, pleck	98.01
3a8p_A		263	T-lymphoma invasion and metastasis-inducing protei	98.0
3pp2_A		124	RHO GTPase-activating protein 27; PH domain, GTPas	97.99
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	97.98
1dro_A		122	Beta-spectrin; cytoskeleton; NMR {Drosophila melan	97.98
1qqg_A		264	IRS-1, insulin receptor substrate 1; beta-sandwhic	97.9
3tl1_A		159	WHIE ORF VI, polyketide cyclase; helix-GRIP fold,	97.83
2q13_A		385	DCC-interacting protein 13 alpha; APPL1, BAR domai	97.82
1t17_A		148	Conserved hypothetical protein; beta-alpha-beta-BE	97.81
2d4r_A		147	Hypothetical protein TTHA0849; start domain, struc	97.8
3tvq_A		169	Multifunctional cyclase-dehydratase-3-O-methyl TR	97.71
2ys3_A		137	UNC-112-related protein 2; PH domain, kindlin-3, s	97.7
2d9w_A		127	Docking protein 2; PH domain, structural genomics,	97.53
3tfz_A		172	Cyclase; helix-GRIP, BET V1-like superfamily, bios	97.52
3lju_X		386	ARF-GAP with dual PH domain-containing protein 1;	97.37
4ejn_A		446	RAC-alpha serine/threonine-protein kinase; AKT1, a	97.29
2pcs_A		162	Conserved protein; structural genomics, unknown fu	97.24
3hk0_A		256	Growth factor receptor-bound protein 10; GRB10, RA	97.23
4gmv_A		281	RAS-associated and pleckstrin homology domains-CO	97.1
3ggn_A		155	Uncharacterized protein DR_A0006; structural genom	97.07
2coa_A		125	Protein kinase C, D2 type; protein kinase D2, PH d	97.01
3p9v_A		161	Uncharacterized protein; structural genomics, PSI-	96.86
2ns9_A		157	Hypothetical protein APE2225; uncharacterized cons	96.82
3a8n_A		279	TIAM-1, T-lymphoma invasion and metastasis-inducin	96.75
2d9z_A		129	Protein kinase C, NU type; PH domain, structural g	96.52
3f08_A		146	Uncharacterized protein Q6HG14; NESG Q6HG14_bachk	96.51
4f7h_A		173	Fermitin family homolog 2; beta-barrel, membrane b	95.95
3ijt_A		155	SMU.440, putative uncharacterized protein; hypothe	95.47
3p51_A		160	Uncharacterized protein; structural genomics, PSI-	95.17
4bbk_A		165	Kindlin-1, fermitin family homolog 1; PH domain, c	95.16
2qpv_A		156	Uncharacterized protein ATU1531; structural genomi	95.14
2le1_A		151	Uncharacterized protein; structural genomics, nort	94.93
1v61_A		132	RAC/CDC42 guanine nucleotide exchange factor (GEF)	93.52
3qwm_A		140	Iqsec1, IQ motif and SEC7 domain-containing protei	91.46
1e09_A		159	PRU AV 1; allergen, major cherry allergen, pathoge	90.39
1tw0_A		157	Pathogenesis-related class 10 protein SPE-16; seve	90.16
1mai_A		131	Phospholipase C delta-1; pleckstrin, inositol tris	89.75
2flh_A		155	Cytokinin-specific binding protein; zeatin, pathog	88.18
3rt2_A		183	Abscisic acid receptor PYL10; ABA-independent PP2C	88.16
3t06_A		418	PDZ-rhogef, RHO guanine nucleotide exchange factor	87.68
2qim_A		158	PR10.2B; trans-zeatin, cytokinin, plant hormones,	86.96
1nty_A		311	Triple functional domain protein; DBL, pleckstrin,	86.94
1icx_A		155	Protein LLR18A, LLPR10.1A; 7-stranded beta sheet,	86.9
1kz7_A		353	Guanine nucleotide exchange factor DBS; guanine nu	86.6
3jrs_A		208	PYL1, putative uncharacterized protein AT5G46790;	86.17
3kl1_A		190	PYL2, putative uncharacterized protein AT2G26040;	85.99
1w1g_A		151	HPDK1, 3-phosphoinositide dependent protein kinase	85.96
3odw_A		536	RHO guanine nucleotide exchange factor 1; regulati	85.94
2dfk_A		402	Collybistin II; DH domain, PH domain, cell cycle;	85.86
1xcg_A		368	PDZ-rhogef, RHO guanine nucleotide exchange factor	85.44
3p6a_A		377	RHO guanine nucleotide exchange factor 1; regulati	85.03
2pz1_A		466	RHO guanine nucleotide exchange factor 4; helical	84.67
3mpx_A		434	FYVE, rhogef and PH domain-containing protein 5; s	83.42
1txd_A		385	RHO guanine nucleotide exchange factor 12; helical	80.87

>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens}	Back alignment and structure

Probab=100.00  E-value=1.8e-43  Score=362.54  Aligned_cols=239  Identities=18%  Similarity=0.243  Sum_probs=201.8

Q ss_pred             eccCCHHHHHHHHHHHHHHHhhcCCCCCCcccccccccCccc-eeeeccC-C-CCCcccCCCCCcccc----cccccccc
Q 006638           95 LGARSPEEAAKWIRSLQEAAVKECPCPTYNFVAVSKRRWPSL-RLYVSKR-S-DYKYSGDWTLGSSIR----SEATASDV  167 (637)
Q Consensus        95 ~~~~~~eea~~W~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~-r~~~~~~-~-~~~~s~~w~~~~~~~----n~~a~~dv  167 (637)
                      +.+.+.++.||    |++||+               ++++|| |+|++++ . ++++|++||++||+|    |+.||+++
T Consensus         2 ~~~~~~~~~~r----~~~a~a---------------r~~~r~~r~~~~~~~~~~~p~~~~w~~~~~~~l~~~n~~al~~l   62 (258)
T 3fo5_A            2 MRPQPGDGERR----YREASA---------------RKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKML   62 (258)
T ss_dssp             --------CHH----HHHHHH---------------HHHHHHHHHTCSCCCTTTSCSEEECCGGGHHHHHHHHHHHHHHH
T ss_pred             ccccCCcchhh----hhhhhh---------------hhhhcccceEEEEcccCCCCcccccCcccceecccCCHHHHHhh
Confidence            45778899999    999999               889999 8898877 4 899999999999987    88999999


Q ss_pred             CCCCCCEEEEeeCCEEEEEEeecCCCCCccCCCCceEEEEEEecCCHHHHHHHHhcCCCCccccccccceeEEEEeecCc
Q 006638          168 IAPSPWKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGH  247 (637)
Q Consensus       168 ~a~~~Wkl~~~knGVrIy~~~~~~~~~~~~~s~~~~~Ka~gvV~aspe~VfelL~D~~~~R~eWD~~~~~~~vVE~ID~~  247 (637)
                      .+.++|++..++|||+||++...         +.+.||++++|++||++||++|+|++. |++||+++.++++|+++|++
T Consensus        63 ~~~~gW~~~~~~~gv~Vy~~~~~---------~~l~~k~~~~v~~~~~~v~~~L~D~~~-R~~WD~~~~~~~vle~id~~  132 (258)
T 3fo5_A           63 VAKDNWVLSSEISQVRLYTLEDD---------KFLSFHMEMVVHVDAAQAFLLLSDLRQ-RPEWDKHYRSVELVQQVDED  132 (258)
T ss_dssp             HTCSCCEEEEEETTEEEEEEECS---------SCEEEEEEEEESSCHHHHHHHHHCGGG-GGGTCTTCCEEEEEEEEETT
T ss_pred             hccCCCEEEecCCCeEEEEEECC---------CceEEEEEEEEeCCHHHHHHHHhCchh-HhHhhhhccEEEEEEEcCCC
Confidence            99999999999999999997432         357899999999999999999999984 99999999999999999999


Q ss_pred             eEEEEEEeecCCCCCCCCCceEEEEEEEEEc-CCC-eEEEEEeecCCCCCCCCCCeEEEEEeeeeEEEEeCCCCCceEEE
Q 006638          248 SDVVHKLLYSDWLPWGMQRRDLLVRRYWRRE-DDG-TYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVK  325 (637)
Q Consensus       248 tdIvY~~~~~~~~P~pvs~RDFV~lR~wrr~-~DG-syvI~~~SV~Hp~~Pp~~GyVRaei~~gG~vI~Pl~~~~~~~VT  325 (637)
                       +++|+...+. +.+++++||||++|+||++ .+| .|+|+.+||.||.+||++|||||+++++||+|+|++++ .|+|+
T Consensus       133 -~ivY~~~~p~-~~~~v~~RDFV~lr~~r~~~~~G~~yvi~~~SV~hp~~Pp~~g~VR~~~~~sg~~I~P~~~~-~t~Vt  209 (258)
T 3fo5_A          133 -DAIYHVTSPA-LGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQ-LTKVS  209 (258)
T ss_dssp             -EEEEEEEECC-CTTCSSCEEEEEEEEEECCSSTTCCEEEEEEEEECTTSCCCTTSEECCCSSEEEEEEEEETT-EEEEE
T ss_pred             -eEEEEEecCC-ccCCCCCCEEEEEEEEEeccCCCCEEEEEEEeccCCCCCCCCCCEEEEEcCcEEEEEECCCC-CEEEE
Confidence             6777655543 3368999999999999885 466 49999999999999999999999999999999999765 79999


Q ss_pred             EEEEEeCCCccccccccchhhHHHHHHHHHHHHHHHHHhhcC
Q 006638          326 HMLAVDWKYWKLYLRPSSARSITIRMLERVAALRELFQAKAG  367 (637)
Q Consensus       326 yi~qvDpkGwip~~~~~~~~~i~~~ml~~va~LRe~~~~~~~  367 (637)
                      |++|+|| |.+|.|..++... +..+.+++.+|++++.....
T Consensus       210 Y~~q~dp-G~lP~~~~n~~g~-s~~~~~t~~~~~~fl~~~~~  249 (258)
T 3fo5_A          210 YYNQATP-GVLNYVTTNVAGL-SSEFYTTFKACEQFLLDNRN  249 (258)
T ss_dssp             EEESCCG-GGHHHHHHHHHTS-CCHHHHHHHHHHHHHHHTC-
T ss_pred             EEEeeCC-CCCCceEEecccc-chHHHHHHHHHHHHHHhccc
Confidence            9999999 5599886655332 23356888899999998754

PyMOL of 3fo5

>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens}	Back alignment and structure

>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens}	Back alignment and structure

>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2	Back alignment and structure

>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2	Back alignment and structure

>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2	Back alignment and structure

>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV}	Back alignment and structure

>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A*	Back alignment and structure

>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A*	Back alignment and structure

>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A	Back alignment and structure

>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A	Back alignment and structure

>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens}	Back alignment and structure

>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A	Back alignment and structure

>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens}	Back alignment and structure

>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A	Back alignment and structure

>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A	Back alignment and structure

>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A*	Back alignment and structure

>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A	Back alignment and structure

>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens}	Back alignment and structure

>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A*	Back alignment and structure

>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A	Back alignment and structure

>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A	Back alignment and structure

>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A	Back alignment and structure

>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens}	Back alignment and structure

>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A	Back alignment and structure

>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A	Back alignment and structure

>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A*	Back alignment and structure

>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A	Back alignment and structure

>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus}	Back alignment and structure

>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B	Back alignment and structure

>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A	Back alignment and structure

>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1	Back alignment and structure

>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A*	Back alignment and structure

>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus}	Back alignment and structure

>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens}	Back alignment and structure

>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus}	Back alignment and structure

>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A*	Back alignment and structure

>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus}	Back alignment and structure

>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens}	Back alignment and structure

>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A	Back alignment and structure

>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens}	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1	Back alignment and structure

>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A*	Back alignment and structure

>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A	Back alignment and structure

>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A	Back alignment and structure

>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6	Back alignment and structure

>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6	Back alignment and structure

>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A	Back alignment and structure

>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP}	Back alignment and structure

>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C*	Back alignment and structure

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A*	Back alignment and structure

>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10	Back alignment and structure

>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens}	Back alignment and structure

>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A	Back alignment and structure

>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A	Back alignment and structure

>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1	Back alignment and structure

>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei}	Back alignment and structure

>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10	Back alignment and structure

>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus}	Back alignment and structure

>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A	Back alignment and structure

>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A*	Back alignment and structure

>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A	Back alignment and structure

>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis}	Back alignment and structure

>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus}	Back alignment and structure

>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8	Back alignment and structure

>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca}	Back alignment and structure

>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1	Back alignment and structure

>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens}	Back alignment and structure

>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A	Back alignment and structure

>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A*	Back alignment and structure

>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1	Back alignment and structure

>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A*	Back alignment and structure

>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C	Back alignment and structure

>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens}	Back alignment and structure

>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A	Back alignment and structure

>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A	Back alignment and structure

>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A	Back alignment and structure

>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A	Back alignment and structure

>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana}	Back alignment and structure

>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A*	Back alignment and structure

>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A	Back alignment and structure

>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A	Back alignment and structure

>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1	Back alignment and structure

>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A*	Back alignment and structure

>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A	Back alignment and structure

>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D	Back alignment and structure

>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens}	Back alignment and structure

>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		637
d2psoa1		197	d.129.3.2 (A:908-1104) Star-related lipid transfer	6e-22
d1em2a_		214	d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu	2e-18
d1ln1a_		203	d.129.3.2 (A:) Phosphatidylcholine transfer protei	3e-16
d1jssa_		199	d.129.3.2 (A:) Cholesterol-regulated Start protein	8e-14
d1upqa_		107	b.55.1.1 (A:) Phosphoinositol 3-phosphate binding	2e-06
d1x1ga1		116	b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie	2e-05
d1eaza_		103	b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId:	5e-05
d2elba2		101	b.55.1.1 (A:274-374) DCC-interacting protein 13-al	9e-05
d1droa_		122	b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila	1e-04
d2i5fa1		104	b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie	1e-04
d2coca1		99	b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont	2e-04
d2dyna_		111	b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId	3e-04
d1u5ea1		209	b.55.1.1 (A:14-222) Src-associated adaptor protein	3e-04
d1v5ua_		117	b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M	4e-04
d1faoa_		100	b.55.1.1 (A:) Dual adaptor of phosphotyrosine and	5e-04
d1fgya_		127	b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1	8e-04
d1v89a_		118	b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI	0.001
d1plsa_		113	b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta	0.001
d1btna_		106	b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus),	0.002
d1u5da1		106	b.55.1.1 (A:108-213) Src kinase-associated phospho	0.003
d1v61a_		132	b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M	0.003
d1unqa_		118	b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H	0.004

>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: STAR domain
domain: Star-related lipid transfer protein 13
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.0 bits (228), Expect = 6e-22
 Identities = 43/197 (21%), Positives = 71/197 (36%), Gaps = 26/197 (13%)

Query: 173 WKIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIM--AVGVVDGTSEAIFQTLMSLGSSRSE 230
           W      +   L  +        +  D +P  +  A   V+     +   ++     R  
Sbjct: 21  WVTCSSTDNTDLAFK--------KVGDGNPLKLWKASVEVEAPPSVVLNRVLR---ERHL 69

Query: 231 WDFCFYRGCVVEHLDGHSDVVHKLLYSDWLPWGMQRRDLLVRRYWRR-EDDGTYVILYHS 289
           WD  F +  VVE LD  +++     Y          RD +V R W+     G   ++  S
Sbjct: 70  WDEDFVQWKVVETLDRQTEIYQ---YVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLS 126

Query: 290 VNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHMLAVDWKYW--KLYLRPSSARSI 347
           V H++     G VRA +    ++I P   GK S + H+  +D K    + Y      +  
Sbjct: 127 VEHEEAQL-LGGVRAVVMDSQYLIEPCGSGK-SRLTHICRIDLKGHSPEWYS-----KGF 179

Query: 348 TIRMLERVAALRELFQA 364
                  VA +R  FQ 
Sbjct: 180 GHLCAAEVARIRNSFQP 196

PyMOL of d2psoa1

>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214	Back information, alignment and structure

>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203	Back information, alignment and structure

>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Length = 199	Back information, alignment and structure

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107	Back information, alignment and structure

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116	Back information, alignment and structure

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101	Back information, alignment and structure

>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122	Back information, alignment and structure

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104	Back information, alignment and structure

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111	Back information, alignment and structure

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209	Back information, alignment and structure

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117	Back information, alignment and structure

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100	Back information, alignment and structure

>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127	Back information, alignment and structure

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118	Back information, alignment and structure

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113	Back information, alignment and structure

>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106	Back information, alignment and structure

>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106	Back information, alignment and structure

>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132	Back information, alignment and structure

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		637
d2psoa1		197	Star-related lipid transfer protein 13 {Human (Hom	99.98
d1jssa_		199	Cholesterol-regulated Start protein 4 (Stard4). {M	99.97
d1em2a_		214	Lipid transport domain of Mln64 {Human (Homo sapie	99.97
d1ln1a_		203	Phosphatidylcholine transfer protein {Human (Homo	99.96
d1v89a_		118	Rho-GTPase-activating protein 25 (KIAA0053) {Human	98.96
d2fjla1		101	Phosphoinositide phospholipase C, PLC-gamma-1 {Rat	98.9
d1wgqa_		109	FYVE, RhoGEF and PH domain containing protein 6, F	98.83
d2i5fa1		104	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	98.81
d2coda1		102	Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96	98.77
d1wi1a_		126	Calcium-dependent activator protein for secretion,	98.77
d1plsa_		113	Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	98.76
d1faoa_		100	Dual adaptor of phosphotyrosine and 3-phosphoinosi	98.75
d1eaza_		103	Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	98.74
d1upqa_		107	Phosphoinositol 3-phosphate binding protein-1, PEP	98.74
d2dyna_		111	Dynamin {Human (Homo sapiens) [TaxId: 9606]}	98.66
d1v5ua_		117	SET binding factor 1, Sbf1 {Mouse (Mus musculus) [	98.63
d1unqa_		118	Rac-alpha serine/threonine kinase {Human (Homo sap	98.63
d1u5da1		106	Src kinase-associated phosphoprotein SKAP55 (SCAP1	98.62
d1v88a_		130	Oxysterol binding protein-related protein 8 (ORP-8	98.62
d2coaa1		112	Protein kinase c, d2 type {Human (Homo sapiens) [T	98.61
d1u5fa1		111	Src-associated adaptor protein Skap2 {Mouse (Mus m	98.6
d1omwa2		119	G-protein coupled receptor kinase 2 (beta-adrenerg	98.57
d1wjma_		123	beta-spectrin {Human (Homo sapiens), brain 2 isofo	98.56
d1fgya_		127	Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	98.55
d1v5pa_		126	Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	98.52
d1x1fa1		136	Signal-transducing adaptor protein 1, STAP-1 {Huma	98.5
d2elba2		101	DCC-interacting protein 13-alpha, APPL1 {Human (Ho	98.49
d1btna_		106	beta-spectrin {Mouse (Mus musculus), brain [TaxId:	98.45
d1x1ga1		116	Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	98.44
d1droa_		122	beta-spectrin {Fruit fly (Drosophila melanogaster)	98.42
d1u5ea1		209	Src-associated adaptor protein Skap2 {Mouse (Mus m	98.41
d1wg7a_		150	Dedicator of cytokinesis protein 9, DOCK9 {Human (	98.38
d2coca1		99	FYVE, RhoGEF and PH domain containing protein 3, F	98.34
d2j59m1		133	Rho GTPase-activating protein 21 {Human (Homo sapi	98.32
d1qqga1		103	Insulin receptor substrate 1, IRS-1 {Human (Homo s	98.3
d2cofa1		95	KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	98.29
d1btka_		169	Bruton's tyrosine kinase {Human (Homo sapiens) [Ta	98.27
d1w1ha_		147	3-phosphoinositide dependent protein kinase-1 {Hum	98.07
d2d4ra1		146	Hypothetical protein TTHA0849 {Thermus thermophilu	98.04
d1v5ma_		136	SH2 and PH domain-containing adapter protein APS {	98.04
d2rera1		155	Multifunctional enzyme TcmN, cyclase/aromatase dom	97.87
d2ns9a1		147	Hypothetical protein APE2225 {Aeropyrum pernix [Ta	97.52
d1t17a_		148	Hypothetical protein CC1736 {Caulobacter crescentu	97.32
d1v61a_		132	Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [	97.31
d3cnwa1		138	Uncharacterized protein XoxI {Bacillus cereus [Tax	97.31
d2dfka2		162	Rho guanine nucleotide exchange factor 9, Collybis	97.2
d2pcsa1		147	Hypothetical protein GKP20 {Geobacillus kaustophil	96.95
d2b79a1		137	Hypothetical protein SMU440 {Streptococcus mutans	96.77
d1maia_		119	Phospholipase C delta-1 {Rat (Rattus norvegicus) [	96.44
d1dbha2		133	Son of sevenless-1 (sos-1) {Human (Homo sapiens) [	95.95
d1ntya2		121	Triple functional domain protein TRIO {Human (Homo	95.83
d1kz7a2		147	Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId	95.19
d1zc3b1		109	Exocyst complex protein EXO84 {Rat (Rattus norvegi	94.45
d1xcga2		140	Rho guanine nucleotide exchange factor 11, PDZ-Rho	94.16
d1ki1b2		142	GEF of intersectin {Human (Homo sapiens) [TaxId: 9	90.46
d1fhoa_		119	UNC-89 {Nematode (Caenorhabditis elegans) [TaxId:	86.79
d1txda2		114	Rho guanine nucleotide exchange factor 12 {Human (	86.22
d1vpma_		155	Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta	83.21
d1y7ua1		164	Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId:	82.68

>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: STAR domain
domain: Star-related lipid transfer protein 13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.98  E-value=4.9e-32  Score=262.97  Aligned_cols=176  Identities=23%  Similarity=0.309  Sum_probs=152.0

Q ss_pred             CCCCEEEEeeCCEEEEEEee-cCCCCCccCCCCceEEEEEEecCCHHHHHHHHhcCCCCccccccccceeEEEEeecCce
Q 006638          170 PSPWKIFGCQNGLRLFKEAK-DWDSRGRHWDDHPAIMAVGVVDGTSEAIFQTLMSLGSSRSEWDFCFYRGCVVEHLDGHS  248 (637)
Q Consensus       170 ~~~Wkl~~~knGVrIy~~~~-~~~~~~~~~s~~~~~Ka~gvV~aspe~VfelL~D~~~~R~eWD~~~~~~~vVE~ID~~t  248 (637)
                      ..||++..+++||+||.+.. ++       +..+++|++++|+++|++|+..+++   .|++||+++.++++||++++++
T Consensus        18 ~~GW~~~~~~~gi~V~~kk~~~g-------s~~~~~k~~~~i~a~~~~vl~~~l~---~r~~Wd~~~~~~~~le~~~~~~   87 (197)
T d2psoa1          18 FKGWVTCSSTDNTDLAFKKVGDG-------NPLKLWKASVEVEAPPSVVLNRVLR---ERHLWDEDFVQWKVVETLDRQT   87 (197)
T ss_dssp             CCSCEEECCSSSCEEEEECCCSS-------CCCCEEEEEEEESSCHHHHHHHHHH---CGGGTCTTBCCCEEEEEEETTE
T ss_pred             CCCceEEecCCCeEEEEEecCCC-------CCeEEEEEEEEEcCCHHHHHHHHHH---hHHHHhhhhheEEEEEEcCCCC
Confidence            35899999999999966543 42       4679999999999999999977665   4899999999999999999999


Q ss_pred             EEEEEEeecCCCCCCCCCceEEEEEEEEEc-CCCeEEEEEeecCCCCCCCCCCeEEEEEeeeeEEEEeCCCCCceEEEEE
Q 006638          249 DVVHKLLYSDWLPWGMQRRDLLVRRYWRRE-DDGTYVILYHSVNHKKCPKQKGYVRACLKSGGFVITPSNQGKQSIVKHM  327 (637)
Q Consensus       249 dIvY~~~~~~~~P~pvs~RDFV~lR~wrr~-~DGsyvI~~~SV~Hp~~Pp~~GyVRaei~~gG~vI~Pl~~~~~~~VTyi  327 (637)
                      +|+|.+++   .|||+++||||++++|+++ ++|.+++.++|+.||.+|+ +++|||.+..+||+|+|.+++ +|+|||+
T Consensus        88 ~i~y~~~~---~p~pvs~RD~v~~~~~~~~~~~~~~~i~~~Sv~~~~~p~-~~~VR~~~~~~~~~i~p~~~~-~t~vt~~  162 (197)
T d2psoa1          88 EIYQYVLN---SMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQL-LGGVRAVVMDSQYLIEPCGSG-KSRLTHI  162 (197)
T ss_dssp             EEEEEEEC---CSSSCCCEEEEEEEEEESCCGGGCEEEEEEECCCTTCCC-CSSEECCEEEEEEEEEECSTT-CEEEEEE
T ss_pred             EEEEEEcc---CCCcccceeEEEEEEEEEeCCCCEEEEEEEeccccCCCC-CCcEEEEEEeccEEEEECCCC-cEEEEEE
Confidence            99998876   4789999999999999986 6889999999999998776 578999999999999999765 7999999


Q ss_pred             EEEeCCCcccccccc-chhhHHHHHHHHHHHHHHHHHh
Q 006638          328 LAVDWKYWKLYLRPS-SARSITIRMLERVAALRELFQA  364 (637)
Q Consensus       328 ~qvDpkGwip~~~~~-~~~~i~~~ml~~va~LRe~~~~  364 (637)
                      +++|||||+|.|+.+ +.+.    |...+.+||+.|+.
T Consensus       163 ~~~Dp~G~iP~W~~n~~~~~----~~~~~~~lr~~f~~  196 (197)
T d2psoa1         163 CRIDLKGHSPEWYSKGFGHL----CAAEVARIRNSFQP  196 (197)
T ss_dssp             EEECCSSSCTTTTTTHHHHH----HHHHHHHHHHTTSC
T ss_pred             EEECCCCcCchhHHhhhHHH----HHHHHHHHHHhhhC
Confidence            999999999999644 4444    34567889998753

PyMOL of d2psoa1

>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]}	Back information, alignment and structure

>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]}	Back information, alignment and structure

>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]}	Back information, alignment and structure

>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]}	Back information, alignment and structure

>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]}	Back information, alignment and structure

>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}	Back information, alignment and structure

>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure