Citrus Sinensis ID: 006752


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
ccccccccHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHcccccEEEccccccccHHHHHHHHccccccEEEcccccccccHHHHHccccccccEEEcccccccccHHHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccEEEcccccccccccccccccccccccccccccccccHHHHHHccccccEEEcccccccccccccccccccEEEcccccccccHHHHHHHccccccEEEEcccccccccHHHHHcccccccEEEccccccccccHHHccccccccEEEEEccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEccccccccHHHHHHHHHccccEEEcccccccccccccccccccccHHHHHHHHHHccccccccccHHHcccccccHHHHHHccccccccccccccccHHccccc
ccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccEEcccccccccHHHHHHHHcHHHccEEcccccccccHHHHHHHHHHHHccEEEcccccccHHHHHHHHcHHHccEEEcccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHcccEEEcccccccccccHHHccEccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcEcccccccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHHHHHccEEEcccccccHHHHHHHHccHcccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHcHHHHHHHHHccEEEcccccccHHHHHHHHHHHHccEEEcccccccHHHHHHHHccHcccEEEcccccccHHHHHHHcccccccEEEccccccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccHHHHHHccccccccccHHHHHccccHHHHHHHHHcccHccccccccHHHccccc
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIElrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTgmtclkeldlsrcvkVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLqnlsvldlgglpvtDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKmfprlsflnlawtgvtklpnissleclnlsnctidsilegnenkaplakISLAGTTFINEREAFLYIETSLLSFldvsnsslsrFCFLTQMKALEhldlsssmigddSVEMVACVGANlrnlnlsntrfssagvgilaghlpnleilslsgtqiDDYAISYMsmmpslkfidisntdikgmypsgqmnvFFSAYCFMIVYNLFLHAYgyvifpssvLAGFIQQVGAETDLVLSLTALQNLNHLERLnleqtqvsdatlfplstFKELIHLSLrnasltdvslhqlsslskltnlsirdavltnsglgsfkpprslklldlhggwllTEDAILQFCKMHPRIEVWHELSvicpsdqigsngpspsrtSLRASLVkqkqdpmpmshsfLDQRLKYSREELLELQYSSlslarpddsstqdamglr
MERERESELVRLCIEaacqsgesvqkWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIelrgensvdAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTnsglgsfkppRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLvkqkqdpmpmsHSFLDQRLKYSREELLELQysslslarpddsstqdamglr
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSllrhlirrrliFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSlklldlhggwllTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSReellelqysslslARPDDSSTQDAMGLR
********LVRLCIEAACQSG**VQKW******LERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICP***********************************************************************
*****ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHE******************************************QRLKYSREELLELQY*************Q*AMGL*
*********VRLCIEAACQ***********RRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQ*************************PMSHSFLDQRLKYSREELLELQYSSLSL***************
*****ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVI********************************SHSFLDQRLKYSREELLELQYS*******************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYSREELLELQYSSLSLARPDDSSTQDAMGLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query632 2.2.26 [Sep-21-2011]
Q8N1E6418 F-box/LRR-repeat protein yes no 0.452 0.684 0.253 4e-07
Q8BID8400 F-box/LRR-repeat protein yes no 0.452 0.715 0.253 6e-07
Q17R01400 F-box/LRR-repeat protein yes no 0.452 0.715 0.253 6e-07
Q723X5 1775 Internalin-I OS=Listeria no no 0.547 0.194 0.253 8e-07
Q8YA32 1778 Internalin-I OS=Listeria yes no 0.667 0.237 0.235 9e-07
Q8CDU4790 F-box/LRR-repeat protein no no 0.376 0.301 0.241 2e-06
Q8NEE6735 F-box/LRR-repeat protein no no 0.419 0.360 0.259 2e-05
Q9DGB6781 Toll-like receptor 2 type yes no 0.148 0.120 0.376 0.0002
Q8IY45258 Protein AMN1 homolog OS=H no no 0.327 0.802 0.242 0.0002
Q8LB33353 F-box protein At3g58530 O no no 0.200 0.359 0.284 0.0002
>sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 153/331 (46%), Gaps = 45/331 (13%)

Query: 66  NAEAIELRG-----ENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTG-MTCLKE 119
           N E++ L G     +N +   ++  +G+   LR+LN++ C+++T S+L  +   +  L+ 
Sbjct: 91  NIESLNLSGCYNLTDNGLGHAFVQEIGS---LRALNLSLCKQITDSSLGRIAQYLKGLEV 147

Query: 120 LDLSRCVKVTDAGMKHLL-SISTLEKLWLSETGLTAD-GIALLSSLQNLSVLDLGGLPVT 177
           L+L  C  +T+ G+  +   +  L+ L L      +D GI  L+ +   +    G L + 
Sbjct: 148 LELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAA--EGCLGLE 205

Query: 178 DLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFL-NLAWTGVTKLPNISSLECL 236
            L L+  Q LT L    +      +RG   L++   LSF   ++  G+  L ++ SL  L
Sbjct: 206 QLTLQDCQKLTDLSLKHI------SRGLTGLRLLN-LSFCGGISDAGLLHLSHMGSLRSL 258

Query: 237 NLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLD-VSNSSLSRFC 295
           NL +C  D+I +       +  + L+G                 +SF D V + SL+   
Sbjct: 259 NLRSC--DNISDTGIMHLAMGSLRLSGLD---------------VSFCDKVGDQSLA--- 298

Query: 296 FLTQ-MKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSN-TRFSSAGVGILAGHLPNL 353
           ++ Q +  L+ L L S  I DD +  +      LR LN+    R +  G+ ++A HL  L
Sbjct: 299 YIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQL 358

Query: 354 EILSLSG-TQIDDYAISYMSMMPSLKFIDIS 383
             + L G T+I    +  ++ +P LK +++ 
Sbjct: 359 TGIDLYGCTRITKRGLERITQLPCLKVLNLG 389




Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin-protein ligase complexes. The SCF(FBXL14) complex acts by mediating ubiquitination and subsequent degradation of SNAI1.
Homo sapiens (taxid: 9606)
>sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 Back     alignment and function description
>sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 Back     alignment and function description
>sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 Back     alignment and function description
>sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=4 SV=1 Back     alignment and function description
>sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|Q9DGB6|TLR22_CHICK Toll-like receptor 2 type-2 OS=Gallus gallus GN=TLR2-2 PE=2 SV=1 Back     alignment and function description
>sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 Back     alignment and function description
>sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
356513289589 PREDICTED: uncharacterized protein LOC10 0.914 0.981 0.609 0.0
297742329588 unnamed protein product [Vitis vinifera] 0.895 0.962 0.593 0.0
255537779597 protein binding protein, putative [Ricin 0.905 0.958 0.623 0.0
225426352598 PREDICTED: uncharacterized protein LOC10 0.895 0.946 0.586 0.0
449464060586 PREDICTED: uncharacterized protein LOC10 0.920 0.993 0.545 1e-177
297803756590 hypothetical protein ARALYDRAFT_492485 [ 0.898 0.962 0.508 1e-153
186701224600 leucine-rich repeat family protein [Arab 0.916 0.965 0.513 1e-150
42567079597 leucine-rich repeat-containing protein [ 0.911 0.964 0.497 1e-143
326513166627 predicted protein [Hordeum vulgare subsp 0.895 0.902 0.478 1e-140
218196286601 hypothetical protein OsI_18882 [Oryza sa 0.900 0.946 0.475 1e-139
>gi|356513289|ref|XP_003525346.1| PREDICTED: uncharacterized protein LOC100814174 [Glycine max] Back     alignment and taxonomy information
 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/620 (60%), Positives = 474/620 (76%), Gaps = 42/620 (6%)

Query: 4   ERESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVF 63
           + ESELV  CIEAAC+S ESV KWR Q RSL+RLP+HLADSLLR LI RRL++PSLLEVF
Sbjct: 2   KSESELVGFCIEAACESRESVDKWRMQSRSLDRLPSHLADSLLRRLIARRLLYPSLLEVF 61

Query: 64  KHNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLS 123
           KH+AE +++RG+NSVDAEWMAYLGA+R+LR LN++DC RV++SALW +TGM+ L+ELDLS
Sbjct: 62  KHSAEEVDVRGDNSVDAEWMAYLGAYRHLRYLNLSDCHRVSTSALWPITGMSSLQELDLS 121

Query: 124 RCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRS 183
           RC KV DAG+ H+LSI  LE+L +SET +TA G+ LL+SL+NLS+LDLGGLPV D+ L S
Sbjct: 122 RCFKVNDAGINHILSIPNLERLRISETSVTAKGVKLLASLKNLSLLDLGGLPVDDVALTS 181

Query: 184 LQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTI 243
           LQVL +L Y+DLWGS++SN+GA+VL  FP+L++LNLAWT VTKLP +S LE LN+SNCTI
Sbjct: 182 LQVLKRLHYIDLWGSKISNKGASVLNTFPKLTYLNLAWTSVTKLPKLSFLEYLNMSNCTI 241

Query: 244 DSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKAL 303
           DSILE  ++KAPLAK+ L+G  F+NE EA LY  T+ LSFLDV+NSS  RF FL++MK +
Sbjct: 242 DSILE--DDKAPLAKLILSGAMFMNEAEALLYANTNFLSFLDVANSSFHRFFFLSKMKVI 299

Query: 304 EHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQI 363
           EHL+LSS M+GDDSVEMVAC G NL++LNLS TR SSAG+GILAGH+P+LEILSLS T +
Sbjct: 300 EHLNLSSCMMGDDSVEMVACAGGNLKSLNLSGTRVSSAGLGILAGHVPHLEILSLSQTPV 359

Query: 364 DDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPS 423
           DD AIS++SMMPSLK +D+SNT+IKG                                  
Sbjct: 360 DDTAISFISMMPSLKDVDLSNTNIKG---------------------------------- 385

Query: 424 SVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRN 483
                F+ Q   + + +LSL ALQNL  LERLNLE TQV D  L+PLS+F+EL +LSL++
Sbjct: 386 -----FLHQGRTDVNSLLSLMALQNLK-LERLNLEHTQVRDEALYPLSSFQELRYLSLKS 439

Query: 484 ASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGWLLTEDAILQF 543
           ASL D+SL+ LSS+ KLTNLSI DAVLTN GL  FK P +LKLLDL G WLLTED IL F
Sbjct: 440 ASLADISLYYLSSIPKLTNLSICDAVLTNYGLDMFKAPETLKLLDLKGCWLLTEDTILSF 499

Query: 544 CKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASLVKQKQDPMPMSHSFLDQRLKYS 603
           C+ HP++EV HEL  + P +Q G N  SPSR++ +   + +K+D +P+S  F+DQRLKYS
Sbjct: 500 CRNHPQVEVRHELGTLFPVNQNGLNHSSPSRSTSKTMQMTKKKDQIPLSPYFVDQRLKYS 559

Query: 604 REELLELQYSSLSLARPDDS 623
           R+ELL LQ++SL LA   +S
Sbjct: 560 RDELLALQFTSLPLASSSES 579




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297742329|emb|CBI34478.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537779|ref|XP_002509956.1| protein binding protein, putative [Ricinus communis] gi|223549855|gb|EEF51343.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225426352|ref|XP_002266070.1| PREDICTED: uncharacterized protein LOC100261612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449464060|ref|XP_004149747.1| PREDICTED: uncharacterized protein LOC101203036 [Cucumis sativus] gi|449505065|ref|XP_004162366.1| PREDICTED: uncharacterized protein LOC101225004 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297803756|ref|XP_002869762.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] gi|297315598|gb|EFH46021.1| hypothetical protein ARALYDRAFT_492485 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|186701224|gb|ACC91251.1| leucine-rich repeat family protein [Arabidopsis halleri] Back     alignment and taxonomy information
>gi|42567079|ref|NP_194115.3| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|20466546|gb|AAM20590.1| unknown protein [Arabidopsis thaliana] gi|22136448|gb|AAM91302.1| unknown protein [Arabidopsis thaliana] gi|51971383|dbj|BAD44356.1| putative protein [Arabidopsis thaliana] gi|332659411|gb|AEE84811.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|326513166|dbj|BAK06823.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|218196286|gb|EEC78713.1| hypothetical protein OsI_18882 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
TAIR|locus:2138131597 AT4G23840 "AT4G23840" [Arabido 0.780 0.825 0.472 3.2e-113
TAIR|locus:2036199585 AT1G15740 [Arabidopsis thalian 0.492 0.531 0.269 1e-17
DICTYBASE|DDB_G0291424902 DDB_G0291424 "Transcription fa 0.498 0.349 0.236 2.6e-10
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.607 0.401 0.252 1.6e-09
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.639 0.410 0.247 3.6e-09
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.443 0.258 0.261 4e-09
ZFIN|ZDB-GENE-030131-5920411 fbxl14a "F-box and leucine-ric 0.449 0.690 0.266 6.5e-09
UNIPROTKB|Q17R01400 FBXL14 "F-box/LRR-repeat prote 0.452 0.715 0.266 1.3e-08
MGI|MGI:2141676400 Fbxl14 "F-box and leucine-rich 0.452 0.715 0.266 1.3e-08
RGD|1305523400 Fbxl14 "F-box and leucine-rich 0.452 0.715 0.266 1.3e-08
TAIR|locus:2138131 AT4G23840 "AT4G23840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1117 (398.3 bits), Expect = 3.2e-113, P = 3.2e-113
 Identities = 243/514 (47%), Positives = 332/514 (64%)

Query:     6 ESELVRLCIEAACQSGESVQKWRRQRRSLERLPAHLADSXXXXXXXXXXXFPSLLEVFKH 65
             ES LVRLC++ AC+SG++V++WR QRRSLE LP HLAD+           FPSLLE FK+
Sbjct:     2 ESPLVRLCLKEACKSGDAVERWRLQRRSLESLPPHLADALLRRLLKKRLLFPSLLEGFKY 61

Query:    66 NAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRC 125
             + E I+LRG++SV+AEWMAY+G F  L +LN++DC+R+ SS LW +TG+T L ELDLSRC
Sbjct:    62 SVENIDLRGKSSVNAEWMAYIGGFVNLITLNLSDCQRINSSTLWPITGLTSLTELDLSRC 121

Query:   126 VKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQ 185
              KVTDAGMKHL S+  L+KLW+S+TG+T  GI+LL+SL+ LS+LDLGGLPVTD  L SLQ
Sbjct:   122 FKVTDAGMKHLQSVVNLKKLWISQTGVTEVGISLLASLKKLSLLDLGGLPVTDQNLISLQ 181

Query:   186 VLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDS 245
              LTKLEYLD+WGS V+N+GA  +  F  LSFLNL+WT +T+ PNI  LECL+++ CTI S
Sbjct:   182 ALTKLEYLDIWGSNVTNQGAVSILKFSNLSFLNLSWTSITQTPNIPHLECLHMNTCTIVS 241

Query:   246 ILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEH 305
               + + + A L K+ L+G  F  E E+  +   S +++LDVS +SL  F FL  M  LEH
Sbjct:   242 EPKTHSSLASLKKLVLSGANFSAETESLSFTNKSCITYLDVSKTSLKNFSFLETMFNLEH 301

Query:   306 LDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDD 365
             LDLSS+  GDDSV  VACVG NL+NLN+S+T+ + +GVG LAGH+P LE LS+S T +DD
Sbjct:   302 LDLSSTAFGDDSVGFVACVGENLKNLNVSDTQITPSGVGNLAGHVPQLETLSMSQTFVDD 361

Query:   366 YAISYMSM-MPSLKFIDISNTDIKGMYP--SGQMNVFFSAYCFMIVYNLFLHAYGYVIFP 422
              +I  +S  MP +K +D+      G Y   S Q     S      + +L   +  +    
Sbjct:   362 LSILLISTTMPCIKALDLGMNSTLGFYYLISPQEEKEKSLAALQSLTSLETLSLEHPYLG 421

Query:   423 SSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLR 482
                L+G              L++L  L HL   +L  T ++D+TL  LS+   L+ L +R
Sbjct:   422 DKALSG--------------LSSLTGLTHL---SLTSTSLTDSTLHHLSSLPNLVSLGVR 464

Query:   483 NASLTDVSLHQLSSLSKLTNLSIRDA-VLTNSGL 515
             +  LT   L +    ++L  L ++   +LT   +
Sbjct:   465 DGVLTSNGLEKFRPPNRLRTLDLQGCWLLTKDDI 498


GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2036199 AT1G15740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291424 DDB_G0291424 "Transcription factor SKN7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5920 fbxl14a "F-box and leucine-rich repeat protein 14a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R01 FBXL14 "F-box/LRR-repeat protein 14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2141676 Fbxl14 "F-box and leucine-rich repeat protein 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305523 Fbxl14 "F-box and leucine-rich repeat protein 14" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score = 54.3 bits (131), Expect = 7e-08
 Identities = 65/278 (23%), Positives = 106/278 (38%), Gaps = 53/278 (19%)

Query: 92  LRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTD--AGMKHLLSISTLEKLWLSE 149
           L         R   S L  LT    L+ELDLS      D    ++ LL  S+L++L L+ 
Sbjct: 58  LSLNETGRIPRGLQSLLQGLTKGCGLQELDLSDNALGPDGCGVLESLLRSSSLQELKLNN 117

Query: 150 TGLTADGI-----ALLSSLQNLSVLDLGGLPVTDLVLRS----LQVLTKLEYLDLWGSQV 200
            GL   G+      L      L  L LG   +      +    L+    L+ L+L  + +
Sbjct: 118 NGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGI 177

Query: 201 SNRGAAVL----KMFPRLSFLNLAWTGVTK---------LPNISSLECLNLSNCTIDSIL 247
            + G   L    K    L  L+L   G+T          L ++ SLE LNL +  +    
Sbjct: 178 GDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTD-- 235

Query: 248 EGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSR-----FC-FLTQMK 301
                 A  A ++           A L    SLL+ L +S + ++          L + +
Sbjct: 236 ------AGAAALA----------SALLSPNISLLT-LSLSCNDITDDGAKDLAEVLAEKE 278

Query: 302 ALEHLDLSSSMIGDDSVEMVA----CVGANLRNLNLSN 335
           +L  LDL  +  G++  +++A      G  L +L + +
Sbjct: 279 SLLELDLRGNKFGEEGAQLLAESLLEPGNELESLWVKD 316


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 632
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG4341483 consensus F-box protein containing LRR [General fu 99.45
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.41
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.39
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.29
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
PLN03150623 hypothetical protein; Provisional 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
PLN03150623 hypothetical protein; Provisional 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.44
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.44
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.35
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.15
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.97
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
KOG4308478 consensus LRR-containing protein [Function unknown 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.51
PRK15386426 type III secretion protein GogB; Provisional 97.46
KOG4308478 consensus LRR-containing protein [Function unknown 97.42
PRK15386426 type III secretion protein GogB; Provisional 97.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.57
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.01
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.54
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.94
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.12
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.3
smart0037026 LRR Leucine-rich repeats, outliers. 89.3
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.83
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.03
smart0037026 LRR Leucine-rich repeats, outliers. 87.03
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 87.01
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 85.79
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.42
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.37
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-49  Score=461.03  Aligned_cols=505  Identities=19%  Similarity=0.191  Sum_probs=382.2

Q ss_pred             CcccEEeccCCCCCCHHHHHHhccCCCccEEEcCCCCCCCchhHHh-hhCCCCcCEEeccCCCCCChhhHhhhcCCCCcc
Q 006752           65 HNAEAIELRGENSVDAEWMAYLGAFRYLRSLNVADCRRVTSSALWA-LTGMTCLKELDLSRCVKVTDAGMKHLLSISTLE  143 (632)
Q Consensus        65 ~~l~~L~Ls~~~~~~~~~~~~~~~~~~L~~L~L~~~~~i~~~~~~~-l~~l~~L~~L~L~~~~~l~~~~~~~l~~l~~L~  143 (632)
                      .+++.|+|++| .+.+..+..|..+++|++|+|++|. +++..+.. +.++++|++|++++| .+++..+.  +.+++|+
T Consensus        69 ~~v~~L~L~~~-~i~~~~~~~~~~l~~L~~L~Ls~n~-~~~~ip~~~~~~l~~L~~L~Ls~n-~l~~~~p~--~~l~~L~  143 (968)
T PLN00113         69 SRVVSIDLSGK-NISGKISSAIFRLPYIQTINLSNNQ-LSGPIPDDIFTTSSSLRYLNLSNN-NFTGSIPR--GSIPNLE  143 (968)
T ss_pred             CcEEEEEecCC-CccccCChHHhCCCCCCEEECCCCc-cCCcCChHHhccCCCCCEEECcCC-ccccccCc--cccCCCC
Confidence            46899999998 4666667888999999999999998 66444444 458999999999998 55543332  4688999


Q ss_pred             EEEccCCCCCHhHHHHhcCCCCCCEEEcCCCCCChHHHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCcEEEccCCC
Q 006752          144 KLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTG  223 (632)
Q Consensus       144 ~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~  223 (632)
                      +|++++|.+++..|..+..+++|++|++++|.+.+..|..++++++|++|++++|.+.+..|..+..+++|++|++++|.
T Consensus       144 ~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  223 (968)
T PLN00113        144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN  223 (968)
T ss_pred             EEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCc
Confidence            99999999988888889999999999999999988888899999999999999999998899999999999999999998


Q ss_pred             CCC-----CCCCCCCCEEECCCCccc-chhccccCCCCCcEEEeeCCCCCchhhhhhhhcCCCccEEeccCCCCCch--h
Q 006752          224 VTK-----LPNISSLECLNLSNCTID-SILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRF--C  295 (632)
Q Consensus       224 l~~-----l~~l~~L~~L~L~~~~l~-~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~--~  295 (632)
                      +.+     +.++++|++|++++|.+. .+|..+..+++|++|++++|.+.+..+. .+..+++|++|++++|.+.+.  .
T Consensus       224 l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~Ls~n~l~~~~p~  302 (968)
T PLN00113        224 LSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP-SIFSLQKLISLDLSDNSLSGEIPE  302 (968)
T ss_pred             cCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch-hHhhccCcCEEECcCCeeccCCCh
Confidence            774     457899999999999987 6777888999999999999988764332 345789999999999998765  5


Q ss_pred             hhhcCCCCCeeeccCCCCCchHHHHHHhcCCCCcEEEccCCcCcchhHHHHHhcCCCCcEEEccCCCCChHHHHHHhcCC
Q 006752          296 FLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMP  375 (632)
Q Consensus       296 ~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~  375 (632)
                      .+..+++|++|++++|.+.+..|..+..+ ++|+.|++++|.+++..+..+ +.+++|+.|++++|++++..|..+..++
T Consensus       303 ~~~~l~~L~~L~l~~n~~~~~~~~~~~~l-~~L~~L~L~~n~l~~~~p~~l-~~~~~L~~L~Ls~n~l~~~~p~~~~~~~  380 (968)
T PLN00113        303 LVIQLQNLEILHLFSNNFTGKIPVALTSL-PRLQVLQLWSNKFSGEIPKNL-GKHNNLTVLDLSTNNLTGEIPEGLCSSG  380 (968)
T ss_pred             hHcCCCCCcEEECCCCccCCcCChhHhcC-CCCCEEECcCCCCcCcCChHH-hCCCCCcEEECCCCeeEeeCChhHhCcC
Confidence            67888999999999999998888888877 899999999999988877776 6789999999999999988888898899


Q ss_pred             CccEEEccCCccccccCCCccchhhhhhhhhhhhhceeccccccccccccccchhhhccccccccc--chHHhhcCCccc
Q 006752          376 SLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVL--SLTALQNLNHLE  453 (632)
Q Consensus       376 ~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~--~~~~l~~l~~L~  453 (632)
                      +|+.|++++|++.+.+|..+..+                             ..++.+++++|.+.  ....+.++++|+
T Consensus       381 ~L~~L~l~~n~l~~~~p~~~~~~-----------------------------~~L~~L~L~~n~l~~~~p~~~~~l~~L~  431 (968)
T PLN00113        381 NLFKLILFSNSLEGEIPKSLGAC-----------------------------RSLRRVRLQDNSFSGELPSEFTKLPLVY  431 (968)
T ss_pred             CCCEEECcCCEecccCCHHHhCC-----------------------------CCCCEEECcCCEeeeECChhHhcCCCCC
Confidence            99999999999998877754321                             23444555555442  123566666677


Q ss_pred             ccccCccCCCCCccccccCcccccccccccccCCCcchhhhccCCCCcEEeecCceeccCCCCCCCCCCCcceEecCCCc
Q 006752          454 RLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGGW  533 (632)
Q Consensus       454 ~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~l~~~~~L~~L~l~~N~  533 (632)
                      .|++++|.+++..+..+..+++|+.|++++|++.+..|..+ ..++|+.|++++|++++..|..+..+++|+.|++++|.
T Consensus       432 ~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~  510 (968)
T PLN00113        432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENK  510 (968)
T ss_pred             EEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCc
Confidence            77777777766666666666667777777776666555544 34666677777777666666666666666777777766


Q ss_pred             ccChHHHHHHHHHcCCeeeeeccccccCCCCCCCCCCCCCcchhhhhh------hcccCCCCCCCccchhcccccCHHHH
Q 006752          534 LLTEDAILQFCKMHPRIEVWHELSVICPSDQIGSNGPSPSRTSLRASL------VKQKQDPMPMSHSFLDQRLKYSREEL  607 (632)
Q Consensus       534 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~ip~~~~~~~~~------~n~~~~~~~~~~~~~~~~~~~~~~~~  607 (632)
                      + .+..+..+. ..+       ..+.+++++|+++|.+|..++.+..+      .|+++|.+|.....      .+.++.
T Consensus       511 l-~~~~p~~~~-~l~-------~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~------l~~L~~  575 (968)
T PLN00113        511 L-SGEIPDELS-SCK-------KLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGN------VESLVQ  575 (968)
T ss_pred             c-eeeCChHHc-Ccc-------CCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhc------CcccCE
Confidence            5 222222221 111       12445566677777776666655444      56666643322222      235667


Q ss_pred             HHhhcccccccCCCC
Q 006752          608 LELQYSSLSLARPDD  622 (632)
Q Consensus       608 l~l~~n~l~g~ip~~  622 (632)
                      +++++|+++|.||..
T Consensus       576 l~ls~N~l~~~~p~~  590 (968)
T PLN00113        576 VNISHNHLHGSLPST  590 (968)
T ss_pred             EeccCCcceeeCCCc
Confidence            788888888888854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-05
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 1e-04
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Iteration: 1

Score = 47.4 bits (111), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 95/348 (27%), Positives = 159/348 (45%), Gaps = 77/348 (22%) Query: 155 DGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSN-RGAAVLKMFPR 213 DG+ L+ NL+ ++ +TD+ L+ LTKL + + +Q+++ A L Sbjct: 57 DGVEYLN---NLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIADITPLANLTNLTG 111 Query: 214 LSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAPLAKISLAGTTFINEREAF 273 L+ N T + L N+++L L LS+ TI I +L+G T + + Sbjct: 112 LTLFNNQITDIDPLKNLTNLNRLELSSNTISDI------------SALSGLTSLQQ---- 155 Query: 274 LYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNL 333 LSF S++ ++ L + LE LD+SS+ + D SV +A + NL +L Sbjct: 156 -------LSF---SSNQVTDLKPLANLTTLERLDISSNKVSDISV--LAKL-TNLESLIA 202 Query: 334 SNTRFSS-AGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYP 392 +N + S +GIL NL+ LSL+G Q+ D I ++ + +L +D++N I + P Sbjct: 203 TNNQISDITPLGILT----NLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAP 256 Query: 393 SGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHL 452 S + L + + S LAG LTAL NL Sbjct: 257 -------LSGLTKLTELKLGANQISNI----SPLAG--------------LTALTNLE-- 289 Query: 453 ERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKL 500 L + Q+ D + P+S K L +L+L +++D+S +SSL+KL Sbjct: 290 ----LNENQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKL 329
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-29
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-27
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-22
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-17
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-14
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-13
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-16
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
 Score =  121 bits (304), Expect = 4e-29
 Identities = 79/575 (13%), Positives = 169/575 (29%), Gaps = 85/575 (14%)

Query: 23  SVQKWRRQRRSLERLPAHLADSLLRHLIRRRLIFPSLLEVFKHNAEAIELRGENSVDAEW 82
            +    R+  ++        D L R      L    L    +     +           W
Sbjct: 46  KIDSETREHVTMALCYTATPDRLSRRF--PNLRSLKLKGKPRAAMFNLIPENWGGYVTPW 103

Query: 83  MAYLGA-FRYLRSLNVADCRRVTSSALWALTGMTC--LKELDLSRCVKVTDAGMKHLLSI 139
           +  +    R L+S++      V+   L  L       L+ L L +C   T  G+  +++ 
Sbjct: 104 VTEISNNLRQLKSVHFRRMI-VSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTH 162

Query: 140 -STLEKLWLSETGLTADGIALLS-------SLQNLSVLDLGGLPVTDLVLRSL-QVLTKL 190
              ++ L + E+  +      L        SL+ L+        ++   L ++ +    L
Sbjct: 163 CRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSL 222

Query: 191 EYLDLWGSQVSNRGAAVLKMFPRLSFLNL--------AWTGVTKLPNISSLECLNLSNCT 242
             + +   ++        K    L                    L     L  L LS   
Sbjct: 223 VSVKVGDFEILE-LVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMG 281

Query: 243 IDSILEGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKA 302
            + +       A + K+ L       E                           + +   
Sbjct: 282 PNEMPILFPFAAQIRKLDLLYALLETE----------------------DHCTLIQKCPN 319

Query: 303 LEHLDLSSSMIGDDSVEMVACVGANLRNLNLSN-----------TRFSSAGVGILAGHLP 351
           LE L+  +  IGD  +E++A     L+ L +                S  G+  LA    
Sbjct: 320 LEVLETRNV-IGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQ 378

Query: 352 NLEILSLSGTQIDDYAISYMS----MMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMI 407
            LE +++  + I + ++  +      +   + + +   +     P           C  +
Sbjct: 379 ELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKL 438

Query: 408 VYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATL 467
                 +     +                TDL LS    Q   ++  + L     SD  L
Sbjct: 439 R-RFAFYLRQGGL----------------TDLGLSYIG-QYSPNVRWMLLGYVGESDEGL 480

Query: 468 FPLSTF-KELIHLSLRNASLTDVSLHQL-SSLSKLTNLSIRDAVLTNSGLGSF---KPPR 522
              S     L  L +R    ++ ++    + L  L  L ++    + +G       +P  
Sbjct: 481 MEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYW 540

Query: 523 SLKLLDLHGGWLLTEDAILQFCKMHPRIEVWHELS 557
           +++L+       + +   ++  +    I  ++ L+
Sbjct: 541 NIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLA 575


>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.98
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.85
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.51
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-56  Score=503.05  Aligned_cols=439  Identities=20%  Similarity=0.210  Sum_probs=320.4

Q ss_pred             cCcccEEeccCCCCCCHHHHH--HhccCCCccEEEcCCCCCCCchhHHhh-hCCCCcCEEeccCCCCCChhhHhh---hc
Q 006752           64 KHNAEAIELRGENSVDAEWMA--YLGAFRYLRSLNVADCRRVTSSALWAL-TGMTCLKELDLSRCVKVTDAGMKH---LL  137 (632)
Q Consensus        64 ~~~l~~L~Ls~~~~~~~~~~~--~~~~~~~L~~L~L~~~~~i~~~~~~~l-~~l~~L~~L~L~~~~~l~~~~~~~---l~  137 (632)
                      +++|++|+|++|. +.+.++.  .++++++|++|++++|. +....+..+ .++++|++|++++| .+++..+..   +.
T Consensus        99 l~~L~~L~Ls~n~-l~~~~~~~~~l~~l~~L~~L~Ls~n~-l~~~~~~~~~~~l~~L~~L~Ls~n-~l~~~~~~~~~~~~  175 (768)
T 3rgz_A           99 SASLTSLDLSRNS-LSGPVTTLTSLGSCSGLKFLNVSSNT-LDFPGKVSGGLKLNSLEVLDLSAN-SISGANVVGWVLSD  175 (768)
T ss_dssp             CTTCCEEECCSSE-EEEEGGGGGGGGGCTTCCEEECCSSE-EECCSSCCSCCCCTTCSEEECCSS-CCEEETHHHHHHTT
T ss_pred             CCCCCEEECCCCc-CCCcCCChHHHhCCCCCCEEECcCCc-cCCcCCHHHhccCCCCCEEECCCC-ccCCcCChhhhhhc
Confidence            4688999999884 5555555  78889999999999887 554444444 68889999999998 676665555   67


Q ss_pred             CCCCccEEEccCCCCCHhHHHHhcCCCCCCEEEcCCCCCChHHHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCcEE
Q 006752          138 SISTLEKLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFL  217 (632)
Q Consensus       138 ~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L  217 (632)
                      ++++|++|++++|.+++..+  +..+++|++|++++|.+.+..|. ++.+++|++|++++|.+++..|..+..+++|++|
T Consensus       176 ~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L  252 (768)
T 3rgz_A          176 GCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLL  252 (768)
T ss_dssp             CCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEE
T ss_pred             cCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEE
Confidence            88999999999998876443  37889999999999999887665 8999999999999999999999999999999999


Q ss_pred             EccCCCCCC-CC--CCCCCCEEECCCCccc-chhccccC-CCCCcEEEeeCCCCCchhhhhhhhcCCCccEEeccCCCCC
Q 006752          218 NLAWTGVTK-LP--NISSLECLNLSNCTID-SILEGNEN-KAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLS  292 (632)
Q Consensus       218 ~l~~n~l~~-l~--~l~~L~~L~L~~~~l~-~~~~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~  292 (632)
                      ++++|.+.+ ++  .+++|++|++++|.+. .+|..++. +++|++|++++|.+.+..+. .+..+++|++|++++|.+.
T Consensus       253 ~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~  331 (768)
T 3rgz_A          253 NISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP-FFGSCSLLESLALSSNNFS  331 (768)
T ss_dssp             ECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCG-GGGGCTTCCEEECCSSEEE
T ss_pred             ECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccch-HHhcCCCccEEECCCCccc
Confidence            999998874 22  6789999999999998 78888776 49999999999998864433 3568999999999999987


Q ss_pred             ch---hhhhcCCCCCeeeccCCCCCchHHHHHHhcCCCCcEEEccCCcCcchhHHHHHh-cCCCCcEEEccCCCCChHHH
Q 006752          293 RF---CFLTQMKALEHLDLSSSMIGDDSVEMVACVGANLRNLNLSNTRFSSAGVGILAG-HLPNLEILSLSGTQIDDYAI  368 (632)
Q Consensus       293 ~~---~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~-~~~~L~~L~L~~n~l~~~~~  368 (632)
                      +.   ..+..+++|++|++++|.+++..|..+....++|++|++++|++++..+..+.. .+++|++|++++|++++..|
T Consensus       332 ~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p  411 (768)
T 3rgz_A          332 GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP  411 (768)
T ss_dssp             EECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECC
T ss_pred             CcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccC
Confidence            43   348899999999999999988888888877349999999999998876655422 16789999999999998888


Q ss_pred             HHHhcCCCccEEEccCCccccccCCCccchhhhhhhhhhhhhceecccccc-cccccc-ccchhhhccccccccc--chH
Q 006752          369 SYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYV-IFPSSV-LAGFIQQVGAETDLVL--SLT  444 (632)
Q Consensus       369 ~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~-~~~~l~~l~~~~~~l~--~~~  444 (632)
                      ..++.+++|++|++++|++++.+|..+..+. .+      ..+........ .+|... ....++.|++++|.+.  ...
T Consensus       412 ~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-~L------~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~  484 (768)
T 3rgz_A          412 PTLSNCSELVSLHLSFNYLSGTIPSSLGSLS-KL------RDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPS  484 (768)
T ss_dssp             GGGGGCTTCCEEECCSSEEESCCCGGGGGCT-TC------CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG
T ss_pred             HHHhcCCCCCEEECcCCcccCcccHHHhcCC-CC------CEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCH
Confidence            8999999999999999999988887654321 11      11111111111 122221 1233445555555442  123


Q ss_pred             HhhcCCcccccccCccCCCCCccccccCcccccccccccccCCCcchhhhccCCCCcEEeecCceeccCCCC
Q 006752          445 ALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLTDVSLHQLSSLSKLTNLSIRDAVLTNSGLG  516 (632)
Q Consensus       445 ~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~  516 (632)
                      .+.++++|++|++++|++++.+|.+++.+++|++|+|++|++++.+|..+..+++|++|++++|++++.+|.
T Consensus       485 ~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~  556 (768)
T 3rgz_A          485 GLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA  556 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCG
T ss_pred             HHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCCh
Confidence            455555555555555555555555555555555555555555555555555555555555555555555444



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 632
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 62.3 bits (150), Expect = 6e-11
 Identities = 57/381 (14%), Positives = 130/381 (34%), Gaps = 41/381 (10%)

Query: 144 KLWLSETGLTADGIALLSSLQNLSVLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNR 203
           K  L +T +T       + L  ++ L    L +    +  ++ L  L  ++   +Q++  
Sbjct: 26  KTVLGKTNVT--DTVSQTDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLT-- 79

Query: 204 GAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSILEGNENKAP-------- 255
               LK   +L  + +    +  +  +++L  L       + I + +  K          
Sbjct: 80  DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLEL 139

Query: 256 ----LAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSS 311
               ++ IS        ++ +F    T L    +++                    L++ 
Sbjct: 140 SSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL 199

Query: 312 MIGDDSVEMVA-----CVGANLRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDY 366
                +   ++      +  NL  L+L+  +    G       L NL  L L+  QI + 
Sbjct: 200 ESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGT---LASLTNLTDLDLANNQISN- 255

Query: 367 AISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMIVYNLFLHAYGYVIFPSSVL 426
            ++ +S +  L  + +    I  + P   +    +                        L
Sbjct: 256 -LAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTL 314

Query: 427 AGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASL 486
                      + +  ++ + +L  L+RL     +VSD  +  L+    +  LS  +  +
Sbjct: 315 YF---------NNISDISPVSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQI 363

Query: 487 TDVSLHQLSSLSKLTNLSIRD 507
           +D  L  L++L+++T L + D
Sbjct: 364 SD--LTPLANLTRITQLGLND 382


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.02
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=8.2e-28  Score=246.89  Aligned_cols=342  Identities=22%  Similarity=0.298  Sum_probs=203.8

Q ss_pred             cCCCccEEEcCCCCCCCchhHHhhhCCCCcCEEeccCCCCCChhhHhhhcCCCCccEEEccCCCCCHhHHHHhcCCCCCC
Q 006752           88 AFRYLRSLNVADCRRVTSSALWALTGMTCLKELDLSRCVKVTDAGMKHLLSISTLEKLWLSETGLTADGIALLSSLQNLS  167 (632)
Q Consensus        88 ~~~~L~~L~L~~~~~i~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~  167 (632)
                      .+.+|++|++++++ |++.  ..+..+++|++|++++| .+++..  .++++++|++|++++|++.+..  .+..+++|+
T Consensus        42 ~l~~l~~L~l~~~~-I~~l--~gl~~L~nL~~L~Ls~N-~l~~l~--~l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~  113 (384)
T d2omza2          42 DLDQVTTLQADRLG-IKSI--DGVEYLNNLTQINFSNN-QLTDIT--PLKNLTKLVDILMNNNQIADIT--PLANLTNLT  113 (384)
T ss_dssp             HHTTCCEEECCSSC-CCCC--TTGGGCTTCCEEECCSS-CCCCCG--GGTTCTTCCEEECCSSCCCCCG--GGTTCTTCC
T ss_pred             HhCCCCEEECCCCC-CCCc--cccccCCCCCEEeCcCC-cCCCCc--cccCCccccccccccccccccc--ccccccccc
Confidence            44567888888776 6542  35667788888888887 566543  3777788888888888776543  367777788


Q ss_pred             EEEcCCCCCChHHHHhccCCCCccEEEecCCCCCchhhHhhcCCCCCcEEEccCCCCCCCCCCCCCCEEECCCCcccchh
Q 006752          168 VLDLGGLPVTDLVLRSLQVLTKLEYLDLWGSQVSNRGAAVLKMFPRLSFLNLAWTGVTKLPNISSLECLNLSNCTIDSIL  247 (632)
Q Consensus       168 ~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~l~~l~~L~~L~L~~~~l~~~~  247 (632)
                      .|+++++.+++..  .......+.......+.+....+.....................+.............+.... .
T Consensus       114 ~L~~~~~~~~~~~--~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~  190 (384)
T d2omza2         114 GLTLFNNQITDID--PLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSD-I  190 (384)
T ss_dssp             EEECCSSCCCCCG--GGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCC-C
T ss_pred             ccccccccccccc--cccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccc-c
Confidence            8888777776543  233455666666666655444333322222223333333333333333333333333332221 1


Q ss_pred             ccccCCCCCcEEEeeCCCCCchhhhhhhhcCCCccEEeccCCCCCchhhhhcCCCCCeeeccCCCCCchHHHHHHhcCCC
Q 006752          248 EGNENKAPLAKISLAGTTFINEREAFLYIETSLLSFLDVSNSSLSRFCFLTQMKALEHLDLSSSMIGDDSVEMVACVGAN  327 (632)
Q Consensus       248 ~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~  327 (632)
                      ....                         .+++++.+++++|.++.......+++|++|++++|.+++..  .+... ++
T Consensus       191 ~~~~-------------------------~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~--~l~~l-~~  242 (384)
T d2omza2         191 SVLA-------------------------KLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG--TLASL-TN  242 (384)
T ss_dssp             GGGG-------------------------GCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG--GGGGC-TT
T ss_pred             cccc-------------------------cccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc--hhhcc-cc
Confidence            2222                         34455555555555555444455555666666665555422  23333 56


Q ss_pred             CcEEEccCCcCcchhHHHHHhcCCCCcEEEccCCCCChHHHHHHhcCCCccEEEccCCccccccCCCccchhhhhhhhhh
Q 006752          328 LRNLNLSNTRFSSAGVGILAGHLPNLEILSLSGTQIDDYAISYMSMMPSLKFIDISNTDIKGMYPSGQMNVFFSAYCFMI  407 (632)
Q Consensus       328 L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~Ls~n~i~~~~~~~~~~~~~~~~~~~~  407 (632)
                      |+.+++++|++++..+   .+.+++|++|+++++++++..+  +..++.++.++++.|.+.+.                 
T Consensus       243 L~~L~l~~n~l~~~~~---~~~~~~L~~L~l~~~~l~~~~~--~~~~~~l~~l~~~~n~l~~~-----------------  300 (384)
T d2omza2         243 LTDLDLANNQISNLAP---LSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDI-----------------  300 (384)
T ss_dssp             CSEEECCSSCCCCCGG---GTTCTTCSEEECCSSCCCCCGG--GTTCTTCSEEECCSSCCSCC-----------------
T ss_pred             cchhccccCccCCCCc---ccccccCCEeeccCcccCCCCc--cccccccccccccccccccc-----------------
Confidence            6666666666655433   2456677777777776665432  55677777777777776653                 


Q ss_pred             hhhceeccccccccccccccchhhhcccccccccchHHhhcCCcccccccCccCCCCCccccccCcccccccccccccCC
Q 006752          408 VYNLFLHAYGYVIFPSSVLAGFIQQVGAETDLVLSLTALQNLNHLERLNLEQTQVSDATLFPLSTFKELIHLSLRNASLT  487 (632)
Q Consensus       408 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~  487 (632)
                                                          ..+..+++++.|++++|++++..  .+..+++|++|++++|+++
T Consensus       301 ------------------------------------~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~  342 (384)
T d2omza2         301 ------------------------------------SPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVS  342 (384)
T ss_dssp             ------------------------------------GGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCC
T ss_pred             ------------------------------------cccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCC
Confidence                                                12455667777777777777643  3666777777777777777


Q ss_pred             CcchhhhccCCCCcEEeecCceeccCCCCCCCCCCCcceEecCCC
Q 006752          488 DVSLHQLSSLSKLTNLSIRDAVLTNSGLGSFKPPRSLKLLDLHGG  532 (632)
Q Consensus       488 ~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~l~~~~~L~~L~l~~N  532 (632)
                      +. + .+.++++|++|++++|++++..|  +.++++|+.|++++|
T Consensus       343 ~l-~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         343 DV-S-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CC-G-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CC-h-hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            63 2 57777777777777777777543  667777777777776



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure