Citrus Sinensis ID: 006758

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630--
MMKNRFPAAMPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTKSDGRRSRSGKKAKKRHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQASSRCASPEELRSRKTPIESIQESTSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
ccccccccccccccccccccEEEEEcccccccccccccccEEEEEcccccccHHHHHccccEEEEEccccccHHHHHcccccEEEEEEcccccHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHHHccccEEEEEcccccccccccccccEEcccHHHHHHHccEEEEEccccccccccccHHHHHccccccEEEEccccccccHHHHHHHHHHccEEEEEcccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccHHHHcccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccHHHHHHccccccccccccccccEEEEEEEEccccEEEEEEEEccccEEEEEEcccccccccccEEEEEcccccccccccccccEEEEcccEEEEEEcccccccccccccccccccEEccccccccEEEEEEEEEHHcccccccccccc
ccccccccccccccccccccEEEEEcccccccEHHHHHccEEEEEccccHHHHHHHHHcccEEEEEccccccHHHHHHccccEEEEEcccccccccHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHcccccccEEEEEEcccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccHHHHHHcccEEcccHHHHHHHccEEEEcccccHHHcccEcHHHHHcccccEEEEEcccHHHEcHHHHHHHHHcccEEEEEEccccccccccHHHcccccEEEcccccccEHHHHHHHHHHHHHHHHHHcHcccccccccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEcccccccEEEEccccccccccccccccccccccccccccccccccccccccHHEEccccccccccccEcccccccccccccccccccccccccccccccHHHHHcccccccccHHHHcccEEEEEEEEccccEEEEEEccccccEEEEEEccccccccccEEEEEEccccEcHEEEHHccHHHHHHcccEEEEEEccccEEHHHEEEccccccEEEccccccEEEEEEEEEEEEcccccccEEccc
mmknrfpaamphrdnptplpsvVALNCIEDCVLEQDSLAGVAlvehvplgrladgKIEAAAAVLLHSLAYLpraaqrrlrPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSasgwlgsvqplcrgmrRCRGLVLGIVGRSASARALATRSLSFKMSVLYfdvpegkgkvtfpsaARRMDTLNDLLAASDVislhcavtdETIQIINAECLqhikpgaflvntgssqllddCAVKQLLIdgtlagcaldgaegpQWMEAWVREMPnvlilprsadyseEVWMEIRDKAISVLQTFffdgvipknaisdtegcenEIDDEIEQYNkldkvstlegsvggqltddiqvspedslkkgiswsrdspsqlqgsgfsqnsantksdgrrsrsgkkaKKRHARQkslqkpddpsalekestshkeddtamsgtdqassrcaspeelrsrktpiesIQESTSKKLsrsskklsevsgetlkdgYVVALYArdrpalhisrqrhkgggwiLETMsnvtkrdpaaQFLIckskdtiglrsftaggKLLQINRRMEFVFAshsfdaweswaiegpleecrlvncrnplaFLDVRIEILAAvgeddgitrwld
mmknrfpaamphrdnptplPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALsasgwlgsvqpLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEgsvggqltddiqvspEDSLKKGISWSRdspsqlqgsgfsqnsantksdgrrsrsgkkakkrharqkslqkpddpsalekestshkeddtamsgtdqassrcaspeelrsrktpiesiqestskklsrsskklsevsgetlkdgyvVALYardrpalhisrqrhkgggwILETMSNVTKRDPAAQFLIckskdtiglrsFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILaavgeddgitrwld
MMKNRFPAAMPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMalllgllrrthllarhalsasgWLGSVQPLCRGMRRCRGLVLGIVGrsasaralatrslsFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTksdgrrsrsgkkakkrharQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQASSRCASPEELRSRKTPIESIQEstskklsrsskklsEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
********************SVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEI***I********************************************************************************************************************************************************LKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRW**
*********************VVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQ*****************************************************************************************************************************ETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
*********MPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPED**********************************************************************************************************************SGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
************RDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQ*************************************************************************************************LSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKNRFPAAMPHRDNPTPLPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTKSDGRRSRSGKKAKKRHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQASSRCASPEELRSRKTPIESIQESTSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKRDPAAQFLICKSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query632 2.2.26 [Sep-21-2011]
O23702636 C-terminal binding protei yes no 0.982 0.976 0.712 0.0
Q9YHU0440 C-terminal-binding protei N/A no 0.485 0.697 0.309 7e-31
Q9W758437 C-terminal-binding protei N/A no 0.484 0.700 0.300 8e-31
Q9Z2F5430 C-terminal-binding protei yes no 0.493 0.725 0.307 1e-30
O88712441 C-terminal-binding protei yes no 0.485 0.696 0.309 1e-30
O46036476 C-terminal-binding protei yes no 0.406 0.539 0.318 2e-30
P56545445 C-terminal-binding protei no no 0.473 0.671 0.298 4e-30
P56546445 C-terminal-binding protei no no 0.473 0.671 0.298 5e-30
Q9EQH5445 C-terminal-binding protei no no 0.473 0.671 0.298 5e-30
Q0VCQ1445 C-terminal-binding protei no no 0.473 0.671 0.301 5e-30
>sp|O23702|CTBP_ARATH C-terminal binding protein AN OS=Arabidopsis thaliana GN=AN PE=1 SV=1 Back     alignment and function desciption
 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/647 (71%), Positives = 527/647 (81%), Gaps = 26/647 (4%)

Query: 1   MMKNRFPAAMPHRDNPTPL-PSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEA 59
           M K R  A MPHRD P+P  P VV LNCIEDC LEQDSLAGVA VE+VPL R+ADGKIE+
Sbjct: 1   MSKIRSSATMPHRDQPSPASPHVVTLNCIEDCALEQDSLAGVAGVEYVPLSRIADGKIES 60

Query: 60  AAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIA 119
           A AVLLHSLAYLPRAAQRRLRP+QLILCLGS+DR VDS LAADLGLRL+HVDTSRAEEIA
Sbjct: 61  ATAVLLHSLAYLPRAAQRRLRPHQLILCLGSADRAVDSTLAADLGLRLVHVDTSRAEEIA 120

Query: 120 DTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALAT 179
           DTVMAL+LGLLRRTHLL+RHALSASGWLGS+QPLCRGMRRCRG+VLGIVGRS SAR LA+
Sbjct: 121 DTVMALILGLLRRTHLLSRHALSASGWLGSLQPLCRGMRRCRGMVLGIVGRSVSARYLAS 180

Query: 180 RSLSFKMSVLYFDVPEGKGKVT----FPSAARRMDTLNDLLAASDVISLHCAVTDETIQI 235
           RSL+FKMSVLYFDVPEG  +      FP AARRMDTLNDLLAASDVISLHCA+T++T+QI
Sbjct: 181 RSLAFKMSVLYFDVPEGDEERIRPSRFPRAARRMDTLNDLLAASDVISLHCALTNDTVQI 240

Query: 236 INAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMP 295
           +NAECLQHIKPGAFLVNTGS QLLDDCAVKQLLIDGT+AGCALDGAEGPQWMEAWV+EMP
Sbjct: 241 LNAECLQHIKPGAFLVNTGSCQLLDDCAVKQLLIDGTIAGCALDGAEGPQWMEAWVKEMP 300

Query: 296 NVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAI-SDTEGCENEIDDEIEQYN 354
           NVLILPRSADYSEEVWMEIR+KAIS+L +FF DGVIP N +  +        ++E +  +
Sbjct: 301 NVLILPRSADYSEEVWMEIREKAISILHSFFLDGVIPSNTVSDEEVEESEASEEEEQSPS 360

Query: 355 KLDKVSTLEGSVGGQ----LTDDIQVSPEDS-LKKGISWSRDSPSQLQGSGFSQNSANTK 409
           K +K++ +E +   Q    LT    V  E S LK+ +     SP Q      SQN+A  K
Sbjct: 361 KHEKLAIVESTSRQQGESTLTSTEIVRREASELKESL-----SPGQQH---VSQNTA-VK 411

Query: 410 SDGRRSRSGKKAKKRHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQ---ASSRCAS 466
            +GRRSRSGKKAKKRH++QK +QK D  S L +ESTS + DD AMS T++   +SSRCAS
Sbjct: 412 PEGRRSRSGKKAKKRHSQQKYMQKTDGSSGLNEESTS-RRDDIAMSDTEEVLSSSSRCAS 470

Query: 467 PEELRSRKTPIESIQESTSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRH 526
           PE+ RSRKTP+E +QES+  +L  SSKK    S E LKDGYVVALYA+D   LH+SRQR 
Sbjct: 471 PEDSRSRKTPLEVMQESSPNQLVMSSKKFIGKSSELLKDGYVVALYAKDLSGLHVSRQRT 530

Query: 527 KGGGWILETMSNVTKRDPAAQFLIC-KSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFD 585
           K GGW L+T+SNV+KRDPAAQF+I  ++KDT+GLRSF AGGKLLQINRRMEFVFASHSFD
Sbjct: 531 KNGGWFLDTLSNVSKRDPAAQFIIAYRNKDTVGLRSFAAGGKLLQINRRMEFVFASHSFD 590

Query: 586 AWESWAIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD 632
            WESW++EG L+ECRLVNCRN  A LDVR+EILA VG DDGITRW+D
Sbjct: 591 VWESWSLEGSLDECRLVNCRNSSAVLDVRVEILAMVG-DDGITRWID 636
Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex (By similarity). Required for cortical microtubules (MTs) arrangement that confers cell shape. Regulates the width of leaves by controlling the polar elongation of leaf cells. Involved in the regulation of trichome branching. Seems to not be able to regulate gene transcription. Regulates epidermal cell divisions and elongation in a non-cell-autonomous manner (regulated by subepidermal cells), but regulates epidermal cell polarity, shape, trichome branching and elongation in a cell-autonomous manner.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9YHU0|CTBP1_XENLA C-terminal-binding protein 1 OS=Xenopus laevis GN=ctbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W758|CTBP2_XENLA C-terminal-binding protein 2 OS=Xenopus laevis GN=ctbp2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2F5|CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus GN=Ctbp1 PE=1 SV=3 Back     alignment and function description
>sp|O88712|CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus GN=Ctbp1 PE=1 SV=2 Back     alignment and function description
>sp|O46036|CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster GN=CtBP PE=1 SV=3 Back     alignment and function description
>sp|P56545|CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens GN=CTBP2 PE=1 SV=1 Back     alignment and function description
>sp|P56546|CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus GN=Ctbp2 PE=1 SV=2 Back     alignment and function description
>sp|Q9EQH5|CTBP2_RAT C-terminal-binding protein 2 OS=Rattus norvegicus GN=Ctbp2 PE=1 SV=2 Back     alignment and function description
>sp|Q0VCQ1|CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus GN=CTBP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
224130386655 predicted protein [Populus trichocarpa] 0.969 0.935 0.792 0.0
359489641 952 PREDICTED: C-terminal binding protein AN 0.992 0.658 0.789 0.0
255541702 930 2-hydroxyacid dehydrogenase, putative [R 0.977 0.664 0.804 0.0
387940576645 angustifolia [Gossypium arboreum] 0.990 0.970 0.785 0.0
224067934620 predicted protein [Populus trichocarpa] 0.966 0.985 0.781 0.0
356531955617 PREDICTED: C-terminal binding protein AN 0.974 0.998 0.766 0.0
449432118 944 PREDICTED: C-terminal binding protein AN 0.982 0.657 0.764 0.0
356568437617 PREDICTED: C-terminal binding protein AN 0.974 0.998 0.762 0.0
449527235636 PREDICTED: C-terminal binding protein AN 0.993 0.987 0.756 0.0
28804252654 angustifolia [Ipomoea nil] gi|28804254|d 0.987 0.954 0.743 0.0
>gi|224130386|ref|XP_002320824.1| predicted protein [Populus trichocarpa] gi|222861597|gb|EEE99139.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/631 (79%), Positives = 557/631 (88%), Gaps = 18/631 (2%)

Query: 19  LPSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRR 78
           LP VV LNCIED  +EQDSL+GVAL+EHVPLGRL+DGKIE+AAAVLLHSLAYLPRAAQRR
Sbjct: 26  LPLVVTLNCIEDFAIEQDSLSGVALIEHVPLGRLSDGKIESAAAVLLHSLAYLPRAAQRR 85

Query: 79  LRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTHLLAR 138
           LRPYQLILCLGS+DR VDSALAADLGLRL+HVDTSRAEEIADTVMAL LGLLRRTHLL+R
Sbjct: 86  LRPYQLILCLGSADRAVDSALAADLGLRLVHVDTSRAEEIADTVMALFLGLLRRTHLLSR 145

Query: 139 HALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKG 198
           HALSASGWLGS+QPLCRGMRRCRGLVLGIVGRSASAR+LATRSL+FKMSVLYFDV EG G
Sbjct: 146 HALSASGWLGSLQPLCRGMRRCRGLVLGIVGRSASARSLATRSLAFKMSVLYFDVHEGPG 205

Query: 199 K-----VTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPG------ 247
           K     +TFP AARRMDTLNDLLAASD+ISLHCA+T+ET+QIIN ECLQHIKPG      
Sbjct: 206 KLTRSSITFPLAARRMDTLNDLLAASDLISLHCALTNETVQIINEECLQHIKPGILLSLL 265

Query: 248 ----AFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVLILPRS 303
               AFLVNTGSSQLLDDCA+KQLLIDGTLAGCALDGAEGPQWMEAWV+EMPNVLILPRS
Sbjct: 266 ILRRAFLVNTGSSQLLDDCALKQLLIDGTLAGCALDGAEGPQWMEAWVKEMPNVLILPRS 325

Query: 304 ADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQYNKLDKVSTLE 363
           ADYSEEVWMEIR+KAIS+LQ+FFFDG++PKNA+SD EG E+EI DE EQ+++ DK STL+
Sbjct: 326 ADYSEEVWMEIREKAISILQSFFFDGIVPKNAVSDEEGEESEIGDESEQFHRQDKESTLQ 385

Query: 364 GSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTKSDGRRSRSGKKAKK 423
            SVG QLTDDIQ++PE S KK    S +S SQ QGSG SQN+  T+SD RRSRSGKKAKK
Sbjct: 386 DSVGEQLTDDIQLTPETSRKKVSGQSIESTSQAQGSGMSQNT-TTRSDERRSRSGKKAKK 444

Query: 424 RHARQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQ-ASSRCASPEELRSRKTPIESIQE 482
           RH RQK  QK D+PS LEKESTSH+EDDTAMSG+DQ +SSR ASPE+ RSRKTPIE +QE
Sbjct: 445 RHGRQKPRQKSDNPSQLEKESTSHQEDDTAMSGSDQVSSSRFASPEDSRSRKTPIELMQE 504

Query: 483 STSKKLSRSSKKLSEVSGETLKDGYVVALYARDRPALHISRQRHKGGGWILETMSNVTKR 542
           S+S +LSRS K+LS  S E LKDG+++ALYARDRPALH+SRQR KGGGW L+ +SNVTKR
Sbjct: 505 SSSGQLSRSGKRLSGKSDELLKDGHIIALYARDRPALHVSRQRAKGGGWFLDALSNVTKR 564

Query: 543 DPAAQFLIC-KSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESWAIEGPLEECRL 601
           DPAAQFL+  ++KDTIGLRSF AGGKLLQINRRMEFVF SHSFD WESW +EG L+ECRL
Sbjct: 565 DPAAQFLVVFRNKDTIGLRSFAAGGKLLQINRRMEFVFTSHSFDVWESWMLEGSLDECRL 624

Query: 602 VNCRNPLAFLDVRIEILAAVGEDDGITRWLD 632
           VNCRNPLA LD R+EILAA+ EDDG+TRWLD
Sbjct: 625 VNCRNPLAILDARVEILAAIAEDDGVTRWLD 655

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359489641|ref|XP_002275405.2| PREDICTED: C-terminal binding protein AN-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541702|ref|XP_002511915.1| 2-hydroxyacid dehydrogenase, putative [Ricinus communis] gi|223549095|gb|EEF50584.1| 2-hydroxyacid dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|387940576|gb|AFK13152.1| angustifolia [Gossypium arboreum] Back     alignment and taxonomy information
>gi|224067934|ref|XP_002302606.1| predicted protein [Populus trichocarpa] gi|222844332|gb|EEE81879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531955|ref|XP_003534541.1| PREDICTED: C-terminal binding protein AN-like [Glycine max] Back     alignment and taxonomy information
>gi|449432118|ref|XP_004133847.1| PREDICTED: C-terminal binding protein AN-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356568437|ref|XP_003552417.1| PREDICTED: C-terminal binding protein AN-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449527235|ref|XP_004170618.1| PREDICTED: C-terminal binding protein AN-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|28804252|dbj|BAC58020.1| angustifolia [Ipomoea nil] gi|28804254|dbj|BAC58021.1| angustifolia [Ipomoea nil] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query632
TAIR|locus:2025376636 AN "ANGUSTIFOLIA" [Arabidopsis 0.990 0.984 0.644 1.4e-206
UNIPROTKB|J9NTH6369 CTBP1 "Uncharacterized protein 0.514 0.880 0.280 1.6e-26
ZFIN|ZDB-GENE-010130-1449 ctbp1 "C-terminal binding prot 0.498 0.701 0.297 2.8e-26
UNIPROTKB|E1C7L0433 CTBP2 "Uncharacterized protein 0.522 0.762 0.264 1.1e-25
UNIPROTKB|F1MYP4419 CTBP1 "Uncharacterized protein 0.511 0.770 0.276 1.2e-25
UNIPROTKB|Q5ZMM8440 LOC416354 "Uncharacterized pro 0.501 0.720 0.283 1.6e-25
UNIPROTKB|Q9W758437 ctbp2 "C-terminal-binding prot 0.504 0.729 0.275 1.9e-25
UNIPROTKB|F1P620430 CTBP1 "Uncharacterized protein 0.514 0.755 0.280 2.5e-25
RGD|2441430 Ctbp1 "C-terminal binding prot 0.514 0.755 0.277 2.5e-25
UNIPROTKB|Q9Z2F5430 Ctbp1 "C-terminal-binding prot 0.514 0.755 0.277 2.5e-25
TAIR|locus:2025376 AN "ANGUSTIFOLIA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1998 (708.4 bits), Expect = 1.4e-206, P = 1.4e-206
 Identities = 414/642 (64%), Positives = 474/642 (73%)

Query:     1 MMKNRFPAAMPHRDNPTPL-PSVVALNCIEDCVLEQDSLAGVALVEHVPLGRLADGKIEA 59
             M K R  A MPHRD P+P  P VV LNCIEDC LEQDSLAGVA VE+VPL R+ADGKIE+
Sbjct:     1 MSKIRSSATMPHRDQPSPASPHVVTLNCIEDCALEQDSLAGVAGVEYVPLSRIADGKIES 60

Query:    60 AAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIA 119
             A AVLLHSLAYLPRAAQRRLRP+QLILCLGS+DR VDS LAADLGLRL+HVDTSRAEEIA
Sbjct:    61 ATAVLLHSLAYLPRAAQRRLRPHQLILCLGSADRAVDSTLAADLGLRLVHVDTSRAEEIA 120

Query:   120 DTVMXXXXXXXXXXXXXXXXXXXXXXWLGSVQPLCRGMRRCRGLVLGIVGXXXXXXXXXX 179
             DTVM                      WLGS+QPLCRGMRRCRG+VLGIVG          
Sbjct:   121 DTVMALILGLLRRTHLLSRHALSASGWLGSLQPLCRGMRRCRGMVLGIVGRSVSARYLAS 180

Query:   180 XXXXFKMSVLYFDVPEG-KGKVT---FPSAARRMDTLNDLLAASDVISLHCAVTDETIQI 235
                 FKMSVLYFDVPEG + ++    FP AARRMDTLNDLLAASDVISLHCA+T++T+QI
Sbjct:   181 RSLAFKMSVLYFDVPEGDEERIRPSRFPRAARRMDTLNDLLAASDVISLHCALTNDTVQI 240

Query:   236 INAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMP 295
             +NAECLQHIKPGAFLVNTGS QLLDDCAVKQLLIDGT+AGCALDGAEGPQWMEAWV+EMP
Sbjct:   241 LNAECLQHIKPGAFLVNTGSCQLLDDCAVKQLLIDGTIAGCALDGAEGPQWMEAWVKEMP 300

Query:   296 NVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAISDTEGCENEIDDEIEQY-N 354
             NVLILPRSADYSEEVWMEIR+KAIS+L +FF DGVIP N +SD E  E+E  +E EQ  +
Sbjct:   301 NVLILPRSADYSEEVWMEIREKAISILHSFFLDGVIPSNTVSDEEVEESEASEEEEQSPS 360

Query:   355 KLDKVSTLEGSVGGQLTDDIQVSPEDSLKKGISWSRDSPSQLQGSGFSQNSANTXXXXXX 414
             K +K++ +E S   Q  +    S E  +++  S  ++S S  Q    SQN+A        
Sbjct:   361 KHEKLAIVE-STSRQQGESTLTSTE-IVRREASELKESLSPGQ-QHVSQNTA-VKPEGRR 416

Query:   415 XXXXXXXXXXXXXQKSLQKPDDPSALEKESTSHKEDDTAMSGTDQ---ASSRCASPEELR 471
                          QK +QK D  S L +ESTS + DD AMS T++   +SSRCASPE+ R
Sbjct:   417 SRSGKKAKKRHSQQKYMQKTDGSSGLNEESTSRR-DDIAMSDTEEVLSSSSRCASPEDSR 475

Query:   472 SRKTPIESIQEXXXXXXXXXXXXXXEVSGETLKDGYVVALYARDRPALHISRQRHKGGGW 531
             SRKTP+E +QE                S E LKDGYVVALYA+D   LH+SRQR K GGW
Sbjct:   476 SRKTPLEVMQESSPNQLVMSSKKFIGKSSELLKDGYVVALYAKDLSGLHVSRQRTKNGGW 535

Query:   532 ILETMSNVTKRDPAAQFLIC-KSKDTIGLRSFTAGGKLLQINRRMEFVFASHSFDAWESW 590
              L+T+SNV+KRDPAAQF+I  ++KDT+GLRSF AGGKLLQINRRMEFVFASHSFD WESW
Sbjct:   536 FLDTLSNVSKRDPAAQFIIAYRNKDTVGLRSFAAGGKLLQINRRMEFVFASHSFDVWESW 595

Query:   591 AIEGPLEECRLVNCRNPLAFLDVRIEILAAVGEDDGITRWLD 632
             ++EG L+ECRLVNCRN  A LDVR+EILA VG DDGITRW+D
Sbjct:   596 SLEGSLDECRLVNCRNSSAVLDVRVEILAMVG-DDGITRWID 636
GO:0000166 "nucleotide binding" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0010091 "trichome branching" evidence=IMP
GO:0000226 "microtubule cytoskeleton organization" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0042802 "identical protein binding" evidence=IPI
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0010482 "regulation of epidermal cell division" evidence=IMP
GO:0031129 "inductive cell-cell signaling" evidence=IMP
GO:0045604 "regulation of epidermal cell differentiation" evidence=IMP
GO:0048444 "floral organ morphogenesis" evidence=IMP
GO:0048530 "fruit morphogenesis" evidence=IMP
GO:2000039 "regulation of trichome morphogenesis" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=IMP;RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0051225 "spindle assembly" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
GO:0042814 "monopolar cell growth" evidence=IMP
UNIPROTKB|J9NTH6 CTBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010130-1 ctbp1 "C-terminal binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7L0 CTBP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYP4 CTBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMM8 LOC416354 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W758 ctbp2 "C-terminal-binding protein 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1P620 CTBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2441 Ctbp1 "C-terminal binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z2F5 Ctbp1 "C-terminal-binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23702CTBP_ARATHNo assigned EC number0.71250.98250.9764yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
cd05299312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 2e-84
COG1052324 COG1052, LdhA, Lactate dehydrogenase and related d 2e-37
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 2e-37
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 1e-33
cd12175311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2e-32
cd12172306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 6e-31
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 6e-31
cd12168321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 1e-30
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 1e-27
cd01619323 cd01619, LDH_like, D-Lactate and related Dehydroge 3e-27
cd05301309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 4e-26
cd12178317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 4e-25
cd12173304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 9e-24
cd12156301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 2e-23
cd12162307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 3e-23
PRK06932314 PRK06932, PRK06932, glycerate dehydrogenase; Provi 6e-23
cd12187329 cd12187, LDH_like_1, D-Lactate and related Dehydro 1e-22
cd12183328 cd12183, LDH_like_2, D-Lactate and related Dehydro 2e-21
PRK06487317 PRK06487, PRK06487, glycerate dehydrogenase; Provi 3e-21
cd12157318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 5e-21
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 6e-21
cd12176304 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, 4e-20
cd12186329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 9e-20
cd12185322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 1e-19
cd12167330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 1e-19
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2e-19
cd12174305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 3e-19
pfam00389312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 2e-18
cd12169308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 2e-18
cd12177321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 4e-18
PRK15409323 PRK15409, PRK15409, bifunctional glyoxylate/hydrox 8e-18
PRK11790409 PRK11790, PRK11790, D-3-phosphoglycerate dehydroge 2e-16
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 3e-16
cd12180308 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 3e-16
cd05302348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 6e-16
PRK13243333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 3e-15
TIGR01327525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 7e-15
cd12161315 cd12161, GDH_like_1, Putative glycerate dehydrogen 2e-14
cd12159303 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 7e-14
PLN02306386 PLN02306, PLN02306, hydroxypyruvate reductase 1e-13
cd12179306 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2e-13
PRK13581526 PRK13581, PRK13581, D-3-phosphoglycerate dehydroge 1e-12
PRK07574385 PRK07574, PRK07574, formate dehydrogenase; Provisi 2e-12
cd12184330 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro 3e-12
PRK08410311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P 1e-11
PLN02928347 PLN02928, PLN02928, oxidoreductase family protein 6e-11
cd12158343 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh 3e-10
cd12160310 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 1e-09
cd12164306 cd12164, GDH_like_2, Putative glycerate dehydrogen 1e-09
PLN03139386 PLN03139, PLN03139, formate dehydrogenase; Provisi 4e-09
cd12155314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 1e-08
PRK12480330 PRK12480, PRK12480, D-lactate dehydrogenase; Provi 5e-08
PRK08605332 PRK08605, PRK08605, D-lactate dehydrogenase; Valid 2e-05
cd12170294 cd12170, 2-Hacid_dh_9, Putative D-isomer specific 3e-05
PRK00257381 PRK00257, PRK00257, erythronate-4-phosphate dehydr 4e-05
cd12166300 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 1e-04
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information 
 Score =  267 bits (684), Expect = 2e-84
 Identities = 112/325 (34%), Positives = 162/325 (49%), Gaps = 23/325 (7%)

Query: 20  PSVVALNCIE-DCVLEQDSL--AGVALVEHVPLGRLADGKIEA--AAAVLLHSLAYLPRA 74
           P VV  +    D  +E++ L  AGV LV+        +    A  A A+L+   A +   
Sbjct: 1   PKVVITDYDFPDLDIEREVLEEAGVELVD-AQSRTEDELIEAAADADALLVQY-APVTAE 58

Query: 75  AQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRTH 134
               L   ++I+  G     VD A A + G+ + +V     EE+AD  +AL+L L R+  
Sbjct: 59  VIEALPRLKVIVRYGVGVDNVDVAAATERGIPVCNVPDYCTEEVADHALALILALARKLP 118

Query: 135 LLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFD-- 192
            L R   +              +RR RGL LG+VG     RA+A R+ +F   V+ +D  
Sbjct: 119 FLDRAVRAGGWDWTV----GGPIRRLRGLTLGLVGFGRIGRAVAKRAKAFGFRVIAYDPY 174

Query: 193 VPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVN 252
           VP+G           R+ +L++LLA SDV+SLHC +T ET  +I+AE L  +KPGAFLVN
Sbjct: 175 VPDGV----AALGGVRVVSLDELLARSDVVSLHCPLTPETRHLIDAEALALMKPGAFLVN 230

Query: 253 TGSSQLLDDCAVKQLLIDGTLAGCALDGA--EGPQWMEAWVREMPNVLILPRSADYSEEV 310
           T    L+D+ A+ + L  G +AG ALD    E P          PNV++ P +A YSEE 
Sbjct: 231 TARGGLVDEAALARALKSGRIAGAALDVLEEEPPPADSPL-LSAPNVILTPHAAWYSEES 289

Query: 311 WMEIRDKAIS-VLQTFFFDGVIPKN 334
             E+R KA   V++     G  P+N
Sbjct: 290 LAELRRKAAEEVVR--VLRGEPPRN 312

The transcriptional corepressor CtBP is a dehydrogenase with sequence and structural similarity to the d2-hydroxyacid dehydrogenase family. CtBP was initially identified as a protein that bound the PXDLS sequence at the adenovirus E1A C terminus, causing the loss of CR-1-mediated transactivation. CtBP binds NAD(H) within a deep cleft, undergoes a conformational change upon NAD binding, and has NAD-dependent dehydrogenase activity. Length = 312
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|236985 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240657 cd12180, 2-Hacid_dh_15, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
>gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240637 cd12160, 2-Hacid_dh_3, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240641 cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240647 cd12170, 2-Hacid_dh_9, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|166874 PRK00257, PRK00257, erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 632
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 100.0
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 100.0
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 100.0
PRK06487317 glycerate dehydrogenase; Provisional 100.0
PRK13243333 glyoxylate reductase; Reviewed 100.0
PRK06932314 glycerate dehydrogenase; Provisional 100.0
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PLN02306386 hydroxypyruvate reductase 100.0
PRK07574385 formate dehydrogenase; Provisional 100.0
PLN03139386 formate dehydrogenase; Provisional 100.0
PLN02928347 oxidoreductase family protein 100.0
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 100.0
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK12480330 D-lactate dehydrogenase; Provisional 100.0
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 100.0
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 100.0
PRK08605332 D-lactate dehydrogenase; Validated 100.0
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 100.0
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 100.0
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 100.0
PRK06436303 glycerate dehydrogenase; Provisional 100.0
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 100.0
KOG0067435 consensus Transcription factor CtBP [Transcription 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 99.79
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.76
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.71
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.54
PLN02494477 adenosylhomocysteinase 99.54
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 99.44
PRK13403335 ketol-acid reductoisomerase; Provisional 99.42
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.35
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.29
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 99.25
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.2
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.16
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.16
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.14
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 99.11
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.07
PLN02256304 arogenate dehydrogenase 99.01
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 98.97
PRK05479330 ketol-acid reductoisomerase; Provisional 98.97
PLN02712667 arogenate dehydrogenase 98.96
PRK15059292 tartronate semialdehyde reductase; Provisional 98.95
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.91
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.89
KOG0409327 consensus Predicted dehydrogenase [General functio 98.85
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 98.85
PLN02858 1378 fructose-bisphosphate aldolase 98.85
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.84
PLN02858 1378 fructose-bisphosphate aldolase 98.83
PRK07417279 arogenate dehydrogenase; Reviewed 98.78
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.78
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.72
PRK06545359 prephenate dehydrogenase; Validated 98.72
PRK07502307 cyclohexadienyl dehydrogenase; Validated 98.72
PRK08655437 prephenate dehydrogenase; Provisional 98.7
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.7
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.68
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 98.67
PLN02712 667 arogenate dehydrogenase 98.64
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 98.62
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.62
PRK08507275 prephenate dehydrogenase; Validated 98.57
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.57
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.56
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 98.56
PRK05225487 ketol-acid reductoisomerase; Validated 98.56
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.55
PLN02688266 pyrroline-5-carboxylate reductase 98.55
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.54
PRK08818370 prephenate dehydrogenase; Provisional 98.52
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.51
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.45
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.43
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 98.43
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.43
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.42
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 98.41
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.4
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.4
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 98.4
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.4
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.39
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.37
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.35
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.35
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 98.34
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.32
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.31
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 98.31
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.29
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.29
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 98.29
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.28
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 98.27
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.23
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 98.21
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.19
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 98.17
PRK09287459 6-phosphogluconate dehydrogenase; Validated 98.14
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.12
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.09
PRK07680273 late competence protein ComER; Validated 98.07
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 98.05
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 98.04
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 98.03
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.02
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.94
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.93
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.88
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.87
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.87
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.87
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.86
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.86
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.82
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.81
KOG2380480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.81
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.8
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.79
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.77
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.74
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.74
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 97.71
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 97.71
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.71
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.7
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 97.69
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.67
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.67
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.66
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.64
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.61
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 97.6
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.58
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.57
PRK08229341 2-dehydropantoate 2-reductase; Provisional 97.57
PLN00203519 glutamyl-tRNA reductase 97.53
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.53
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.53
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.53
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.53
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.52
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.52
PTZ00431260 pyrroline carboxylate reductase; Provisional 97.5
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.48
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.48
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.45
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.44
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.44
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.43
PRK06141314 ornithine cyclodeaminase; Validated 97.41
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.4
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.4
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.38
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.37
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.37
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.37
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.36
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.35
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.34
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.33
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.32
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.31
PLN02353473 probable UDP-glucose 6-dehydrogenase 97.31
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.3
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.3
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.29
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.27
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.26
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.24
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.24
KOG0067435 consensus Transcription factor CtBP [Transcription 97.24
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.22
PRK07340304 ornithine cyclodeaminase; Validated 97.2
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.19
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 97.18
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.14
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.13
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 97.11
PRK11730715 fadB multifunctional fatty acid oxidation complex 97.11
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.1
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.08
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.05
PRK08618325 ornithine cyclodeaminase; Validated 97.04
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.01
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.99
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 96.96
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.95
PRK11154708 fadJ multifunctional fatty acid oxidation complex 96.95
PTZ00117319 malate dehydrogenase; Provisional 96.95
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 96.93
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.92
PRK06046326 alanine dehydrogenase; Validated 96.92
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 96.88
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.87
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 96.84
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.84
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.83
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.83
PRK13940414 glutamyl-tRNA reductase; Provisional 96.83
PRK06444197 prephenate dehydrogenase; Provisional 96.82
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.82
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.79
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 96.78
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.76
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.73
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.73
PRK14982340 acyl-ACP reductase; Provisional 96.72
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.72
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.64
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.64
PRK06823315 ornithine cyclodeaminase; Validated 96.63
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.61
PRK14030445 glutamate dehydrogenase; Provisional 96.61
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.54
PRK06199379 ornithine cyclodeaminase; Validated 96.51
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 96.49
PRK08291330 ectoine utilization protein EutC; Validated 96.48
PLN02477410 glutamate dehydrogenase 96.47
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.39
PRK00048257 dihydrodipicolinate reductase; Provisional 96.38
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.38
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.37
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.36
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.3
PRK06407301 ornithine cyclodeaminase; Provisional 96.28
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.25
PRK06223307 malate dehydrogenase; Reviewed 96.24
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.23
PRK07589346 ornithine cyclodeaminase; Validated 96.23
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.23
PRK13303265 L-aspartate dehydrogenase; Provisional 96.2
PRK09414445 glutamate dehydrogenase; Provisional 96.19
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 96.16
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.1
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.1
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 96.05
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.05
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.04
PRK06719157 precorrin-2 dehydrogenase; Validated 96.03
PRK14031444 glutamate dehydrogenase; Provisional 96.02
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.01
PTZ00082321 L-lactate dehydrogenase; Provisional 95.99
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.98
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 95.93
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.91
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.87
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.85
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.84
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.78
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.75
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.64
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.63
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.63
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.57
PRK00779304 ornithine carbamoyltransferase; Provisional 95.56
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.55
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.54
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.5
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 95.45
PLN02353473 probable UDP-glucose 6-dehydrogenase 95.41
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.35
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 95.33
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.3
KOG2653487 consensus 6-phosphogluconate dehydrogenase [Carboh 95.23
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 95.23
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 95.21
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 95.21
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 95.18
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.16
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.1
PRK08223287 hypothetical protein; Validated 95.1
COG5322351 Predicted dehydrogenase [General function predicti 95.1
PRK09496453 trkA potassium transporter peripheral membrane com 95.07
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.99
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 94.98
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 94.97
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 94.9
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.82
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 94.8
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 94.78
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.74
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 94.72
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 94.71
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 94.65
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.6
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 94.59
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 94.58
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 94.57
PRK08328231 hypothetical protein; Provisional 94.57
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 94.54
PRK07232752 bifunctional malic enzyme oxidoreductase/phosphotr 94.54
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.51
PRK02255338 putrescine carbamoyltransferase; Provisional 94.51
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.51
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 94.47
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.47
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 94.44
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.44
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 94.43
PRK05086312 malate dehydrogenase; Provisional 94.35
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 94.34
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.31
PLN02527306 aspartate carbamoyltransferase 94.3
PLN02602350 lactate dehydrogenase 94.28
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 94.24
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 94.24
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 94.21
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 94.2
PLN00106323 malate dehydrogenase 94.17
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.14
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.11
PRK12862763 malic enzyme; Reviewed 94.08
COG0281432 SfcA Malic enzyme [Energy production and conversio 94.07
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.02
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.0
PRK07411390 hypothetical protein; Validated 93.99
PRK11579346 putative oxidoreductase; Provisional 93.96
PRK01713334 ornithine carbamoyltransferase; Provisional 93.93
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.91
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.88
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.87
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.87
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.85
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.79
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 93.77
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.77
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 93.71
PRK10637457 cysG siroheme synthase; Provisional 93.68
PTZ00325321 malate dehydrogenase; Provisional 93.65
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 93.65
PLN02948577 phosphoribosylaminoimidazole carboxylase 93.59
PRK02102331 ornithine carbamoyltransferase; Validated 93.46
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.42
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.41
PLN02342348 ornithine carbamoyltransferase 93.38
PRK07806248 short chain dehydrogenase; Provisional 93.35
KOG4230 935 consensus C1-tetrahydrofolate synthase [Coenzyme t 93.34
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 93.3
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.27
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.24
PLN03209576 translocon at the inner envelope of chloroplast su 93.24
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 93.23
PRK06270341 homoserine dehydrogenase; Provisional 93.2
PRK09496453 trkA potassium transporter peripheral membrane com 93.17
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.14
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 93.14
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 93.11
PRK11891429 aspartate carbamoyltransferase; Provisional 93.1
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 93.07
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 93.05
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 93.04
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 93.0
TIGR00036266 dapB dihydrodipicolinate reductase. 92.94
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 92.93
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.88
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 92.88
PRK04284332 ornithine carbamoyltransferase; Provisional 92.86
PRK07576264 short chain dehydrogenase; Provisional 92.83
PRK06349426 homoserine dehydrogenase; Provisional 92.82
PLN02214342 cinnamoyl-CoA reductase 92.81
PRK06398258 aldose dehydrogenase; Validated 92.8
PRK07877 722 hypothetical protein; Provisional 92.79
PRK12861 764 malic enzyme; Reviewed 92.79
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.75
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.74
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.72
PRK05442326 malate dehydrogenase; Provisional 92.71
PRK03659601 glutathione-regulated potassium-efflux system prot 92.71
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 92.71
CHL00194317 ycf39 Ycf39; Provisional 92.67
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.66
COG0673342 MviM Predicted dehydrogenases and related proteins 92.65
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 92.6
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 92.59
PRK15076431 alpha-galactosidase; Provisional 92.54
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 92.51
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 92.49
PRK14851 679 hypothetical protein; Provisional 92.44
PRK10669558 putative cation:proton antiport protein; Provision 92.25
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.09
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 92.08
PRK03562621 glutathione-regulated potassium-efflux system prot 92.06
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.95
PRK10206344 putative oxidoreductase; Provisional 91.93
PLN00112444 malate dehydrogenase (NADP); Provisional 91.89
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 91.83
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 91.83
PRK06128300 oxidoreductase; Provisional 91.82
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 91.82
PRK08300302 acetaldehyde dehydrogenase; Validated 91.82
PRK08192338 aspartate carbamoyltransferase; Provisional 91.79
cd00257119 Fascin Fascin-like domain; members include actin-b 91.75
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 91.71
PLN02695370 GDP-D-mannose-3',5'-epimerase 91.67
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 91.65
PRK08040336 putative semialdehyde dehydrogenase; Provisional 91.63
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 91.52
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 91.51
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.49
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 91.44
PRK06392326 homoserine dehydrogenase; Provisional 91.41
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.39
PRK12939250 short chain dehydrogenase; Provisional 91.37
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 91.31
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 91.28
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 91.22
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 91.21
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 91.17
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 91.09
PLN02586360 probable cinnamyl alcohol dehydrogenase 91.02
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 91.0
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 90.88
PRK12742237 oxidoreductase; Provisional 90.81
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 90.79
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 90.72
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 90.68
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 90.61
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 90.59
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 90.56
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.55
PRK08265261 short chain dehydrogenase; Provisional 90.55
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 90.53
PRK06701290 short chain dehydrogenase; Provisional 90.42
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 90.41
PRK13529563 malate dehydrogenase; Provisional 90.41
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 90.3
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.25
COG2344211 AT-rich DNA-binding protein [General function pred 90.17
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 90.16
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 90.16
PLN03129581 NADP-dependent malic enzyme; Provisional 89.94
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 89.91
PRK06182273 short chain dehydrogenase; Validated 89.88
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 89.87
PRK08324681 short chain dehydrogenase; Validated 89.85
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 89.83
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 89.83
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.8
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 89.8
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 89.78
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 89.78
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 89.74
PRK14852 989 hypothetical protein; Provisional 89.7
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 89.63
PRK13376525 pyrB bifunctional aspartate carbamoyltransferase c 89.39
PLN02178375 cinnamyl-alcohol dehydrogenase 89.32
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 89.31
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 89.22
PRK12937245 short chain dehydrogenase; Provisional 89.22
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 89.16
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.01
PRK07523255 gluconate 5-dehydrogenase; Provisional 88.98
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 88.9
PRK14804311 ornithine carbamoyltransferase; Provisional 88.84
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 88.79
PLN02206442 UDP-glucuronate decarboxylase 88.73
PRK07856252 short chain dehydrogenase; Provisional 88.72
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 88.7
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 88.64
PLN02427386 UDP-apiose/xylose synthase 88.63
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 88.58
PF05222136 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal 88.55
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 88.43
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 88.38
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 88.37
PRK04148134 hypothetical protein; Provisional 88.35
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 88.24
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 88.2
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 88.19
PLN02383344 aspartate semialdehyde dehydrogenase 88.17
PLN02740381 Alcohol dehydrogenase-like 88.12
PLN02896353 cinnamyl-alcohol dehydrogenase 88.09
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 87.94
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 87.93
PRK06194287 hypothetical protein; Provisional 87.87
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 87.83
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 87.75
PRK12367245 short chain dehydrogenase; Provisional 87.74
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 87.73
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 87.66
PRK12828239 short chain dehydrogenase; Provisional 87.65
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 87.54
PRK06500249 short chain dehydrogenase; Provisional 87.37
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.34
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 87.26
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 87.24
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 87.19
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 87.17
PRK07326237 short chain dehydrogenase; Provisional 87.16
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 87.12
PLN02514357 cinnamyl-alcohol dehydrogenase 86.99
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 86.99
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 86.97
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 86.95
PRK08264238 short chain dehydrogenase; Validated 86.89
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-64  Score=531.23  Aligned_cols=281  Identities=25%  Similarity=0.351  Sum_probs=255.7

Q ss_pred             ccccccceEEEEecCCCCCHHHHhcCCCceEEEEecccCCccchHHHHhcCcEEEEcCCCChHHHHHHHHHHHHHHHhhc
Q 006758           54 DGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVMALLLGLLRRT  133 (632)
Q Consensus        54 e~~i~dAdaIli~s~~~L~~evL~~lp~LK~I~~~gaG~D~VD~~aa~erGI~VtNvpg~na~aVAE~ALaliLal~Rrl  133 (632)
                      .+.+.++|++++ +.++++++++..+|+||+|++.|+|+||||+++++++||.|+|+|++|+.+||||+++++|+++|++
T Consensus        40 ~~~~~~~d~~~~-~~~~v~~~~l~~~~~Lk~I~~~g~Gvd~id~~~~~~~gi~V~nap~~na~~vAE~~~~~~L~~~R~~  118 (324)
T COG0111          40 LEALADADALIV-SVTPVTEEVLAAAPNLKAIGRAGAGVDNIDLEAATKRGILVVNAPGGNAISVAELVLALLLALARRI  118 (324)
T ss_pred             HhhcccCcEEEE-ecCCCCHHHHhhCCCceEEEEccccccccCHHHHhhcCCEEEeCCCcchHHHHHHHHHHHHHHhcCc
Confidence            356889999888 8889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCCCCCCCccccccCcEEEEEeCChhhHHHHHHHhhCCCEEEEECCCCCCCCcccccCceecCCHH
Q 006758          134 HLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLN  213 (632)
Q Consensus       134 ~~~~~~~~~~g~W~~~~~~~~~~~~~L~GktVGIIGlG~IG~~vA~~LkafGm~V~~~dr~~~~~~~~~~~g~~~~~sL~  213 (632)
                      +.++..+ +++.|....    ....+|+|+||||||+|+||+.+|++|++|||+|++|||+..... ....+....++|+
T Consensus       119 ~~~~~~~-~~g~W~~~~----~~g~el~gkTvGIiG~G~IG~~va~~l~afgm~v~~~d~~~~~~~-~~~~~~~~~~~Ld  192 (324)
T COG0111         119 PDADASQ-RRGEWDRKA----FRGTELAGKTVGIIGLGRIGRAVAKRLKAFGMKVIGYDPYSPRER-AGVDGVVGVDSLD  192 (324)
T ss_pred             hhhHHHH-HcCCccccc----cccccccCCEEEEECCCHHHHHHHHHHHhCCCeEEEECCCCchhh-hccccceecccHH
Confidence            9999885 899998621    233589999999999999999999999999999999999654432 2234566678999


Q ss_pred             HHhccCCEEEEccCCChhhHhhccHHHHhccCCCcEEEEcCCChhhcHHHHHHHHHcCCcceEEeecCCC-CCCCCcccc
Q 006758          214 DLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEG-PQWMEAWVR  292 (632)
Q Consensus       214 eLL~~ADVV~l~lPlT~~T~~lI~~~~L~~MK~GAvLINvgRG~iVDe~AL~~AL~sg~I~GAaLDVfE~-P~~~~~pL~  292 (632)
                      ++|++||||++|+|+|++|+||||++.|++||+|++|||+|||++||++||++||++|+|+||+||||++ |++.++|||
T Consensus       193 ~lL~~sDiv~lh~PlT~eT~g~i~~~~~a~MK~gailIN~aRG~vVde~aL~~AL~~G~i~gA~lDVf~~EPl~~~~pL~  272 (324)
T COG0111         193 ELLAEADILTLHLPLTPETRGLINAEELAKMKPGAILINAARGGVVDEDALLAALDSGKIAGAALDVFEEEPLPADSPLW  272 (324)
T ss_pred             HHHhhCCEEEEcCCCCcchhcccCHHHHhhCCCCeEEEECCCcceecHHHHHHHHHcCCcceEEecCCCCCCCCCCChhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999997 777789999


Q ss_pred             CCCcEEEcCCCCCccHHHHHHHHHHHHHHHHHHHHcCCC---CCccccCCcCc
Q 006758          293 EMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVI---PKNAISDTEGC  342 (632)
Q Consensus       293 ~~pNVIiTPHiAg~T~ea~~~~~~~a~~nL~~fL~~G~~---p~nvVn~~~~~  342 (632)
                      .+|||++|||+|+.|.++++++...+++|+.+|+ .|..   +.+.|+..++|
T Consensus       273 ~~pnV~~TPHia~~T~ea~~~~~~~~~~~i~~~l-~g~~~~~~~~~v~~~~~~  324 (324)
T COG0111         273 DLPNVILTPHIGGSTDEAQERVAEIVAENIVRYL-AGGPVVNNAPEVDLERGY  324 (324)
T ss_pred             cCCCeEECCcccccCHHHHHHHHHHHHHHHHHHH-cCCCCCCCccccccccCC
Confidence            9999999999999999999999999999999996 7776   45556655554

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4230 consensus C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
3ga0_A358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 6e-25
1hl3_A358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 8e-25
1mx3_A347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 2e-24
2ome_A336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 3e-24
1hku_A358 CtbpBARS: A DUAL-Function Protein Involved In Trans 3e-24
3k5p_A416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 9e-12
3kb6_A334 Crystal Structure Of D-lactate Dehydrogenase From A 3e-10
1j4a_A333 Insights Into Domain Closure, Substrate Specificity 7e-10
2dld_A337 D-Lactate Dehydrogenase Complexed With Nadh And Oxa 8e-10
1j49_A333 Insights Into Domain Closure, Substrate Specificity 1e-09
1dxy_A333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 2e-09
2p9c_A410 Crystal Structure Of Serine Bound G336v Mutant Of E 3e-09
2p9g_A410 Crystal Structure Of Serine Bound G336v,G337v Doubl 3e-09
4ebf_A334 Semet Thermostable Phosphite Dehydrogenase Glu175-A 7e-09
4e5m_A329 Thermostable Phosphite Dehydrogenase E175aA176R IN 9e-09
4e5k_A329 Thermostable Phosphite Dehydrogenase In Complex Wit 9e-09
4e5p_A332 Thermostable Phosphite Dehydrogenase A176r Variant 9e-09
4e5n_A330 Thermostable Phosphite Dehydrogenase In Complex Wit 1e-08
1psd_A409 The Allosteric Ligand Site In The Vmax-Type Coopera 2e-08
1gdh_A320 Crystal Structure Of A Nad-Dependent D-Glycerate De 2e-08
1sc6_A404 Crystal Structure Of W139g D-3-Phosphoglycerate Deh 5e-08
2yq4_A343 Crystal Structure Of D-isomer Specific 2-hydroxyaci 6e-08
2dbr_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 7e-08
1wwk_A307 Crystal Structure Of Phosphoglycerate Dehydrogenase 7e-08
3fn4_A401 Apo-form Of Nad-dependent Formate Dehydrogenase Fro 8e-08
2gsd_A402 Nad-dependent Formate Dehydrogenase From Bacterium 9e-08
2dbq_A334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 2e-07
3ddn_A528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 2e-07
1ygy_A529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 2e-07
3ba1_A333 Structure Of Hydroxyphenylpyruvate Reductase From C 4e-07
2gug_A401 Nad-dependent Formate Dehydrogenase From Pseudomona 5e-07
2go1_A401 Nad-Dependent Formate Dehydrogenase From Pseudomona 5e-07
2nac_A393 High Resolution Structures Of Holo And Apo Formate 5e-07
1yba_A410 The Active Form Of Phosphoglycerate Dehydrogenase L 6e-07
2d0i_A333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 8e-07
3hg7_A324 Crystal Structure Of D-Isomer Specific 2-Hydroxyaci 8e-07
1xdw_A331 Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase 9e-07
2w2k_A348 Crystal Structure Of The Apo Forms Of Rhodotorula G 2e-06
2w2l_D348 Crystal Structure Of The Holo Forms Of Rhodotorula 2e-06
2cuk_A311 Crystal Structure Of Tt0316 Protein From Thermus Th 2e-06
2w2k_B348 Crystal Structure Of The Apo Forms Of Rhodotorula G 3e-06
3naq_A357 Apo-Form Of Nad-Dependent Formate Dehydrogenase Fro 1e-05
3n7u_A351 Nad-Dependent Formate Dehydrogenase From Higher-Pla 1e-05
4dgs_A340 The Crystals Structure Of Dehydrogenase From Rhizob 7e-05
3gg9_A352 Crystal Structure Of Putative D-3-Phosphoglycerate 7e-05
2o4c_A380 Crystal Structure Of D-erythronate-4-phosphate Dehy 5e-04
2j6i_A364 Candida Boidinii Formate Dehydrogenase (Fdh) C-Term 5e-04
2fss_A365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 6e-04
>pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 145/319 (45%), Gaps = 11/319 (3%)
Query: 7   PAAMPHRDNPTPLPSVVALNCIEDCVLEQDSL---AGVALVEHVPLGRLADGKIEAAAAV 63
           P  M    +P PL   VAL    DC +E   L   A VA  +      + +  +  A   
Sbjct: 14  PPIMNGPMHPRPL---VALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGA 70
Query: 64  LLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIHVDTSRAEEIADTVM 123
           L++    L R    + +  ++I+ +GS    +D   A DLG+ + +V  +  EE AD+ +
Sbjct: 71  LMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTL 130
Query: 124 XXXXXXXXXXX--XXXXXXXXXXXWLGSVQPLCRGMRRCRGLVLGIVGXXXXXXXXXXXX 181
                                    +  ++ +  G  R RG  LGI+G            
Sbjct: 131 CHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLERVGQAVALRA 190
Query: 182 XXFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECL 241
             F  +VL++D P     +      +R+ TL DLL  SD ++LHC + +    +IN   +
Sbjct: 191 KAFGFNVLFYD-PYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTV 249
Query: 242 QHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGP--QWMEAWVREMPNVLI 299
           + ++ GAFLVNT    L+D+ A+ Q L +G + G ALD  E     + +  +++ PN++ 
Sbjct: 250 KQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLIC 309
Query: 300 LPRSADYSEEVWMEIRDKA 318
            P +A YSE+  +E+R++A
Sbjct: 310 TPHAAWYSEQASIEMREEA 328
>pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2- Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 Back     alignment and structure
>pdb|1J4A|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|2DLD|A Chain A, D-Lactate Dehydrogenase Complexed With Nadh And Oxamate Length = 337 Back     alignment and structure
>pdb|1J49|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
>pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|4EBF|A Chain A, Semet Thermostable Phosphite Dehydrogenase Glu175-Ala Mutant Length = 334 Back     alignment and structure
>pdb|4E5M|A Chain A, Thermostable Phosphite Dehydrogenase E175aA176R IN COMPLEX WITH NADP Length = 329 Back     alignment and structure
>pdb|4E5K|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad And Sulfite Length = 329 Back     alignment and structure
>pdb|4E5P|A Chain A, Thermostable Phosphite Dehydrogenase A176r Variant In Complex With Nad Length = 332 Back     alignment and structure
>pdb|4E5N|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad Length = 330 Back     alignment and structure
>pdb|1PSD|A Chain A, The Allosteric Ligand Site In The Vmax-Type Cooperative Enzyme Phosphoglycerate Dehydrogenase Length = 409 Back     alignment and structure
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404 Back     alignment and structure
>pdb|2YQ4|A Chain A, Crystal Structure Of D-isomer Specific 2-hydroxyacid Dehydrogenase From Lactobacillus Delbrueckii Ssp. Bulgaricus Length = 343 Back     alignment and structure
>pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
>pdb|3FN4|A Chain A, Apo-form Of Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c-1 In Closed Conformation Length = 401 Back     alignment and structure
>pdb|2GSD|A Chain A, Nad-dependent Formate Dehydrogenase From Bacterium Moraxella Sp.c2 In Complex With Nad And Azide Length = 402 Back     alignment and structure
>pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
>pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
>pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>pdb|2GUG|A Chain A, Nad-dependent Formate Dehydrogenase From Pseudomonas Sp.101 In Complex With Formate Length = 401 Back     alignment and structure
>pdb|2GO1|A Chain A, Nad-Dependent Formate Dehydrogenase From Pseudomonas Sp.101 Length = 401 Back     alignment and structure
>pdb|2NAC|A Chain A, High Resolution Structures Of Holo And Apo Formate Dehydrogenase Length = 393 Back     alignment and structure
>pdb|1YBA|A Chain A, The Active Form Of Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|3HG7|A Chain A, Crystal Structure Of D-Isomer Specific 2-Hydroxyacid Dehydrogenase Family Protein From Aeromonas Salmonicida Subsp. Salmonicida A449 Length = 324 Back     alignment and structure
>pdb|1XDW|A Chain A, Nad+-Dependent (R)-2-Hydroxyglutarate Dehydrogenase From Acidaminococcus Fermentans Length = 331 Back     alignment and structure
>pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 Back     alignment and structure
>pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 Back     alignment and structure
>pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure
>pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 Back     alignment and structure
>pdb|3NAQ|A Chain A, Apo-Form Of Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabidopsis Thaliana Length = 357 Back     alignment and structure
>pdb|3N7U|A Chain A, Nad-Dependent Formate Dehydrogenase From Higher-Plant Arabid Thaliana In Complex With Nad And Azide Length = 351 Back     alignment and structure
>pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 Back     alignment and structure
>pdb|3GG9|A Chain A, Crystal Structure Of Putative D-3-Phosphoglycerate Dehydrogenase Oxidoreductase From Ralstonia Solanacearum Length = 352 Back     alignment and structure
>pdb|2O4C|A Chain A, Crystal Structure Of D-erythronate-4-phosphate Dehydrogenase Complexed With Nad Length = 380 Back     alignment and structure
>pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 Back     alignment and structure
>pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query632
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 3e-35
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 1e-33
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 2e-33
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 9e-33
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 1e-32
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 4e-32
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 2e-31
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 2e-31
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 3e-31
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 4e-31
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 6e-31
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 2e-30
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 4e-30
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 1e-29
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 1e-28
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 3e-28
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 2e-27
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 4e-25
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 7e-25
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 2e-24
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 4e-24
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 2e-23
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 6e-23
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 4e-22
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 2e-21
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 3e-21
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 2e-20
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 5e-20
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 3e-18
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 1e-17
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 2e-17
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 9e-05
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
 Score =  134 bits (339), Expect = 3e-35
 Identities = 42/226 (18%), Positives = 81/226 (35%), Gaps = 17/226 (7%)

Query: 115 AEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASA 174
           A+ +A+  +ALLL   +R        +    +   V      +   +G  + ++G     
Sbjct: 83  ADAVAEFALALLLAPYKRIIQYGE-KMKRGDYGRDV-----EIPLIQGEKVAVLGLGEIG 136

Query: 175 RALATRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQ 234
             +     +    V  F     K         R  ++L + L  +        +   T  
Sbjct: 137 TRVGKILAALGAQVRGFS-RTPK-----EGPWRFTNSLEEALREARAAVCALPLNKHTRG 190

Query: 235 IINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALD--GAEGPQWMEAWVR 292
           ++  + L  +   A  VN G +++LD   V ++L +      A D          +A   
Sbjct: 191 LVKYQHLALMAEDAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAEFF 250

Query: 293 EMPNVLILP--RSADYSEEVWMEIRDKAISVLQTFFFDGVIPKNAI 336
            +PNV+  P       +E VW ++  +A+  L T +  G  P+N  
Sbjct: 251 SLPNVVATPWVAGGYGNERVWRQMVMEAVRNLIT-YATGGRPRNIA 295
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 100.0
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 100.0
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 100.0
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 100.0
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 100.0
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 100.0
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 100.0
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 100.0
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 100.0
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 100.0
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 100.0
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 100.0
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 100.0
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 100.0
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 100.0
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 100.0
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 100.0
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 100.0
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 100.0
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 100.0
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 100.0
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 100.0
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 100.0
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 100.0
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 100.0
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 100.0
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 100.0
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 100.0
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 100.0
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 100.0
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 100.0
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 100.0
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.97
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 99.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.93
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.89
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 99.86
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.85
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 99.74
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 99.73
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 99.65
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.63
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 99.59
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.57
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.53
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 99.52
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.35
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.32
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.3
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.27
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.27
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.22
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.21
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.2
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.19
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.16
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.16
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.14
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.13
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.13
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.09
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.09
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.08
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 99.05
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.05
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.03
4ezb_A317 Uncharacterized conserved protein; structural geno 99.01
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 98.99
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.98
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 98.97
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.97
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.96
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.95
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.94
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 98.94
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.92
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 98.91
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.91
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 98.88
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 98.84
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.33
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 98.82
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.81
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.81
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.81
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 98.8
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.76
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 98.75
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.73
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.68
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 98.67
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 98.64
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.63
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.61
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.57
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 98.57
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.56
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.56
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.55
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 98.52
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.51
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 98.48
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.47
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.47
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 98.42
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.42
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 98.4
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.39
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.38
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 98.36
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 98.34
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.32
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.3
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.3
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 98.28
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.28
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.26
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.25
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 98.22
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.22
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.21
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 98.21
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.2
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 98.19
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.18
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 98.18
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.16
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.16
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 98.15
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.14
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.14
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.14
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 98.14
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 98.14
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.13
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.13
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 98.12
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.12
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.11
2duw_A145 Putative COA-binding protein; ligand binding prote 98.1
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.1
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.09
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.07
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.03
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 97.97
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.96
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.89
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.86
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.84
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.84
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.78
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.77
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.71
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.7
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.69
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.66
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.64
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 97.62
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.58
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 97.58
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 97.57
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.55
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.53
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.51
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.51
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.5
1iuk_A140 Hypothetical protein TT1466; structural genomics, 97.5
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.49
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.49
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 97.47
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.43
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.43
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 97.42
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.4
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.39
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.36
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.32
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.29
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.27
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.27
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.26
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.22
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 97.2
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.18
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.18
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.16
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.12
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.1
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.08
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.07
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.06
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.06
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.04
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.03
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.02
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.01
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.0
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.0
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.98
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.98
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.97
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.96
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.95
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 96.93
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.93
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.92
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 96.9
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.89
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 96.86
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.86
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.83
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 96.81
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.8
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.76
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.75
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.75
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 96.74
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.72
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 96.69
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 96.69
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.65
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.65
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 96.6
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.56
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.55
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.55
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.55
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.53
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.51
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.48
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.47
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.45
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.45
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 96.45
1ydw_A362 AX110P-like protein; structural genomics, protein 96.44
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.43
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.41
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 96.41
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.38
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 96.38
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.38
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.37
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.36
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.35
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.32
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.3
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.3
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 96.28
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 96.27
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 96.26
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.26
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 96.23
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.22
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.21
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.19
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.18
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.18
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.18
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 96.15
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.12
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.11
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.1
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.09
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.07
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.06
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 96.06
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.06
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 96.04
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 96.02
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.99
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.97
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 95.94
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 95.91
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 95.91
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 95.9
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.84
1oth_A321 Protein (ornithine transcarbamoylase); transferase 95.81
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.79
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.79
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 95.78
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 95.71
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.68
3tl2_A315 Malate dehydrogenase; center for structural genomi 95.67
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.66
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.66
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 95.64
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.62
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.6
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.58
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 95.57
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.57
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 95.54
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.53
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 95.5
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.48
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 95.47
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 95.46
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.46
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 95.44
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.41
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.4
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 95.4
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 95.39
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 95.35
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.33
3on5_A362 BH1974 protein; structural genomics, joint center 95.32
3btv_A438 Galactose/lactose metabolism regulatory protein GA 95.25
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 95.24
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 95.24
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 95.24
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.24
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.24
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 95.22
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 95.22
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.21
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.2
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.18
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.18
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.18
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 95.17
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.15
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.15
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 95.13
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.13
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 95.1
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 95.09
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.07
3slg_A372 PBGP3 protein; structural genomics, seattle struct 95.07
4had_A350 Probable oxidoreductase protein; structural genomi 95.03
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 95.02
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 95.01
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.01
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 95.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 94.99
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.98
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 94.97
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 94.97
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.96
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.96
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.94
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.9
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.9
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 94.9
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.88
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 94.88
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.83
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 94.77
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 94.76
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 94.76
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.75
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.75
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 94.74
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.72
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 94.71
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 94.7
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.62
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 94.62
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 94.6
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.6
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 94.57
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.57
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.56
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.56
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 94.56
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.54
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 94.51
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.5
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.5
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 94.48
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.44
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 94.43
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.41
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 94.4
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.4
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 94.4
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 94.38
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.37
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 94.36
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 94.35
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.34
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.31
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.31
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 94.31
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 94.25
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.25
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 94.23
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 94.23
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.21
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 94.19
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 94.19
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.18
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.17
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 94.16
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 94.14
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 94.13
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.11
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.1
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 94.1
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 94.1
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 94.1
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 94.08
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 94.07
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 94.07
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 94.06
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 94.03
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 94.03
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 94.03
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.01
1lnq_A336 MTHK channels, potassium channel related protein; 93.98
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 93.97
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 93.95
1ooe_A236 Dihydropteridine reductase; structural genomics, P 93.95
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 93.94
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.93
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 93.9
4eye_A342 Probable oxidoreductase; structural genomics, niai 93.89
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 93.87
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.85
1xq6_A253 Unknown protein; structural genomics, protein stru 93.85
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 93.83
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 93.83
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 93.82
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 93.81
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 93.8
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.8
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.77
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 93.75
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.74
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 93.73
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 93.72
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 93.69
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 93.68
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 93.65
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 93.62
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 93.61
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 93.6
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.57
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.54
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 93.51
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 93.45
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.43
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 93.42
4gx0_A565 TRKA domain protein; membrane protein, ION channel 93.41
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.41
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 93.4
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 93.4
3gms_A340 Putative NADPH:quinone reductase; structural genom 93.38
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 93.37
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 93.32
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.32
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 93.3
3oqb_A383 Oxidoreductase; structural genomics, protein struc 93.28
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 93.25
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 93.23
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 93.2
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 93.17
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 93.17
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 93.16
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 93.15
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 93.15
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 93.13
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.12
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 93.09
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 93.08
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 93.06
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 93.03
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 92.97
4h3v_A390 Oxidoreductase domain protein; structural genomics 92.95
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 92.94
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 92.93
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 92.87
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.84
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 92.8
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.78
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 92.78
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 92.76
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 92.71
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.71
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 92.68
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 92.68
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 92.67
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.66
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 92.65
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 92.64
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 92.59
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 92.58
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 92.56
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 92.56
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 92.55
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 92.54
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 92.53
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 92.52
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 92.51
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 92.51
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 92.5
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
Probab=100.00  E-value=5.5e-64  Score=529.27  Aligned_cols=299  Identities=22%  Similarity=0.348  Sum_probs=259.6

Q ss_pred             CchHHhhccCCc-eEEecCCCCCcccccccceEEEEecCCCCCHHHHhcCCCceEEEEecccCCccchHHHHhcCcEEEE
Q 006758           31 CVLEQDSLAGVA-LVEHVPLGRLADGKIEAAAAVLLHSLAYLPRAAQRRLRPYQLILCLGSSDRTVDSALAADLGLRLIH  109 (632)
Q Consensus        31 ~~~e~e~L~~la-eV~~~~~~~l~e~~i~dAdaIli~s~~~L~~evL~~lp~LK~I~~~gaG~D~VD~~aa~erGI~VtN  109 (632)
                      .++..+.|+++. ++...+...+++..+.+||+++++...++++++++++|+||+|+++|+|+||||+++|+++||.|+|
T Consensus        13 ~p~~~e~l~~~~~~~~~~~~~~~~~~~l~~ad~i~v~~~~~i~~~~l~~~p~Lk~I~~~~~G~d~id~~~~~~~gI~v~n   92 (334)
T 3kb6_A           13 VPFYQEALKDLSLKIYTTDVSKVPENELKKAELISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHIDLDYCKKKGILVTH   92 (334)
T ss_dssp             HHHHHHHTTTSCEEECSSCGGGSCHHHHHHCSEEEECTTSCBCHHHHHTCTTCCEEEESSSCCTTBCHHHHHHHTCEEEC
T ss_pred             CHHHHHHHHhCCcEEEeCCcccCCHHHhcCCCEEEEeCCCCCCHHHHhcCCCCcEEEECCcccchhcHHHHHHCCCEEEE
Confidence            345567788773 2222233445566788999999998889999999999999999999999999999999999999999


Q ss_pred             cCCCChHHHHHHHHHHHHHHHhhcHHHHHHHHHhcCCCCCCCCCCCccccccCcEEEEEeCChhhHHHHHHHhhCCCEEE
Q 006758          110 VDTSRAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVL  189 (632)
Q Consensus       110 vpg~na~aVAE~ALaliLal~Rrl~~~~~~~~~~g~W~~~~~~~~~~~~~L~GktVGIIGlG~IG~~vA~~LkafGm~V~  189 (632)
                      +|++++.+||||+++++|+++|++..+... .+.+.|.....   ...++|.|+||||||+|+||+.+|+++++|||+|+
T Consensus        93 ~p~~~~~~vAE~~~~l~L~~~r~~~~~~~~-~~~~~~~~~~~---~~~~~l~g~tvGIiG~G~IG~~va~~~~~fg~~v~  168 (334)
T 3kb6_A           93 IPAYSPESVAEHTFAMILTLVKRLKRIEDR-VKKLNFSQDSE---ILARELNRLTLGVIGTGRIGSRVAMYGLAFGMKVL  168 (334)
T ss_dssp             CTTSCHHHHHHHHHHHHHHHHTTHHHHHHH-HHTTCCCCCGG---GCBCCGGGSEEEEECCSHHHHHHHHHHHHTTCEEE
T ss_pred             CCCcCcHHHHHHHHHHHHHHhhcccccccc-ccccccccccc---cccceecCcEEEEECcchHHHHHHHhhcccCceee
Confidence            999999999999999999999999998886 47778764322   23468999999999999999999999999999999


Q ss_pred             EECCCCCCCCcccccCceecCCHHHHhccCCEEEEccCCChhhHhhccHHHHhccCCCcEEEEcCCChhhcHHHHHHHHH
Q 006758          190 YFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLI  269 (632)
Q Consensus       190 ~~dr~~~~~~~~~~~g~~~~~sL~eLL~~ADVV~l~lPlT~~T~~lI~~~~L~~MK~GAvLINvgRG~iVDe~AL~~AL~  269 (632)
                      +||++.....   ......+.+|+++|++||||++|||+|++|+||||++.|++||+|++|||+|||++||++||++||+
T Consensus       169 ~~d~~~~~~~---~~~~~~~~~l~ell~~sDivslh~Plt~~T~~li~~~~l~~mk~~a~lIN~aRG~iVde~aL~~aL~  245 (334)
T 3kb6_A          169 CYDVVKREDL---KEKGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDALYRAYQ  245 (334)
T ss_dssp             EECSSCCHHH---HHTTCEECCHHHHHHHCSEEEECCCCCTTTTTCBCHHHHHHSCTTEEEEECSCGGGBCHHHHHHHHH
T ss_pred             ecCCccchhh---hhcCceecCHHHHHhhCCEEEEcCCCChhhccCcCHHHHhhcCCCeEEEecCccccccHHHHHHHHH
Confidence            9998764321   1122345799999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcceEEeecCCC-CCCCCc---------------cccCCCcEEEcCCCCCccHHHHHHHHHHHHHHHHHHHHcCCCCC
Q 006758          270 DGTLAGCALDGAEG-PQWMEA---------------WVREMPNVLILPRSADYSEEVWMEIRDKAISVLQTFFFDGVIPK  333 (632)
Q Consensus       270 sg~I~GAaLDVfE~-P~~~~~---------------pL~~~pNVIiTPHiAg~T~ea~~~~~~~a~~nL~~fL~~G~~p~  333 (632)
                      +|+|+||+||||++ |++.++               |||.+|||++|||+||+|.+++.++.+.+++||.+|+ +|++|.
T Consensus       246 ~g~i~gA~LDV~~~EPl~~~~~~~~~~~~~~~~~~~~L~~~~nvilTPHia~~T~ea~~~~~~~~~~ni~~~l-~Ge~~~  324 (334)
T 3kb6_A          246 RGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKSLERIREETVKVVKAFV-KGDLEQ  324 (334)
T ss_dssp             TTCEEEEEESCCTTHHHHHTTGGGGTCCCHHHHHHHHHHTSTTEEECCSCTTCBHHHHHHHHHHHHHHHHHHH-HTCGGG
T ss_pred             hCCceEEEEeCCCCCCCcccccccccccccccccchhhccCCCEEECCchhhChHHHHHHHHHHHHHHHHHHH-cCCCCc
Confidence            99999999999997 544333               6899999999999999999999999999999999997 798766


Q ss_pred             cccc
Q 006758          334 NAIS  337 (632)
Q Consensus       334 nvVn  337 (632)
                      ..+|
T Consensus       325 ~~~n  328 (334)
T 3kb6_A          325 IKGN  328 (334)
T ss_dssp             GGGG
T ss_pred             CCCC
Confidence            5444
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 632
d1gdha1191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp 2e-24
d1mx3a1193 c.2.1.4 (A:126-318) Transcription corepressor CtbP 5e-21
d1ygya1184 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase 9e-21
d2naca1188 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudom 1e-19
d1sc6a1188 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase 3e-17
d1dxya1199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro 2e-10
d1qp8a1181 c.2.1.4 (A:83-263) Putative formate dehydrogenase 8e-09
d1j4aa1197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto 1e-07
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 4e-06
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: D-glycerate dehydrogenase
species: Hyphomicrobium methylovorum [TaxId: 84]

 Score = 98.8 bits (245), Expect = 2e-24
 Identities = 54/183 (29%), Positives = 76/183 (41%), Gaps = 2/183 (1%)

Query: 119 ADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALA 178
           A+  M LLLG  RR        +    W G  +PL     +     LGI G  +  +ALA
Sbjct: 6   AEIAMLLLLGSARRAGE-GEKMIRTRSWPGW-EPLELVGEKLDNKTLGIYGFGSIGQALA 63

Query: 179 TRSLSFKMSVLYFDVPEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINA 238
            R+  F M + YFD             A   D+L+ LL+ S   SL+   T ET    N 
Sbjct: 64  KRAQGFDMDIDYFDTHRASSSDEASYQATFHDSLDSLLSVSQFFSLNAPSTPETRYFFNK 123

Query: 239 ECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTLAGCALDGAEGPQWMEAWVREMPNVL 298
             ++ +  GA +VNT    L+D+  V   L  G LA    D   G   +     ++PN  
Sbjct: 124 ATIKSLPQGAIVVNTARGDLVDNELVVAALEAGRLAYAGFDVFAGEPNINEGYYDLPNTF 183

Query: 299 ILP 301
           + P
Sbjct: 184 LFP 186
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query632
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 100.0
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 100.0
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 100.0
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 100.0
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 100.0
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 100.0
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 100.0
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 100.0
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.81
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.73
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.7
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.68
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.65
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.64
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.61
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.51
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.5
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.4
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.38
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.29
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.29
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 99.24
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.13
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.88
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.86
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.84
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.71
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.54
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.52
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.42
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 98.38
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.32
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.15
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.05
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.05
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.03
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.03
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.0
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.88
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.88
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.85
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.77
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.76
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.73
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.71
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.7
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.64
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.56
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.52
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.51
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.5
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.42
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.13
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.09
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.07
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 97.04
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.01
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.0
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.98
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.91
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.91
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.82
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.78
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.77
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.74
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.74
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.73
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.71
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.7
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.69
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.65
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.63
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.51
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.46
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.43
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.43
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.4
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.37
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.36
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.34
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.28
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.27
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.25
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.15
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.14
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.14
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.13
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.06
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.06
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.05
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.0
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.98
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 95.89
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 95.81
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 95.8
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.72
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.68
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.67
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.65
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.58
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.51
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.43
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.39
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 95.36
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.34
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.3
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.27
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 95.26
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.25
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 95.14
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 95.13
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.12
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.11
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.08
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 95.07
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.99
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.74
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 94.73
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 94.7
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.6
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.55
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.5
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 94.45
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 94.43
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.3
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.25
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 94.19
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 94.15
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.14
d1dfca3123 Fascin {Human (Homo sapiens) [TaxId: 9606]} 94.08
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.94
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.66
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.59
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 93.57
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.44
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 93.43
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 93.41
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.23
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.23
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.21
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.15
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 93.13
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.11
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.08
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.04
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.02
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 93.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 92.93
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.74
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.74
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.59
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 92.59
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 92.57
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.5
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.43
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.3
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 92.28
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.27
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.27
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 92.24
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 92.2
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.18
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.13
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.1
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 92.09
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.06
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 92.04
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.02
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.91
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.85
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.79
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.78
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 91.77
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 91.75
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 91.67
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.6
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.59
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.54
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 91.52
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.52
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 91.51
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 91.42
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.35
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 91.29
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.14
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 91.02
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 90.96
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 90.93
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.92
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 90.9
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.86
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.81
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.75
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 90.75
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.72
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.63
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 90.51
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 90.51
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 90.51
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 90.4
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.34
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.3
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 90.28
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.28
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.21
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 90.13
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.98
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.8
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 89.78
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 89.74
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 89.72
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.68
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.6
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 89.48
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 89.47
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.43
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 89.35
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 89.11
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 88.82
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.82
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.82
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.8
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 88.75
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 88.43
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 88.33
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 88.28
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 88.25
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 88.02
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 88.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 87.74
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 87.51
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 87.47
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 87.33
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 87.32
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 87.26
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.23
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 87.2
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 87.15
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.94
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 86.91
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.33
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 86.18
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 85.94
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 85.92
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 85.92
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 85.8
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 85.72
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 85.64
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 85.52
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 85.45
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 85.39
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 85.35
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 85.24
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 84.95
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 84.82
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 84.7
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 83.73
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 83.41
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 83.19
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 82.13
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.12
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 82.04
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 82.04
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 81.87
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 81.63
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 81.49
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 81.39
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 81.15
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 80.66
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 80.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 80.19
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 80.13
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=3.8e-47  Score=367.48  Aligned_cols=184  Identities=26%  Similarity=0.357  Sum_probs=165.0

Q ss_pred             ChHHHHHHHHHHHHHHHhhcHHHHHHHHHhcCCCCCCCCCCCccccccCcEEEEEeCChhhHHHHHHHhhCCCEEEEECC
Q 006758          114 RAEEIADTVMALLLGLLRRTHLLARHALSASGWLGSVQPLCRGMRRCRGLVLGIVGRSASARALATRSLSFKMSVLYFDV  193 (632)
Q Consensus       114 na~aVAE~ALaliLal~Rrl~~~~~~~~~~g~W~~~~~~~~~~~~~L~GktVGIIGlG~IG~~vA~~LkafGm~V~~~dr  193 (632)
                      |+.+||||+|++||++.|+++.++.. .+.+.|....    ....++.|+++||||+|.||+.+|+++++|||+|++||+
T Consensus         1 N~~sVAE~~~~liL~~~R~i~~~~~~-~~~~~W~~~~----~~~~~l~~k~vgiiG~G~IG~~va~~~~~fg~~v~~~d~   75 (184)
T d1ygya1           1 NIHSAAEHALALLLAASRQIPAADAS-LREHTWKRSS----FSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDP   75 (184)
T ss_dssp             SHHHHHHHHHHHHHHHHTTHHHHHHH-HHTTCCCGGG----CCBCCCTTCEEEEECCSHHHHHHHHHHHTTTCEEEEECT
T ss_pred             CchHHHHHHHHHHHHHHcCHHHHHHH-HHhCCCCccc----cccccccceeeeeccccchhHHHHHHhhhccceEEeecC
Confidence            67899999999999999999999887 5889997532    223679999999999999999999999999999999999


Q ss_pred             CCCCCCcccccCceecCCHHHHhccCCEEEEccCCChhhHhhccHHHHhccCCCcEEEEcCCChhhcHHHHHHHHHcCCc
Q 006758          194 PEGKGKVTFPSAARRMDTLNDLLAASDVISLHCAVTDETIQIINAECLQHIKPGAFLVNTGSSQLLDDCAVKQLLIDGTL  273 (632)
Q Consensus       194 ~~~~~~~~~~~g~~~~~sL~eLL~~ADVV~l~lPlT~~T~~lI~~~~L~~MK~GAvLINvgRG~iVDe~AL~~AL~sg~I  273 (632)
                      +..... ....+ ....++++++++||+|++|||+|++|++|||++.|+.||+|++|||+|||++||++||++||++|+|
T Consensus        76 ~~~~~~-~~~~~-~~~~~l~ell~~sDiv~~~~Plt~~T~~lin~~~l~~mk~~a~lIN~sRG~iVde~aL~~aL~~~~i  153 (184)
T d1ygya1          76 YVSPAR-AAQLG-IELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHV  153 (184)
T ss_dssp             TSCHHH-HHHHT-CEECCHHHHHHHCSEEEECCCCSTTTTTCBCHHHHTTSCTTEEEEECSCTTSBCHHHHHHHHHTSSE
T ss_pred             CCChhH-HhhcC-ceeccHHHHHhhCCEEEEcCCCCchhhhhhhHHHHhhhCCCceEEEecchhhhhhHHHHHHHhcCcE
Confidence            864332 11122 3457999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEeecCCCCCCCCccccCCCcEEEcCCCC
Q 006758          274 AGCALDGAEGPQWMEAWVREMPNVLILPRSA  304 (632)
Q Consensus       274 ~GAaLDVfE~P~~~~~pL~~~pNVIiTPHiA  304 (632)
                      +||+||||++||.+++|||++|||++|||||
T Consensus       154 ~~a~lDV~~~EP~~~~~l~~~~nviiTPHIG  184 (184)
T d1ygya1         154 RAAGLDVFATEPCTDSPLFELAQVVVTPHLG  184 (184)
T ss_dssp             EEEEESSCSSSSCSCCGGGGCTTEEECSSCS
T ss_pred             eEEEEeCCCCCCCCCchHhcCCCEEECCCCC
Confidence            9999999998666689999999999999997
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure