Citrus Sinensis ID: 006831

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMHRSGDELIEEAS
cccccHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHccccHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccc
cccEEEEEcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEcEEEEEcccccHHccEEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccEEEEccccccEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHccHcccccccccccccccccccccHHHHHHHHHHcccccEccccccEcccEEEccccEEEcHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcc
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRqclngslgspsgdnvkpfprnsNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLdsrgllyyyrkpwswnsaagsqssiqrsnpsetsqGLLSRWLSshyhggvhdeksVARHTVNLLTstikpdadqsdlrfcfriisptkvytlqaentlDQMDWIEKINGVIASLLsfqtpervnvkhclssgpkesfdrcfiresgllvdspyvdqttieehasknitggdhlhsskslgdleyivknekpIDLLRRvygnnkcadcgasepdwaslNLGVLICIQCsgvhrnlgVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIgnnsltderhmgfsrtdKQKRFivrkpnpddsisvkEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIIcsepnvnaihgqasygkrlplaTVMEMEeherddkkidcfdgdtlddplsyLNSMHRSGDELIEEAS
MASIFFTvafngdgnfvLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNgslgspsgdnvkpFPRNSNKLIEAAMQSAVKGKVQTIKQgylskrssnlradwkrRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTstikpdadqsdLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHasknitggdhlHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNnsltderhmgfsrtdkqkrfivrkpnpddsisvkEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICsepnvnaihgqasygkrLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNsmhrsgdelieeas
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMHRSGDELIEEAS
***IFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQ*******************************************************************TIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWN*********************LSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIE*****************SLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSL***************************ISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATV**************CF***************************
***IFFTVAFNGDGNFVLQ************************HNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQ*****************************************************************************************FVLDSRGLLYY*********************************************************************************************DWI********************************************************************************************RVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIG************************************QYIHAKYAEKI*********************VRDNDKKAVYRQIICSEP***************************************************************
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNS*******************LLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMHRS*********
**SIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRE*************************************GKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSW*******SSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS*****************************GLLV**P*VDQTTIEEHASK*I********************NEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRI*******************************SISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEH*****KIDCFDGD************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIFFTVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMHRSGDELIEEAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query629 2.2.26 [Sep-21-2011]
Q9FIT8828 ADP-ribosylation factor G yes no 0.952 0.723 0.648 0.0
Q5W7F2827 ADP-ribosylation factor G no no 0.903 0.686 0.631 0.0
Q9SMX5775 ADP-ribosylation factor G no no 0.786 0.638 0.443 1e-123
Q9C6C3776 ADP-ribosylation factor G no no 0.785 0.636 0.445 1e-118
Q96P50 834 Arf-GAP with coiled-coil, yes no 0.556 0.419 0.290 5e-43
Q5ZK62 781 Arf-GAP with coiled-coil, yes no 0.562 0.453 0.278 7e-42
Q6ZQK5 770 Arf-GAP with coiled-coil, no no 0.581 0.475 0.286 5e-39
Q5FVC7 770 Arf-GAP with coiled-coil, yes no 0.581 0.475 0.286 7e-39
Q6IVG4 778 Arf-GAP with coiled-coil, yes no 0.565 0.457 0.283 4e-38
Q15057 778 Arf-GAP with coiled-coil, no no 0.565 0.457 0.281 5e-38
>sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 Back     alignment and function desciption
 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/612 (64%), Positives = 473/612 (77%), Gaps = 13/612 (2%)

Query: 19  QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
           QAREK+LSLRKSTR+DVA  IEEDLH+ART+FEQARF+LV ALSN E+KKRFE LEAV G
Sbjct: 134 QAREKYLSLRKSTRLDVAATIEEDLHSARTTFEQARFHLVSALSNAESKKRFEFLEAVSG 193

Query: 79  TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
           TMDAHLRFFKQGYELLHQMEPFINQVLAYA QSREC++YE ASL++RMQ+Y +Q+DRE+R
Sbjct: 194 TMDAHLRFFKQGYELLHQMEPFINQVLAYAHQSRECANYEMASLNERMQEYQRQVDRETR 253

Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
                S  SP+GD ++   RNS K+IEA MQSA KGKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 N----SCVSPTGDGMRHNSRNSQKVIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRR 309

Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSV 258
           FF+LDSRG+LYYYRKPW+W+S  GS+S + R+  SE S GLLSRWLSSHYHGGVHDEK V
Sbjct: 310 FFILDSRGMLYYYRKPWNWSSGNGSRSVVHRNMASENSPGLLSRWLSSHYHGGVHDEKPV 369

Query: 259 ARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS 318
           ARHTVNLLTSTIK DADQ+DLRFCFRIISPTKVYTLQAEN  DQMDWIEKI GVIASLLS
Sbjct: 370 ARHTVNLLTSTIKVDADQTDLRFCFRIISPTKVYTLQAENAQDQMDWIEKITGVIASLLS 429

Query: 319 FQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKN-ITGGDHLHS 377
           FQTPER  ++     G     D     +SG L D   ++Q    E   ++ +TGG+    
Sbjct: 430 FQTPERAIMRLSTVDGG----DTFSASDSGSLADPYDIEQAESGESTVEHPMTGGNRSRF 485

Query: 378 SKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLG 437
           S  L   + +VK EKPID+L RV GN +CADCGA EPDWASLNLGVLICI+CSG+HRNLG
Sbjct: 486 SGCLQQHD-MVKTEKPIDVLTRVLGNERCADCGAPEPDWASLNLGVLICIECSGIHRNLG 544

Query: 438 VHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDK 497
           VHISKVRSLTLDVKVWEPSVL LFQSLGN+Y NSVWEELL   + + +  R  G  ++D+
Sbjct: 545 VHISKVRSLTLDVKVWEPSVLTLFQSLGNVYVNSVWEELLNSESRTSSASRSSGTPKSDR 604

Query: 498 QKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAV 557
            ++ +VRKP  +D ISVKE +IHAKY+E+IFV K  D  H  +V Q++WE+VR NDKK+V
Sbjct: 605 PRKLLVRKPGFNDPISVKELFIHAKYSERIFVRKAIDSQHFQAVFQEIWENVRANDKKSV 664

Query: 558 YRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSM 617
           YR I+CSE +VNA+ GQASY   LPL+ +M+MEE    + K    + +  ++P  Y NS 
Sbjct: 665 YRHIVCSEADVNALRGQASYTVSLPLSKMMQMEETL--EAKFKSIEEEFQENPAGYSNS- 721

Query: 618 HRSGDELIEEAS 629
              G+ ++ E +
Sbjct: 722 RGDGESMVREET 733
Probable GTPase-activating protein (By similarity). Regulator of membrane trafficking. Required for maintaining a straight growth of root hairs.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 Back     alignment and function description
>sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 Back     alignment and function description
>sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 Back     alignment and function description
>sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query629
255540067 818 gcn4-complementing protein, putative [Ri 0.941 0.723 0.704 0.0
334188557 828 ARF-GAP domain 1 protein [Arabidopsis th 0.952 0.723 0.648 0.0
10176916 768 GCN4-complementing protein homolog [Arab 0.922 0.755 0.641 0.0
297793757 856 ARF-GAP domain 1 [Arabidopsis lyrata sub 0.957 0.703 0.628 0.0
296085519 832 unnamed protein product [Vitis vinifera] 0.926 0.700 0.661 0.0
359491578 822 PREDICTED: ADP-ribosylation factor GTPas 0.898 0.687 0.668 0.0
147791929 822 hypothetical protein VITISV_040393 [Viti 0.898 0.687 0.670 0.0
297734503 827 unnamed protein product [Vitis vinifera] 0.904 0.688 0.667 0.0
224072473 830 predicted protein [Populus trichocarpa] 0.925 0.701 0.655 0.0
449520667 1194 PREDICTED: ADP-ribosylation factor GTPas 0.898 0.473 0.670 0.0
>gi|255540067|ref|XP_002511098.1| gcn4-complementing protein, putative [Ricinus communis] gi|223550213|gb|EEF51700.1| gcn4-complementing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/609 (70%), Positives = 494/609 (81%), Gaps = 17/609 (2%)

Query: 19  QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
           QAR+KFLSLRKSTRMDVA  +EE+L+NA++SFE ARFNLV ALS VEAKKRFE LEAV G
Sbjct: 134 QARDKFLSLRKSTRMDVAATVEEELYNAKSSFELARFNLVSALSVVEAKKRFEFLEAVSG 193

Query: 79  TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
           TMDAHLR+FKQGYELLHQ+EPFINQVLAYAQQSRECS+YEQASL +R+Q++++QIDRES+
Sbjct: 194 TMDAHLRYFKQGYELLHQLEPFINQVLAYAQQSRECSNYEQASLSERVQEHMRQIDRESK 253

Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
             LNG LGSPSG+ ++ F RNS+K+IEA MQSA KGKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 HSLNGGLGSPSGEGMRIFARNSHKVIEAVMQSASKGKVQTIRQGYLSKRSSNLRGDWKRR 313

Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSV 258
           FFVLDSRG+LYYYRKP+SW S  GSQSS+QR+  ++   GLLSRWLSSHYHGGVHDEK+V
Sbjct: 314 FFVLDSRGMLYYYRKPFSWTSVTGSQSSVQRNVAADNGPGLLSRWLSSHYHGGVHDEKTV 373

Query: 259 ARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS 318
           ARHTVNLLTSTIK DADQSDLRFCFRIISP KVYTLQAEN LDQMDWIEKI GVI SLLS
Sbjct: 374 ARHTVNLLTSTIKVDADQSDLRFCFRIISPVKVYTLQAENALDQMDWIEKITGVITSLLS 433

Query: 319 FQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSS 378
           FQTPER      LS+G + S DR  I E   LVDSP  DQT IE+  S  I    HLHSS
Sbjct: 434 FQTPERR-----LSTGHRGSGDRPTISEGSSLVDSPDNDQTDIEDFTSNIIPPRSHLHSS 488

Query: 379 KSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGV 438
           K     EY +++EKPID+LR V GN+KCADCGA EPDWASLNLGVLICI+CSGVHRNLGV
Sbjct: 489 KLSQQQEYCMRSEKPIDVLRSVPGNDKCADCGAPEPDWASLNLGVLICIECSGVHRNLGV 548

Query: 439 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQ 498
           HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELL+   +   D+   GFS++D+Q
Sbjct: 549 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLQSRTSFTADDMAKGFSKSDRQ 608

Query: 499 KRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVY 558
           K F +RKP+ DD I+VKEQ+IHAKYAEKIF+HK KD  HLL VA+Q+WESV  NDKKAVY
Sbjct: 609 KLFHIRKPSHDDPIAVKEQFIHAKYAEKIFIHKIKDDQHLLPVAEQVWESVYANDKKAVY 668

Query: 559 RQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMH 618
           R I+CS  +VNAIHGQAS+     L +V++ ++ E  D   DC            L S++
Sbjct: 669 RHIVCSGADVNAIHGQASFSTSSSLTSVIQYKQQENLDLNFDC------------LQSLN 716

Query: 619 RSGDELIEE 627
           ++ D+LI +
Sbjct: 717 KNEDQLITD 725

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|334188557|ref|NP_201004.2| ARF-GAP domain 1 protein [Arabidopsis thaliana] gi|209572799|sp|Q9FIT8.2|AGD1_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD1; Short=ARF GAP AGD1; AltName: Full=Protein ARF-GAP DOMAIN 1; Short=AtAGD1 gi|332010162|gb|AED97545.1| ARF-GAP domain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|10176916|dbj|BAB10160.1| GCN4-complementing protein homolog [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297793757|ref|XP_002864763.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] gi|297310598|gb|EFH41022.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296085519|emb|CBI29251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491578|ref|XP_002280846.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147791929|emb|CAN67895.1| hypothetical protein VITISV_040393 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734503|emb|CBI15750.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224072473|ref|XP_002303749.1| predicted protein [Populus trichocarpa] gi|222841181|gb|EEE78728.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449520667|ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query629
TAIR|locus:2183916827 SFC "SCARFACE" [Arabidopsis th 0.901 0.685 0.640 9.4e-185
TAIR|locus:2197359775 AGD4 "ARF-GAP domain 4" [Arabi 0.481 0.390 0.469 1.8e-116
TAIR|locus:2025850776 AGD2 "ARF-GAP domain 2" [Arabi 0.486 0.394 0.473 7e-113
DICTYBASE|DDB_G0276395843 acapB "Arf GTPase activating p 0.151 0.112 0.5 6.5e-39
RGD|1310711625 Acap3 "ArfGAP with coiled-coil 0.181 0.182 0.463 1.8e-36
UNIPROTKB|D4AAD1 833 Acap3 "Protein Acap3" [Rattus 0.181 0.136 0.463 1.8e-35
UNIPROTKB|F1NGZ5 834 ACAP3 "Uncharacterized protein 0.213 0.160 0.412 1.8e-35
ZFIN|ZDB-GENE-030131-1711 575 acap3a "ArfGAP with coiled-coi 0.181 0.198 0.447 2.2e-30
ZFIN|ZDB-GENE-081104-34 735 si:ch211-168b3.1 "si:ch211-168 0.152 0.130 0.495 3.5e-30
UNIPROTKB|F1NG96 764 ACAP2 "Arf-GAP with coiled-coi 0.275 0.226 0.345 6.4e-30
TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1792 (635.9 bits), Expect = 9.4e-185, P = 9.4e-185
 Identities = 372/581 (64%), Positives = 438/581 (75%)

Query:    19 QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
             QAREKFLSLRK T+ DVA  +E++LH +R+ FEQARFNLV ALSNVEAKKRFE LEAV G
Sbjct:   134 QAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVEAKKRFEFLEAVSG 193

Query:    79 TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
             TMDAHLR+FKQGYELLHQMEP+INQVL YAQQSRE S+YEQA+L+++MQ+Y +Q+DRESR
Sbjct:   194 TMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESR 253

Query:   139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
                NGS GSP+GD ++   R+S+K+I+A MQSA +GKVQTI+QGYLSKRSSNLR DWKRR
Sbjct:   254 WGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLSKRSSNLRGDWKRR 313

Query:   199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS--HYHGGVHDEK 256
             FFVLDSRG+LYYYRK  S  S +GSQ S QR N SE   GLLSRWLSS  H HGGVHDEK
Sbjct:   314 FFVLDSRGMLYYYRKQCSKPSGSGSQLSGQR-NSSELGSGLLSRWLSSNNHGHGGVHDEK 372

Query:   257 SVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASL 316
             SVARHTVNLLTSTIK DADQSDLRFCFRIISPTK YTLQAE+ LDQMDWIEKI GVIASL
Sbjct:   373 SVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASL 432

Query:   317 LSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLH 376
             LS Q PE+      + SG   S       ES     S Y D  T EE   +    G +  
Sbjct:   433 LSSQVPEQRLPGSPMGSGHHRSAS-----ESSSYESSEY-DHPTTEEFVCERSFLGYNER 486

Query:   377 SSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNL 436
              S+S      I K EKPID LR+V GN+KCADCGA EPDWASLNLGVL+CI+CSGVHRNL
Sbjct:   487 PSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNL 546

Query:   437 GVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTD 496
             GVHISKVRSLTLDVKVWEPSV++LFQ+LGN +AN+VWEELL   +    D    G + +D
Sbjct:   547 GVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFDP---GLTVSD 603

Query:   497 KQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKA 556
             K +  +  KP+  D IS+KE+YI AKYAEK+FV + +D     S AQQ+W++V  NDKKA
Sbjct:   604 KSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRRSRDSDFPQSAAQQMWDAVSGNDKKA 663

Query:   557 VYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEH-ERDD 596
             VYR I+  + +VN ++ Q S    L L+ V+ + E  +R+D
Sbjct:   664 VYRLIVNGDADVNYVYDQTS-SSSLTLSRVILVPERPKRED 703
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008060 "ARF GTPase activator activity" evidence=IEA;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0030140 "trans-Golgi network transport vesicle" evidence=IDA
GO:0035091 "phosphatidylinositol binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0010051 "xylem and phloem pattern formation" evidence=RCA;IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006897 "endocytosis" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009888 "tissue development" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010638 "positive regulation of organelle organization" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045595 "regulation of cell differentiation" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276395 acapB "Arf GTPase activating protein B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1310711 Acap3 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1711 acap3a "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-34 si:ch211-168b3.1 "si:ch211-168b3.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG96 ACAP2 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIT8AGD1_ARATHNo assigned EC number0.64860.95230.7234yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.8__2187__AT5G61980.1
annotation not avaliable (856 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
pfam01412117 pfam01412, ArfGap, Putative GTPase activating prot 7e-46
smart00105119 smart00105, ArfGap, Putative GTP-ase activating pr 9e-42
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 1e-33
cd07606202 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B 1e-29
COG5347319 COG5347, COG5347, GTPase-activating protein that r 2e-29
PLN03114 395 PLN03114, PLN03114, ADP-ribosylation factor GTPase 3e-12
smart00233102 smart00233, PH, Pleckstrin homology domain 4e-12
pfam00169101 pfam00169, PH, PH domain 2e-10
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 2e-09
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 3e-09
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 7e-09
cd07307194 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain 1e-07
smart00721239 smart00721, BAR, BAR domain 4e-06
cd13288120 cd13288, PH_Ses, Sesquipedalian family Pleckstrin 5e-06
cd01233111 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p 5e-06
cd07637200 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) 5e-06
cd07603200 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) 1e-05
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 1e-05
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 1e-05
cd13269106 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) 2e-05
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 2e-05
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 4e-05
cd13266106 cd13266, PH_Skap_family, Src kinase-associated pho 7e-05
cd07638200 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) 1e-04
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 1e-04
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 1e-04
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 1e-04
cd13251108 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin 2e-04
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 2e-04
cd13270118 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing 2e-04
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 3e-04
cd01250114 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat 4e-04
cd07631215 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) 5e-04
PLN03131 705 PLN03131, PLN03131, hypothetical protein; Provisio 6e-04
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 7e-04
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 0.001
cd01218123 cd01218, PH_Phafin2-like, Phafin2 (also called EAP 0.001
cd07601215 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) d 0.001
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 0.002
cd13267125 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub 0.003
cd07602207 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysi 0.003
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 0.004
>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf Back     alignment and domain information 
 Score =  157 bits (400), Expect = 7e-46
 Identities = 59/142 (41%), Positives = 73/142 (51%), Gaps = 25/142 (17%)

Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
           ++ +  LR++ GN  CADCGA  P WASLNLG+ ICI+CSGVHR+LGVHISKVRSLTLD 
Sbjct: 1   KRLLRELRKLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLD- 59

Query: 451 KVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDD 510
             W P  L   ++ GN  AN  WE                             + P    
Sbjct: 60  -KWTPEQLEFMKAGGNKRANEFWE-----------------------ANLPPPKPPPSSS 95

Query: 511 SISVKEQYIHAKYAEKIFVHKR 532
               +E +I AKY EK+F    
Sbjct: 96  DREKRESFIRAKYVEKLFAEAE 117

Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117
>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|153271 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>gnl|CDD|214787 smart00721, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153321 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>gnl|CDD|153287 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153322 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153315 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|153285 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153286 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 629
KOG0521 785 consensus Putative GTPase activating proteins (GAP 100.0
KOG0705749 consensus GTPase-activating protein Centaurin gamm 100.0
KOG0703287 consensus Predicted GTPase-activating protein [Sig 100.0
PF01412116 ArfGap: Putative GTPase activating protein for Arf 100.0
smart00105112 ArfGap Putative GTP-ase activating proteins for th 100.0
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 100.0
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 100.0
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 99.98
COG5347319 GTPase-activating protein that regulates ARFs (ADP 99.97
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 99.96
PLN03131 705 hypothetical protein; Provisional 99.96
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 99.93
KOG0706 454 consensus Predicted GTPase-activating protein [Sig 99.91
KOG0704 386 consensus ADP-ribosylation factor GTPase activator 99.91
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 99.88
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 99.87
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 99.87
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 99.86
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.86
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 99.85
cd07606202 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain 99.85
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 99.84
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.84
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.83
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.82
cd07632215 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.81
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.81
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.77
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.76
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.73
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 99.72
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.72
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.71
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.7
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.69
cd07641215 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.68
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.67
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.67
cd07640213 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 99.67
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.65
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.65
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.64
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.62
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.61
cd07642215 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.59
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.58
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.54
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.54
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.54
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.51
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.5
cd07609214 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domai 99.49
PF1540989 PH_8: Pleckstrin homology domain 99.41
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.41
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.38
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.38
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.31
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.29
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.27
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.23
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.23
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.22
KOG0702 524 consensus Predicted GTPase-activating protein [Sig 99.11
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.07
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.02
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.0
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.95
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 98.87
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.8
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.76
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 98.68
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.68
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.59
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.54
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.46
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.37
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.27
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.21
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.17
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 98.15
smart00721239 BAR BAR domain. 98.14
KOG3751622 consensus Growth factor receptor-bound proteins (G 97.94
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 97.73
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 97.7
PTZ00267478 NIMA-related protein kinase; Provisional 97.69
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 97.68
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.6
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.58
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.55
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.51
PTZ00283496 serine/threonine protein kinase; Provisional 97.36
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.34
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.16
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 97.15
PLN02866 1068 phospholipase D 97.14
cd07608192 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) dom 97.06
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 96.97
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 96.96
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 96.87
KOG1739 611 consensus Serine/threonine protein kinase GPBP [Si 96.76
KOG3723851 consensus PH domain protein Melted [Signal transdu 96.76
cd07595244 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) 96.67
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 96.31
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 96.03
KOG35311036 consensus Rho guanine nucleotide exchange factor C 95.77
KOG0521785 consensus Putative GTPase activating proteins (GAP 95.76
cd07593215 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom 95.7
cd07594229 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom 95.69
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 95.67
cd07618246 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of 95.39
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 94.87
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 94.76
PF15406112 PH_6: Pleckstrin homology domain 94.69
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 94.48
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.35
cd07592223 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom 94.32
cd07616229 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do 94.24
cd07591224 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o 93.82
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 93.33
cd07615223 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do 93.29
cd07613223 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do 93.19
cd07600242 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of 92.87
cd07614223 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do 92.85
cd07619248 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of 92.4
PF15404185 PH_4: Pleckstrin homology domain 92.23
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 91.91
cd07599216 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o 91.85
PF15408104 PH_7: Pleckstrin homology domain 91.81
cd07611211 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) 91.8
cd07588211 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma 91.74
PF06456229 Arfaptin: Arfaptin-like domain; InterPro: IPR01050 91.33
cd07612211 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B 91.19
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 90.93
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 90.41
cd00011203 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do 90.26
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 89.93
KOG3771460 consensus Amphiphysin [Intracellular trafficking, 89.91
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 89.62
cd07617220 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do 89.55
cd07620257 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of 89.41
KOG1737 799 consensus Oxysterol-binding protein [Lipid transpo 88.89
KOG35311036 consensus Rho guanine nucleotide exchange factor C 88.86
cd07660201 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain 88.7
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 86.2
KOG05172473 consensus Beta-spectrin [Cytoskeleton] 85.75
KOG4214117 consensus Myotrophin and similar proteins [Transcr 85.65
KOG2070661 consensus Guanine nucleotide exchange factor [Nucl 84.72
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 83.79
PF08397219 IMD: IRSp53/MIM homology domain; InterPro: IPR0136 82.79
cd05394313 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the 80.88
KOG0512228 consensus Fetal globin-inducing factor (contains a 80.7
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-67  Score=601.28  Aligned_cols=446  Identities=40%  Similarity=0.604  Sum_probs=354.0

Q ss_pred             hhhhhhHhHHHHHHHHHHhcccCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHH
Q 006831            7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRF   86 (629)
Q Consensus         7 ~~~Fe~~q~kyd~~~~ky~slsk~k~~~~~~E~a~eL~~aRk~f~~asldyv~~l~~vq~kk~~e~le~l~~~~~a~~~f   86 (629)
                      -+.||++++.||.+++||.+++|.+++.+..|.+++|+.+|+.|++.+||||.+|+.+|.||++++||++++||+||.+|
T Consensus       126 kk~f~ka~~~~d~a~~k~~~l~k~~~~~~~~e~~~~l~~~r~~f~~~~~~y~~~ln~~q~kk~~~~le~~l~~~~aq~~f  205 (785)
T KOG0521|consen  126 KKLFEKASEEYDLALVKYSRLPKKRRSKVKTEVEEELAAARRKFQLTALDYVLALNVLQAKKQFEILETLLGFMHAQINF  205 (785)
T ss_pred             hHHHHHHHhhHHHHHHHhhhhhhccccchhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccchHHHHHHHHHHHhccch
Confidence            47899999999999999999999999888899999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhHhhhhchHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCCCCCCCchHHHHH
Q 006831           87 FKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEA  166 (629)
Q Consensus        87 f~~g~e~~~~l~p~~~~l~~~~q~~r~~~~~~~~~L~~~m~~~k~qi~~~~~~s~~~~~~~ps~~~~~~~~~~~~k~~~~  166 (629)
                      |++|++++++|+||++++..++++++.+++.+++.+.++++.++.+.+...+.-  .....|++.               
T Consensus       206 F~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~~q~l~~~~~~~~~~~--~~~~~~~~~---------------  268 (785)
T KOG0521|consen  206 FKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQRYQELRSASNLESRPK--SDSASPSGG---------------  268 (785)
T ss_pred             hcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhHHHHHHHHhhhhhhcc--ccccccccc---------------
Confidence            999999999999999999999999999999999999999999988877655441  111122221               


Q ss_pred             HHhhhccCCcceeEeeeeeeccCCCCCCceeEEEEEecCceEEEEeCCCCCCCcCCCcccccCCCCCCcccccccccccc
Q 006831          167 AMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS  246 (629)
Q Consensus       167 ~~~~~~~~~~~~iKqGyL~Krs~~~~k~WkRRwFvL~~~glLyYy~~~~~~~~g~~~~~~~~~~~~~~~g~g~l~~~~~~  246 (629)
                            +........|||+++..+..+.|+||||... ++.+.|.......                             
T Consensus       269 ------~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~~~l~~~~r~~~~-----------------------------  312 (785)
T KOG0521|consen  269 ------NLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-DGQLGYQHRGADA-----------------------------  312 (785)
T ss_pred             ------cccchhhhhhhhhhhcccchhhHHhhhhhhh-ccccccccccccc-----------------------------
Confidence                  1122345689999999988899999999998 4544444322211                             


Q ss_pred             ccCCCccccccceeeEeecccceeecCCCCCCCcceEEEeeCCcEEEEEeCCHHHHHHHHHHHHHHHHHHhccCCccccc
Q 006831          247 HYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVN  326 (629)
Q Consensus       247 ~~~g~v~d~~~~~~~~i~l~~~~vk~~~d~~drrfcF~Iit~~rty~LqAeSe~E~~~WI~aI~~aI~~~l~~~~~~~~~  326 (629)
                      .           .....++.+|.|++.++..++||||+|++|+|+|+|||+|+.+.++||.+|++.|..+++...++...
T Consensus       313 ~-----------~~~~~dL~~csvk~~~~~~drr~CF~iiS~tks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~~~~~~~  381 (785)
T KOG0521|consen  313 E-----------NVLIEDLRTCSVKPDAEQRDRRFCFEIISPTKSYLLQAESEKDCQDWISALQNSILSALNSAFLGQDS  381 (785)
T ss_pred             c-----------ccccccchhccccCCcccccceeeEEEecCCcceEEecCchhHHHHHHHHHHHHHHHHHhccCccccc
Confidence            0           02456789999999888889999999999999999999999999999999999999999987776522


Q ss_pred             cccccCCCCCCCCccccccccCCccCCCCCCccchhhcccccccCCCCcCCCcccchhhhhccccchHHHHHhccCCCCC
Q 006831          327 VKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKC  406 (629)
Q Consensus       327 ~~~~l~~~p~~s~~~~~~s~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~N~~C  406 (629)
                      ...+    ..++++..+++. ..+.+.         ....++                  ..+...++..++.+|||..|
T Consensus       382 ~~~~----~~~~~~~~~~s~-~~~~s~---------~~s~~~------------------~~~~~~~~~~vq~~pgN~~c  429 (785)
T KOG0521|consen  382 TGGR----NTQSGHSSSASY-STITSA---------NTSRER------------------LNKGISVIEEVQSVPGNAQC  429 (785)
T ss_pred             ccCC----Cccccccccccc-cccccc---------cccccc------------------cccCcchhhhhhcCCchhhh
Confidence            1111    111111111110 000000         000000                  00112267889999999999


Q ss_pred             CCCCCCCCCceecccceeEeccccccccccCcccceeeEeecCCCcCChhHHHHHhhcChhHHHHHHHhhhccCCCCCcc
Q 006831          407 ADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTD  486 (629)
Q Consensus       407 aDCg~~~p~w~s~n~Gv~lC~~CsgvHR~LG~hiSkVrSl~lD~~~w~~~~l~~~~~~GN~~~N~i~e~~l~~~~~~~~~  486 (629)
                      ||||+++|+|+|+|+||.+||+||||||+|||||||||||+||  .|+++.+.+|+.+||..+|.|||+.+++..     
T Consensus       430 ~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD--~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~-----  502 (785)
T KOG0521|consen  430 CDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD--VWEPELLLLFKNLGNKYVNEIYEALLPSYD-----  502 (785)
T ss_pred             hhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh--ccCcHHHHHHHHhCcchhhhhhhccccccc-----
Confidence            9999999999999999999999999999999999999999999  599999999999999999999999998731     


Q ss_pred             ccccCccccccccccccCCCCCCCCHHHHHHHHHHHhccCcccccCCCCcch----------------hhHHHHHHHHHh
Q 006831          487 ERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHL----------------LSVAQQLWESVR  550 (629)
Q Consensus       487 ~~~~~~~~~~~~~~~~~~kP~~~~~~~~re~fI~~KY~~k~f~~~~~~~~~~----------------~~~~~~l~~av~  550 (629)
                                      ..+|.+..+...|+.||++||+++.|....+.....                ..-..+++++|.
T Consensus       503 ----------------~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  566 (785)
T KOG0521|consen  503 ----------------SSKPTASSSRQAREAWIKAKYVERRFSVKEPQIKRLYLERLLEAIKSILESASASGVQISEGVS  566 (785)
T ss_pred             ----------------ccCCCCccchhhhhHhhhcccceeeEeecccchhhhhhhhhhhhhhhhhhhhhhhhhhHhhccc
Confidence                            368888777999999999999999999997654210                122456777776


Q ss_pred             cCCHHH-HHHHHHhCCCCcccc
Q 006831          551 DNDKKA-VYRQIICSEPNVNAI  571 (629)
Q Consensus       551 ~~d~~~-~~~~l~~~gadvn~~  571 (629)
                      .++.+. ++.+++....|.+..
T Consensus       567 ~~~~~~~v~~l~~~~~~d~~~~  588 (785)
T KOG0521|consen  567 GSSREETVYHLIVSTLNDASIR  588 (785)
T ss_pred             cCCccccceeeeccCccccccc
Confidence            777665 676665544455543

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07609 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domain of fungal Snf1p-interacting protein 3 Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>cd07608 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized fungal Arf GAP proteins Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins Back     alignment and domain information
>cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A Back     alignment and domain information
>cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 Back     alignment and domain information
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 Back     alignment and domain information
>cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 Back     alignment and domain information
>cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 Back     alignment and domain information
>cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II Back     alignment and domain information
>cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins Back     alignment and domain information
>PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules Back     alignment and domain information
>cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 Back     alignment and domain information
>cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0517 consensus Beta-spectrin [Cytoskeleton] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family Back     alignment and domain information
>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
3t9k_A 390 Crystal Structure Of Acap1 C-portion Mutant S554d F 6e-27
3jue_A 368 Crystal Structure Of Arfgap And Ank Repeat Domain O 6e-27
4f1p_A 368 Crystal Structure Of Mutant S554d For Arfgap And An 6e-27
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 6e-21
3fm8_C 392 Crystal Structure Of Full Length Centaurin Alpha-1 1e-20
3feh_A 386 Crystal Structure Of Full Length Centaurin Alpha-1 1e-20
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 5e-20
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 6e-20
2iqj_A134 Crystal Structure Of The Gap Domain Of Smap1l (Loc6 2e-16
2crr_A141 Solution Structure Of Arfgap Domain From Human Smap 5e-16
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 3e-15
2p57_A144 Gap Domain Of Znf289, An Id1-Regulated Zinc Finger 3e-14
2crw_A149 Solution Structure Of The Arfgap Domain Of Adp-Ribo 9e-14
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 4e-12
3dwd_A147 Crystal Structure Of The Arfgap Domain Of Human Arf 7e-12
2q13_A385 Crystal Structure Of Bar-Ph Domain Of Appl1 Length 2e-09
2owa_A138 Crystal Structure Of Putative Gtpase Activating Pro 7e-09
2z0o_A387 Crystal Structure Of Appl1-Bar-Ph Domain Length = 3 3e-08
2elb_A396 Crystal Structure Of The Bar-Ph Domain Of Human App 6e-07
2olm_A140 Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 9e-05
2z0n_A280 Crystal Structure Of Appl1-Bar Domain Length = 280 3e-04
2q12_A265 Crystal Structure Of Bar Domain Of Appl1 Length = 2 4e-04
2d9l_A134 Solution Structure Of The Arfgap Domain Of Human Ri 9e-04
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (297), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 87/167 (52%), Gaps = 29/167 (17%)
Query: 365 ASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVL 424
            S    G   +   +  G + ++V   + +D      GN +C DC    P+WAS+NLGV 
Sbjct: 13  GSAATLGSGGMARGREPGGVGHVVAQVQSVD------GNAQCCDCREPAPEWASINLGVT 66
Query: 425 ICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSL 484
           +CIQCSG+HR+LGVH SKVRSLTLD   WEP ++ L   LGN+  N ++E          
Sbjct: 67  LCIQCSGIHRSLGVHFSKVRSLTLD--SWEPELVKLMCELGNVIINQIYEA--------- 115
Query: 485 TDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHK 531
                       + +   V+KP P  S   KE +IHAKY EK F+ K
Sbjct: 116 ------------RVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTK 150
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 Back     alignment and structure
>pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 Back     alignment and structure
>pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 Back     alignment and structure
>pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 Back     alignment and structure
>pdb|2Q13|A Chain A, Crystal Structure Of Bar-Ph Domain Of Appl1 Length = 385 Back     alignment and structure
>pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 Back     alignment and structure
>pdb|2Z0O|A Chain A, Crystal Structure Of Appl1-Bar-Ph Domain Length = 387 Back     alignment and structure
>pdb|2ELB|A Chain A, Crystal Structure Of The Bar-Ph Domain Of Human Appl1 Length = 396 Back     alignment and structure
>pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 Back     alignment and structure
>pdb|2Z0N|A Chain A, Crystal Structure Of Appl1-Bar Domain Length = 280 Back     alignment and structure
>pdb|2Q12|A Chain A, Crystal Structure Of Bar Domain Of Appl1 Length = 265 Back     alignment and structure
>pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query629
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-54
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-52
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-51
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-51
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 2e-48
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 2e-28
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 5e-48
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 3e-47
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 2e-40
2owa_A138 Arfgap-like finger domain containing protein; zinc 6e-39
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 2e-38
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 3e-37
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 1e-35
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 1e-35
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 2e-31
3o47_A329 ADP-ribosylation factor GTPase-activating protein 8e-23
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 4e-21
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 9e-21
1v5p_A126 Pleckstrin homology domain-containing, family A; T 3e-18
1wi1_A126 Calcium-dependent activator protein for secretion, 6e-18
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 9e-18
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 9e-17
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 1e-16
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 3e-16
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 4e-16
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 5e-16
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 5e-16
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 6e-16
2dkp_A128 Pleckstrin homology domain-containing family A mem 7e-16
3aj4_A112 Pleckstrin homology domain-containing family B ME; 1e-15
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 2e-15
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 2e-15
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 2e-15
2yry_A122 Pleckstrin homology domain-containing family A mem 2e-15
2d9y_A117 Pleckstrin homology domain-containing protein fami 3e-15
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 3e-15
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 1e-14
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-14
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 4e-14
2d9v_A130 Pleckstrin homology domain-containing protein fami 8e-14
1u5e_A211 SRC-associated adaptor protein; novel dimerization 1e-13
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 2e-13
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 2e-13
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 2e-13
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 4e-13
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 5e-13
3cxb_B112 Pleckstrin homology domain-containing family M mem 5e-13
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 1e-12
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 4e-11
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 4e-11
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 4e-11
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 7e-11
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 1e-10
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 1e-10
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 1e-10
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 1e-10
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 3e-10
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 4e-10
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 2e-09
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 1e-08
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 2e-08
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 2e-08
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 4e-08
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 2e-07
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 2e-07
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-07
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 5e-07
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 7e-07
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 5e-06
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 7e-06
1v88_A130 Oxysterol binding protein-related protein 8; vesic 8e-06
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 9e-05
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 2e-04
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 9e-04
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
 Score =  185 bits (471), Expect = 3e-54
 Identities = 70/238 (29%), Positives = 104/238 (43%), Gaps = 42/238 (17%)

Query: 389 KNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTL 448
             ++ I  ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTL
Sbjct: 3   LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTL 62

Query: 449 DVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNP 508
           D  V   S L L +++GN   N + E  L   +                       KPNP
Sbjct: 63  D--VLGTSELLLAKNIGNAGFNEIMECCLPSED---------------------PVKPNP 99

Query: 509 DDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICS---- 564
              +  ++ YI AKY E+ +    K H    +    L E+V+  D   + +         
Sbjct: 100 GSDMIARKDYITAKYMERRYAR--KKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLT 157

Query: 565 ---------EPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSY 613
                    EP+  A+H       R  L  V  + ++  +  K     G T    L Y
Sbjct: 158 EKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTG-KGST---ALHY 211
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Length = 244 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query629
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 100.0
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 100.0
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 100.0
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 100.0
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 100.0
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 100.0
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 100.0
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 100.0
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 100.0
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 100.0
2owa_A138 Arfgap-like finger domain containing protein; zinc 99.97
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 99.97
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 99.97
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 99.96
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 99.96
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.92
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 99.84
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.83
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.81
1wi1_A126 Calcium-dependent activator protein for secretion, 99.8
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.76
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.76
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.75
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.75
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.75
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.75
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.75
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.75
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.75
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.74
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.74
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.74
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.74
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.73
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.73
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.73
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.73
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.73
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.73
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.73
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.73
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.72
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.72
2yry_A122 Pleckstrin homology domain-containing family A mem 99.72
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.72
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.72
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.72
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.72
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.71
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.71
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.7
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.7
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.7
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.7
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.69
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.69
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.69
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.69
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.68
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.68
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.67
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.66
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.66
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.65
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.64
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.62
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.59
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.57
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.56
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.56
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.53
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.46
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.4
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.35
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.32
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.29
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.28
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.22
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.07
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.04
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 98.99
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 98.9
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 98.87
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 98.86
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.77
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.76
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.36
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 98.26
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.17
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 97.87
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.86
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.78
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.73
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.7
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.63
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.61
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.58
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.57
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.56
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.56
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 97.5
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.47
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.35
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.18
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.12
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.1
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 97.1
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.03
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 96.95
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.78
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.7
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 96.52
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 96.4
1foe_A377 T-lymphoma invasion and metastasis inducing protei 96.37
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 96.15
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 94.75
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 94.64
4gpm_A169 Engineered protein OR264; de novo protein, structu 94.41
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 93.83
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 93.57
4avm_A237 Bridging integrator 2; protein binding, plasma mem 93.43
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 93.08
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 92.74
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 91.64
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 91.34
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 89.59
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 88.16
4gpm_A169 Engineered protein OR264; de novo protein, structu 87.58
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 87.4
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 87.23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 87.04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 86.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 86.29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 85.93
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 84.18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 83.99
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 83.98
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 82.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 82.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 82.43
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 82.06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 81.95
2rfa_A 232 Transient receptor potential cation channel subfa 81.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 81.69
1sw6_A327 Regulatory protein SWI6; transcription regulation, 81.44
3hra_A201 Ankyrin repeat family protein; structural protein; 81.37
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 81.19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 81.16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 80.69
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 80.64
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 80.56
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
Probab=100.00  E-value=1.6e-39  Score=350.96  Aligned_cols=248  Identities=27%  Similarity=0.383  Sum_probs=195.9

Q ss_pred             hhhhhhHhHHHHHHHHHHhcccCCCCcchH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHH
Q 006831            7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVA-VVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLR   85 (629)
Q Consensus         7 ~~~Fe~~q~kyd~~~~ky~slsk~k~~~~~-~E~a~eL~~aRk~f~~asldyv~~l~~vq~kk~~e~le~l~~~~~a~~~   85 (629)
                      -++||+++.+||++++||++++|+|+++.. .|++++|+++|+.|++++||||.+|+.++.++++++|+.++.||+++.+
T Consensus       130 kk~fek~~~~yd~al~k~~~~~k~k~~e~~~~ea~~~l~~~rk~f~~~~ldy~~~l~~l~~rk~~e~le~l~~~~~a~~~  209 (385)
T 2q13_A          130 KEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQIS  209 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCCSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            368999999999999999999999988755 6777999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhHhh-hhchHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCCCCCCCchHHH
Q 006831           86 FFKQGYELL-HQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLI  164 (629)
Q Consensus        86 ff~~g~e~~-~~l~p~~~~l~~~~q~~r~~~~~~~~~L~~~m~~~k~qi~~~~~~s~~~~~~~ps~~~~~~~~~~~~k~~  164 (629)
                      ||++|++++ ++++||+++|..++++.|.+++++++.+.+.++.++.    ....+     +.|+++..           
T Consensus       210 ff~~g~~~~~~~~~~~~~~l~~~l~~~r~~~~~~~~~~~~~~~~l~~----~~~~~-----~~~~~~~~-----------  269 (385)
T 2q13_A          210 FFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEV----ASDPL-----YVPDPDPT-----------  269 (385)
T ss_dssp             HHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHGGG-----SSSSCCTT-----------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc----cCCCC-----CCCCCccc-----------
Confidence            999999998 5999999999999999999999998888877765442    11111     11221110           


Q ss_pred             HHHHhhhccCCcceeEeeeeeeccCC--CCCCceeEEEEEecCceEEEEeCCCCCCCcCCCcccccCCCCCCcccccccc
Q 006831          165 EAAMQSAVKGKVQTIKQGYLSKRSSN--LRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSR  242 (629)
Q Consensus       165 ~~~~~~~~~~~~~~iKqGyL~Krs~~--~~k~WkRRwFvL~~~glLyYy~~~~~~~~g~~~~~~~~~~~~~~~g~g~l~~  242 (629)
                          + .......++|+|||+|+++.  .++.|+||||||+ ++.|+||++. +.                         
T Consensus       270 ----~-~~~~~~~~~k~G~L~K~~~~~~~~~~WkkRwfvL~-~~~L~y~k~~-~~-------------------------  317 (385)
T 2q13_A          270 ----K-FPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQ-GGNLMSQARG-DV-------------------------  317 (385)
T ss_dssp             ----T-SCCCCCCSCCEEEEEEC--------CCEEEEEEEE-TTEEEEECSS-CS-------------------------
T ss_pred             ----c-cccCCCCccEEEEEEEecCCCCCcCCceeEEEEEE-CCEEEEecCC-Cc-------------------------
Confidence                0 00112367899999999876  3457999999998 5667787763 21                         


Q ss_pred             ccccccCCCccccccceeeEeecccceeecCCCCCCCcceEEEeeCC--cEEEEEeCCHHHHHHHHHHHHHHHHHHhccC
Q 006831          243 WLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPT--KVYTLQAENTLDQMDWIEKINGVIASLLSFQ  320 (629)
Q Consensus       243 ~~~~~~~g~v~d~~~~~~~~i~l~~~~vk~~~d~~drrfcF~Iit~~--rty~LqAeSe~E~~~WI~aI~~aI~~~l~~~  320 (629)
                                     .+.+.|+|..|++.+. +..+++|||+|++++  ++|+|||+|++|+++||.+|+.+|..++...
T Consensus       318 ---------------~~~~~i~l~~~~v~~~-~~~~r~~~F~i~t~~~~~~~~l~A~s~~e~~~Wi~ai~~~~~~~~~~~  381 (385)
T 2q13_A          318 ---------------AGGLAMDIDNCSVMAV-DCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSE  381 (385)
T ss_dssp             ---------------SCEEEEECTTCEEEEE-CCTTCSSEEEEECTTSCBCCCEECSSHHHHHHHHHHHHHHHTTCC---
T ss_pred             ---------------CCCceEEccceEEEec-cccCCCceEEEEeCCCCeEEEEEeCCHHHHHHHHHHHHHHHHhhcccc
Confidence                           1235688888988774 446889999999999  9999999999999999999999998766544


Q ss_pred             Cc
Q 006831          321 TP  322 (629)
Q Consensus       321 ~~  322 (629)
                      .|
T Consensus       382 ~~  383 (385)
T 2q13_A          382 NP  383 (385)
T ss_dssp             --
T ss_pred             CC
Confidence            33
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 629
d1dcqa2122 g.45.1.1 (A:247-368) Pyk2-associated protein beta 5e-38
d2elba1268 a.238.1.1 (A:6-273) DCC-interacting protein 13-alp 4e-21
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 2e-18
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-17
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 6e-14
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 2e-13
d1urua_217 a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila 3e-11
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 9e-11
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 9e-11
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 1e-10
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 2e-10
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 3e-10
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 4e-10
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 9e-10
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 9e-10
d2d4ca1237 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap 1e-09
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 4e-09
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 7e-09
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 7e-09
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 7e-09
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 1e-08
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 2e-08
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 2e-08
d1y2oa1248 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain 2e-07
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 2e-07
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 2e-07
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 5e-07
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 1e-06
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 2e-06
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 2e-06
d1i4da_200 a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Hum 2e-05
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 2e-05
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 3e-05
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 3e-05
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 4e-05
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 7e-05
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 2e-04
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 2e-04
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 2e-04
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 7e-04
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 0.001
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 0.002
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 0.004
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure

class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  134 bits (339), Expect = 5e-38
 Identities = 53/142 (37%), Positives = 76/142 (53%), Gaps = 23/142 (16%)

Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
           ++ I  ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTLD 
Sbjct: 3   KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD- 61

Query: 451 KVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDD 510
            V   S L L +++GN   N + E  L                           KPNP  
Sbjct: 62  -VLGTSELLLAKNIGNAGFNEIMECCL---------------------PSEDPVKPNPGS 99

Query: 511 SISVKEQYIHAKYAEKIFVHKR 532
            +  ++ YI AKY E+ +  K+
Sbjct: 100 DMIARKDYITAKYMERRYARKK 121
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query629
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 100.0
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.79
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.77
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.76
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.74
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.73
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.72
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.72
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.72
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.72
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.7
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.7
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.7
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.69
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.69
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.69
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.69
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.68
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.68
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.67
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.67
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.65
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.64
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.64
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.62
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.62
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.57
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.56
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.55
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.03
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.89
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.76
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 98.61
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.51
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.44
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.44
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 98.41
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 98.37
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.25
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 98.25
d2d4ca1237 Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.89
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.7
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.0
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 95.52
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 93.58
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 93.32
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 92.42
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 92.27
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 91.81
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 91.21
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 89.47
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 89.1
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 89.1
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 88.68
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 87.18
d1ixva_ 229 26S proteasome non-ATPase regulatory subunit 10, g 86.63
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 86.54
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 86.15
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 86.12
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 86.02
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 85.27
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 84.83
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 84.64
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 84.62
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 84.37
d1uoha_ 223 26S proteasome non-ATPase regulatory subunit 10, g 83.83
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 83.78
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 83.62
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 83.34
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 80.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 80.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 80.36
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 80.27
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1.4e-40  Score=300.83  Aligned_cols=119  Identities=45%  Similarity=0.801  Sum_probs=111.8

Q ss_pred             cchHHHHHhccCCCCCCCCCCCCCCceecccceeEeccccccccccCcccceeeEeecCCCcCChhHHHHHhhcChhHHH
Q 006831          391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYAN  470 (629)
Q Consensus       391 ~~~~~~l~~~p~N~~CaDCg~~~p~w~s~n~Gv~lC~~CsgvHR~LG~hiSkVrSl~lD~~~w~~~~l~~~~~~GN~~~N  470 (629)
                      ++.++.|++.|||+.|||||+++|+|||+|+|||||++|||+||+||+|||+|||++||  .|++++|++|+.+||..+|
T Consensus         3 ~~~l~~l~~~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld--~w~~~~i~~~~~~GN~~~n   80 (122)
T d1dcqa2           3 KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD--VLGTSELLLAKNIGNAGFN   80 (122)
T ss_dssp             HHHHHHHHHSTTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTS--CCCGGGGHHHHHSCHHHHH
T ss_pred             HHHHHHHHhCCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccC--CCCHHHHHHHHHHhHHHHH
Confidence            46788999999999999999999999999999999999999999999999999999999  7999999999999999999


Q ss_pred             HHHHhhhccCCCCCccccccCccccccccccccCCCCCCCCHHHHHHHHHHHhccCcccccC
Q 006831          471 SVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKR  532 (629)
Q Consensus       471 ~i~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~kP~~~~~~~~re~fI~~KY~~k~f~~~~  532 (629)
                      .+||+++++..                     ..||.++++...|++||++||++|+|+.+.
T Consensus        81 ~~~ea~~~~~~---------------------~~kp~~~~~~~~r~~fI~~KY~~k~f~~k~  121 (122)
T d1dcqa2          81 EIMECCLPSED---------------------PVKPNPGSDMIARKDYITAKYMERRYARKK  121 (122)
T ss_dssp             HHHTTTCCSSS---------------------CCSCCTTCCHHHHHHHHHHHHTTCTTSCCC
T ss_pred             HHHHhhCCccc---------------------CcCCCCCccHHHHHHHHHHHHHhCcccccc
Confidence            99999998632                     368999999999999999999999999763
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure