Citrus Sinensis ID: 006831
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 629 | ||||||
| 255540067 | 818 | gcn4-complementing protein, putative [Ri | 0.941 | 0.723 | 0.704 | 0.0 | |
| 334188557 | 828 | ARF-GAP domain 1 protein [Arabidopsis th | 0.952 | 0.723 | 0.648 | 0.0 | |
| 10176916 | 768 | GCN4-complementing protein homolog [Arab | 0.922 | 0.755 | 0.641 | 0.0 | |
| 297793757 | 856 | ARF-GAP domain 1 [Arabidopsis lyrata sub | 0.957 | 0.703 | 0.628 | 0.0 | |
| 296085519 | 832 | unnamed protein product [Vitis vinifera] | 0.926 | 0.700 | 0.661 | 0.0 | |
| 359491578 | 822 | PREDICTED: ADP-ribosylation factor GTPas | 0.898 | 0.687 | 0.668 | 0.0 | |
| 147791929 | 822 | hypothetical protein VITISV_040393 [Viti | 0.898 | 0.687 | 0.670 | 0.0 | |
| 297734503 | 827 | unnamed protein product [Vitis vinifera] | 0.904 | 0.688 | 0.667 | 0.0 | |
| 224072473 | 830 | predicted protein [Populus trichocarpa] | 0.925 | 0.701 | 0.655 | 0.0 | |
| 449520667 | 1194 | PREDICTED: ADP-ribosylation factor GTPas | 0.898 | 0.473 | 0.670 | 0.0 |
| >gi|255540067|ref|XP_002511098.1| gcn4-complementing protein, putative [Ricinus communis] gi|223550213|gb|EEF51700.1| gcn4-complementing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 862 bits (2226), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 429/609 (70%), Positives = 494/609 (81%), Gaps = 17/609 (2%)
Query: 19 QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
QAR+KFLSLRKSTRMDVA +EE+L+NA++SFE ARFNLV ALS VEAKKRFE LEAV G
Sbjct: 134 QARDKFLSLRKSTRMDVAATVEEELYNAKSSFELARFNLVSALSVVEAKKRFEFLEAVSG 193
Query: 79 TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
TMDAHLR+FKQGYELLHQ+EPFINQVLAYAQQSRECS+YEQASL +R+Q++++QIDRES+
Sbjct: 194 TMDAHLRYFKQGYELLHQLEPFINQVLAYAQQSRECSNYEQASLSERVQEHMRQIDRESK 253
Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
LNG LGSPSG+ ++ F RNS+K+IEA MQSA KGKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 HSLNGGLGSPSGEGMRIFARNSHKVIEAVMQSASKGKVQTIRQGYLSKRSSNLRGDWKRR 313
Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSSHYHGGVHDEKSV 258
FFVLDSRG+LYYYRKP+SW S GSQSS+QR+ ++ GLLSRWLSSHYHGGVHDEK+V
Sbjct: 314 FFVLDSRGMLYYYRKPFSWTSVTGSQSSVQRNVAADNGPGLLSRWLSSHYHGGVHDEKTV 373
Query: 259 ARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLS 318
ARHTVNLLTSTIK DADQSDLRFCFRIISP KVYTLQAEN LDQMDWIEKI GVI SLLS
Sbjct: 374 ARHTVNLLTSTIKVDADQSDLRFCFRIISPVKVYTLQAENALDQMDWIEKITGVITSLLS 433
Query: 319 FQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSS 378
FQTPER LS+G + S DR I E LVDSP DQT IE+ S I HLHSS
Sbjct: 434 FQTPERR-----LSTGHRGSGDRPTISEGSSLVDSPDNDQTDIEDFTSNIIPPRSHLHSS 488
Query: 379 KSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGV 438
K EY +++EKPID+LR V GN+KCADCGA EPDWASLNLGVLICI+CSGVHRNLGV
Sbjct: 489 KLSQQQEYCMRSEKPIDVLRSVPGNDKCADCGAPEPDWASLNLGVLICIECSGVHRNLGV 548
Query: 439 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQ 498
HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELL+ + D+ GFS++D+Q
Sbjct: 549 HISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLQSRTSFTADDMAKGFSKSDRQ 608
Query: 499 KRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVY 558
K F +RKP+ DD I+VKEQ+IHAKYAEKIF+HK KD HLL VA+Q+WESV NDKKAVY
Sbjct: 609 KLFHIRKPSHDDPIAVKEQFIHAKYAEKIFIHKIKDDQHLLPVAEQVWESVYANDKKAVY 668
Query: 559 RQIICSEPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSYLNSMH 618
R I+CS +VNAIHGQAS+ L +V++ ++ E D DC L S++
Sbjct: 669 RHIVCSGADVNAIHGQASFSTSSSLTSVIQYKQQENLDLNFDC------------LQSLN 716
Query: 619 RSGDELIEE 627
++ D+LI +
Sbjct: 717 KNEDQLITD 725
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|334188557|ref|NP_201004.2| ARF-GAP domain 1 protein [Arabidopsis thaliana] gi|209572799|sp|Q9FIT8.2|AGD1_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD1; Short=ARF GAP AGD1; AltName: Full=Protein ARF-GAP DOMAIN 1; Short=AtAGD1 gi|332010162|gb|AED97545.1| ARF-GAP domain 1 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10176916|dbj|BAB10160.1| GCN4-complementing protein homolog [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297793757|ref|XP_002864763.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] gi|297310598|gb|EFH41022.1| ARF-GAP domain 1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|296085519|emb|CBI29251.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359491578|ref|XP_002280846.2| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147791929|emb|CAN67895.1| hypothetical protein VITISV_040393 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734503|emb|CBI15750.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224072473|ref|XP_002303749.1| predicted protein [Populus trichocarpa] gi|222841181|gb|EEE78728.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449520667|ref|XP_004167355.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD3-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 629 | ||||||
| TAIR|locus:2183916 | 827 | SFC "SCARFACE" [Arabidopsis th | 0.901 | 0.685 | 0.640 | 9.4e-185 | |
| TAIR|locus:2197359 | 775 | AGD4 "ARF-GAP domain 4" [Arabi | 0.481 | 0.390 | 0.469 | 1.8e-116 | |
| TAIR|locus:2025850 | 776 | AGD2 "ARF-GAP domain 2" [Arabi | 0.486 | 0.394 | 0.473 | 7e-113 | |
| DICTYBASE|DDB_G0276395 | 843 | acapB "Arf GTPase activating p | 0.151 | 0.112 | 0.5 | 6.5e-39 | |
| RGD|1310711 | 625 | Acap3 "ArfGAP with coiled-coil | 0.181 | 0.182 | 0.463 | 1.8e-36 | |
| UNIPROTKB|D4AAD1 | 833 | Acap3 "Protein Acap3" [Rattus | 0.181 | 0.136 | 0.463 | 1.8e-35 | |
| UNIPROTKB|F1NGZ5 | 834 | ACAP3 "Uncharacterized protein | 0.213 | 0.160 | 0.412 | 1.8e-35 | |
| ZFIN|ZDB-GENE-030131-1711 | 575 | acap3a "ArfGAP with coiled-coi | 0.181 | 0.198 | 0.447 | 2.2e-30 | |
| ZFIN|ZDB-GENE-081104-34 | 735 | si:ch211-168b3.1 "si:ch211-168 | 0.152 | 0.130 | 0.495 | 3.5e-30 | |
| UNIPROTKB|F1NG96 | 764 | ACAP2 "Arf-GAP with coiled-coi | 0.275 | 0.226 | 0.345 | 6.4e-30 |
| TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1792 (635.9 bits), Expect = 9.4e-185, P = 9.4e-185
Identities = 372/581 (64%), Positives = 438/581 (75%)
Query: 19 QAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGG 78
QAREKFLSLRK T+ DVA +E++LH +R+ FEQARFNLV ALSNVEAKKRFE LEAV G
Sbjct: 134 QAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVEAKKRFEFLEAVSG 193
Query: 79 TMDAHLRFFKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESR 138
TMDAHLR+FKQGYELLHQMEP+INQVL YAQQSRE S+YEQA+L+++MQ+Y +Q+DRESR
Sbjct: 194 TMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESR 253
Query: 139 QCLNGSLGSPSGDNVKPFPRNSNKLIEAAMQSAVKGKVQTIKQGYLSKRSSNLRADWKRR 198
NGS GSP+GD ++ R+S+K+I+A MQSA +GKVQTI+QGYLSKRSSNLR DWKRR
Sbjct: 254 WGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLSKRSSNLRGDWKRR 313
Query: 199 FFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS--HYHGGVHDEK 256
FFVLDSRG+LYYYRK S S +GSQ S QR N SE GLLSRWLSS H HGGVHDEK
Sbjct: 314 FFVLDSRGMLYYYRKQCSKPSGSGSQLSGQR-NSSELGSGLLSRWLSSNNHGHGGVHDEK 372
Query: 257 SVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASL 316
SVARHTVNLLTSTIK DADQSDLRFCFRIISPTK YTLQAE+ LDQMDWIEKI GVIASL
Sbjct: 373 SVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASL 432
Query: 317 LSFQTPERVNVKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLH 376
LS Q PE+ + SG S ES S Y D T EE + G +
Sbjct: 433 LSSQVPEQRLPGSPMGSGHHRSAS-----ESSSYESSEY-DHPTTEEFVCERSFLGYNER 486
Query: 377 SSKSLGDLEYIVKNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNL 436
S+S I K EKPID LR+V GN+KCADCGA EPDWASLNLGVL+CI+CSGVHRNL
Sbjct: 487 PSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNL 546
Query: 437 GVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTD 496
GVHISKVRSLTLDVKVWEPSV++LFQ+LGN +AN+VWEELL + D G + +D
Sbjct: 547 GVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFDP---GLTVSD 603
Query: 497 KQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKA 556
K + + KP+ D IS+KE+YI AKYAEK+FV + +D S AQQ+W++V NDKKA
Sbjct: 604 KSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRRSRDSDFPQSAAQQMWDAVSGNDKKA 663
Query: 557 VYRQIICSEPNVNAIHGQASYGKRLPLATVMEMEEH-ERDD 596
VYR I+ + +VN ++ Q S L L+ V+ + E +R+D
Sbjct: 664 VYRLIVNGDADVNYVYDQTS-SSSLTLSRVILVPERPKRED 703
|
|
| TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276395 acapB "Arf GTPase activating protein B" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|1310711 Acap3 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1711 acap3a "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081104-34 si:ch211-168b3.1 "si:ch211-168b3.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NG96 ACAP2 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.8__2187__AT5G61980.1 | annotation not avaliable (856 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 629 | |||
| pfam01412 | 117 | pfam01412, ArfGap, Putative GTPase activating prot | 7e-46 | |
| smart00105 | 119 | smart00105, ArfGap, Putative GTP-ase activating pr | 9e-42 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 1e-33 | |
| cd07606 | 202 | cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B | 1e-29 | |
| COG5347 | 319 | COG5347, COG5347, GTPase-activating protein that r | 2e-29 | |
| PLN03114 | 395 | PLN03114, PLN03114, ADP-ribosylation factor GTPase | 3e-12 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 4e-12 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 2e-10 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 2e-09 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 3e-09 | |
| cd01251 | 105 | cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple | 7e-09 | |
| cd07307 | 194 | cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain | 1e-07 | |
| smart00721 | 239 | smart00721, BAR, BAR domain | 4e-06 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 5e-06 | |
| cd01233 | 111 | cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein p | 5e-06 | |
| cd07637 | 200 | cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) | 5e-06 | |
| cd07603 | 200 | cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) | 1e-05 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 1e-05 | |
| cd13282 | 96 | cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology | 1e-05 | |
| cd13269 | 106 | cd13269, PH_alsin, Alsin Pleckstrin homology (PH) | 2e-05 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 2e-05 | |
| cd13247 | 125 | cd13247, BAR-PH_APPL, Adaptor protein containing P | 4e-05 | |
| cd13266 | 106 | cd13266, PH_Skap_family, Src kinase-associated pho | 7e-05 | |
| cd07638 | 200 | cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) | 1e-04 | |
| cd13380 | 106 | cd13380, PH_Skap1, Src kinase-associated phosphopr | 1e-04 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 1e-04 | |
| cd01265 | 101 | cd01265, PH_TBC1D2A, TBC1 domain family member 2A | 1e-04 | |
| cd13251 | 108 | cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin | 2e-04 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 2e-04 | |
| cd13270 | 118 | cd13270, PH1_TAPP1_2, Tandem PH-domain-containing | 2e-04 | |
| cd13271 | 114 | cd13271, PH2_TAPP1_2, Tandem PH-domain-containing | 3e-04 | |
| cd01250 | 114 | cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat | 4e-04 | |
| cd07631 | 215 | cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) | 5e-04 | |
| PLN03131 | 705 | PLN03131, PLN03131, hypothetical protein; Provisio | 6e-04 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 7e-04 | |
| cd13265 | 108 | cd13265, PH_evt, Evectin Pleckstrin homology (PH) | 0.001 | |
| cd01218 | 123 | cd01218, PH_Phafin2-like, Phafin2 (also called EAP | 0.001 | |
| cd07601 | 215 | cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) d | 0.001 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 0.002 | |
| cd13267 | 125 | cd13267, PH_DOCK-D, Dedicator of cytokinesis-D sub | 0.003 | |
| cd07602 | 207 | cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysi | 0.003 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 0.004 |
| >gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf | Back alignment and domain information |
|---|
Score = 157 bits (400), Expect = 7e-46
Identities = 59/142 (41%), Positives = 73/142 (51%), Gaps = 25/142 (17%)
Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
++ + LR++ GN CADCGA P WASLNLG+ ICI+CSGVHR+LGVHISKVRSLTLD
Sbjct: 1 KRLLRELRKLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLD- 59
Query: 451 KVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDD 510
W P L ++ GN AN WE + P
Sbjct: 60 -KWTPEQLEFMKAGGNKRANEFWE-----------------------ANLPPPKPPPSSS 95
Query: 511 SISVKEQYIHAKYAEKIFVHKR 532
+E +I AKY EK+F
Sbjct: 96 DREKRESFIRAKYVEKLFAEAE 117
|
Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117 |
| >gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) | Back alignment and domain information |
|---|
| >gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|153271 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature | Back alignment and domain information |
|---|
| >gnl|CDD|214787 smart00721, BAR, BAR domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153321 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|153287 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153322 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, N-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat | Back alignment and domain information |
|---|
| >gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153315 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187, ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153285 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|153286 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 629 | |||
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 100.0 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 100.0 | |
| KOG0703 | 287 | consensus Predicted GTPase-activating protein [Sig | 100.0 | |
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 100.0 | |
| smart00105 | 112 | ArfGap Putative GTP-ase activating proteins for th | 100.0 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 100.0 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 100.0 | |
| KOG1451 | 812 | consensus Oligophrenin-1 and related Rho GTPase-ac | 99.98 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 99.97 | |
| PLN03119 | 648 | putative ADP-ribosylation factor GTPase-activating | 99.96 | |
| PLN03131 | 705 | hypothetical protein; Provisional | 99.96 | |
| PLN03114 | 395 | ADP-ribosylation factor GTPase-activating protein | 99.93 | |
| KOG0706 | 454 | consensus Predicted GTPase-activating protein [Sig | 99.91 | |
| KOG0704 | 386 | consensus ADP-ribosylation factor GTPase activator | 99.91 | |
| cd07601 | 215 | BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A | 99.88 | |
| cd07603 | 200 | BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of | 99.87 | |
| cd07602 | 207 | BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR | 99.87 | |
| cd07637 | 200 | BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.86 | |
| cd07631 | 215 | BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.86 | |
| cd07634 | 207 | BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai | 99.85 | |
| cd07606 | 202 | BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain | 99.85 | |
| cd07636 | 207 | BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G | 99.84 | |
| cd07635 | 207 | BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.84 | |
| cd07638 | 200 | BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.83 | |
| cd07639 | 200 | BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.82 | |
| cd07632 | 215 | BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.81 | |
| cd07633 | 207 | BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.81 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.77 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.76 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.73 | |
| cd07604 | 215 | BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of | 99.72 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.72 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.71 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.7 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.69 | |
| cd07641 | 215 | BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.68 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.67 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.67 | |
| cd07640 | 213 | BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.67 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.65 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.65 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.64 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.62 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 99.61 | |
| cd07642 | 215 | BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of | 99.59 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.58 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 99.54 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.54 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.54 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.51 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.5 | |
| cd07609 | 214 | BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domai | 99.49 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 99.41 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 99.41 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 99.38 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 99.38 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.31 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 99.29 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.27 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.23 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 99.23 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.22 | |
| KOG0702 | 524 | consensus Predicted GTPase-activating protein [Sig | 99.11 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 99.07 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 99.02 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.0 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 98.95 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 98.87 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.8 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.76 | |
| cd07307 | 194 | BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri | 98.68 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 98.68 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 98.59 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 98.54 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 98.46 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 98.37 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 98.27 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 98.21 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 98.17 | |
| KOG0932 | 774 | consensus Guanine nucleotide exchange factor EFA6 | 98.15 | |
| smart00721 | 239 | BAR BAR domain. | 98.14 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 97.94 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 97.73 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 97.7 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.69 | |
| PF03114 | 229 | BAR: BAR domain; InterPro: IPR004148 Endocytosis a | 97.68 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 97.6 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 97.58 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 97.55 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 97.51 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 97.36 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.34 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 97.16 | |
| KOG0248 | 936 | consensus Cytoplasmic protein Max-1, contains PH, | 97.15 | |
| PLN02866 | 1068 | phospholipase D | 97.14 | |
| cd07608 | 192 | BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) dom | 97.06 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 96.97 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 96.96 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 96.87 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 96.76 | |
| KOG3723 | 851 | consensus PH domain protein Melted [Signal transdu | 96.76 | |
| cd07595 | 244 | BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) | 96.67 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 96.31 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 96.03 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 95.77 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 95.76 | |
| cd07593 | 215 | BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom | 95.7 | |
| cd07594 | 229 | BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom | 95.69 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 95.67 | |
| cd07618 | 246 | BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of | 95.39 | |
| cd07590 | 225 | BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B | 94.87 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 94.76 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 94.69 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 94.48 | |
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 94.35 | |
| cd07592 | 223 | BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom | 94.32 | |
| cd07616 | 229 | BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do | 94.24 | |
| cd07591 | 224 | BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o | 93.82 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 93.33 | |
| cd07615 | 223 | BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do | 93.29 | |
| cd07613 | 223 | BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do | 93.19 | |
| cd07600 | 242 | BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of | 92.87 | |
| cd07614 | 223 | BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do | 92.85 | |
| cd07619 | 248 | BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of | 92.4 | |
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 92.23 | |
| KOG3543 | 1218 | consensus Ca2+-dependent activator protein [Signal | 91.91 | |
| cd07599 | 216 | BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o | 91.85 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 91.81 | |
| cd07611 | 211 | BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) | 91.8 | |
| cd07588 | 211 | BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma | 91.74 | |
| PF06456 | 229 | Arfaptin: Arfaptin-like domain; InterPro: IPR01050 | 91.33 | |
| cd07612 | 211 | BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B | 91.19 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 90.93 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 90.41 | |
| cd00011 | 203 | BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do | 90.26 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 89.93 | |
| KOG3771 | 460 | consensus Amphiphysin [Intracellular trafficking, | 89.91 | |
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 89.62 | |
| cd07617 | 220 | BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do | 89.55 | |
| cd07620 | 257 | BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of | 89.41 | |
| KOG1737 | 799 | consensus Oxysterol-binding protein [Lipid transpo | 88.89 | |
| KOG3531 | 1036 | consensus Rho guanine nucleotide exchange factor C | 88.86 | |
| cd07660 | 201 | BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain | 88.7 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 86.2 | |
| KOG0517 | 2473 | consensus Beta-spectrin [Cytoskeleton] | 85.75 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 85.65 | |
| KOG2070 | 661 | consensus Guanine nucleotide exchange factor [Nucl | 84.72 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 83.79 | |
| PF08397 | 219 | IMD: IRSp53/MIM homology domain; InterPro: IPR0136 | 82.79 | |
| cd05394 | 313 | RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the | 80.88 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 80.7 |
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-67 Score=601.28 Aligned_cols=446 Identities=40% Similarity=0.604 Sum_probs=354.0
Q ss_pred hhhhhhHhHHHHHHHHHHhcccCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHH
Q 006831 7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVAVVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLRF 86 (629)
Q Consensus 7 ~~~Fe~~q~kyd~~~~ky~slsk~k~~~~~~E~a~eL~~aRk~f~~asldyv~~l~~vq~kk~~e~le~l~~~~~a~~~f 86 (629)
-+.||++++.||.+++||.+++|.+++.+..|.+++|+.+|+.|++.+||||.+|+.+|.||++++||++++||+||.+|
T Consensus 126 kk~f~ka~~~~d~a~~k~~~l~k~~~~~~~~e~~~~l~~~r~~f~~~~~~y~~~ln~~q~kk~~~~le~~l~~~~aq~~f 205 (785)
T KOG0521|consen 126 KKLFEKASEEYDLALVKYSRLPKKRRSKVKTEVEEELAAARRKFQLTALDYVLALNVLQAKKQFEILETLLGFMHAQINF 205 (785)
T ss_pred hHHHHHHHhhHHHHHHHhhhhhhccccchhHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccchHHHHHHHHHHHhccch
Confidence 47899999999999999999999999888899999999999999999999999999999999999999999999999999
Q ss_pred HhhhhHhhhhchHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCCCCCCCchHHHHH
Q 006831 87 FKQGYELLHQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLIEA 166 (629)
Q Consensus 87 f~~g~e~~~~l~p~~~~l~~~~q~~r~~~~~~~~~L~~~m~~~k~qi~~~~~~s~~~~~~~ps~~~~~~~~~~~~k~~~~ 166 (629)
|++|++++++|+||++++..++++++.+++.+++.+.++++.++.+.+...+.- .....|++.
T Consensus 206 F~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~~q~l~~~~~~~~~~~--~~~~~~~~~--------------- 268 (785)
T KOG0521|consen 206 FKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQRYQELRSASNLESRPK--SDSASPSGG--------------- 268 (785)
T ss_pred hcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhHHHHHHHHhhhhhhcc--ccccccccc---------------
Confidence 999999999999999999999999999999999999999999988877655441 111122221
Q ss_pred HHhhhccCCcceeEeeeeeeccCCCCCCceeEEEEEecCceEEEEeCCCCCCCcCCCcccccCCCCCCcccccccccccc
Q 006831 167 AMQSAVKGKVQTIKQGYLSKRSSNLRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSRWLSS 246 (629)
Q Consensus 167 ~~~~~~~~~~~~iKqGyL~Krs~~~~k~WkRRwFvL~~~glLyYy~~~~~~~~g~~~~~~~~~~~~~~~g~g~l~~~~~~ 246 (629)
+........|||+++..+..+.|+||||... ++.+.|.......
T Consensus 269 ------~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~~~l~~~~r~~~~----------------------------- 312 (785)
T KOG0521|consen 269 ------NLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-DGQLGYQHRGADA----------------------------- 312 (785)
T ss_pred ------cccchhhhhhhhhhhcccchhhHHhhhhhhh-ccccccccccccc-----------------------------
Confidence 1122345689999999988899999999998 4544444322211
Q ss_pred ccCCCccccccceeeEeecccceeecCCCCCCCcceEEEeeCCcEEEEEeCCHHHHHHHHHHHHHHHHHHhccCCccccc
Q 006831 247 HYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPTKVYTLQAENTLDQMDWIEKINGVIASLLSFQTPERVN 326 (629)
Q Consensus 247 ~~~g~v~d~~~~~~~~i~l~~~~vk~~~d~~drrfcF~Iit~~rty~LqAeSe~E~~~WI~aI~~aI~~~l~~~~~~~~~ 326 (629)
. .....++.+|.|++.++..++||||+|++|+|+|+|||+|+.+.++||.+|++.|..+++...++...
T Consensus 313 ~-----------~~~~~dL~~csvk~~~~~~drr~CF~iiS~tks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~~~~~~~ 381 (785)
T KOG0521|consen 313 E-----------NVLIEDLRTCSVKPDAEQRDRRFCFEIISPTKSYLLQAESEKDCQDWISALQNSILSALNSAFLGQDS 381 (785)
T ss_pred c-----------ccccccchhccccCCcccccceeeEEEecCCcceEEecCchhHHHHHHHHHHHHHHHHHhccCccccc
Confidence 0 02456789999999888889999999999999999999999999999999999999999987776522
Q ss_pred cccccCCCCCCCCccccccccCCccCCCCCCccchhhcccccccCCCCcCCCcccchhhhhccccchHHHHHhccCCCCC
Q 006831 327 VKHCLSSGPKESFDRCFIRESGLLVDSPYVDQTTIEEHASKNITGGDHLHSSKSLGDLEYIVKNEKPIDLLRRVYGNNKC 406 (629)
Q Consensus 327 ~~~~l~~~p~~s~~~~~~s~s~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~N~~C 406 (629)
...+ ..++++..+++. ..+.+. ....++ ..+...++..++.+|||..|
T Consensus 382 ~~~~----~~~~~~~~~~s~-~~~~s~---------~~s~~~------------------~~~~~~~~~~vq~~pgN~~c 429 (785)
T KOG0521|consen 382 TGGR----NTQSGHSSSASY-STITSA---------NTSRER------------------LNKGISVIEEVQSVPGNAQC 429 (785)
T ss_pred ccCC----Cccccccccccc-cccccc---------cccccc------------------cccCcchhhhhhcCCchhhh
Confidence 1111 111111111110 000000 000000 00112267889999999999
Q ss_pred CCCCCCCCCceecccceeEeccccccccccCcccceeeEeecCCCcCChhHHHHHhhcChhHHHHHHHhhhccCCCCCcc
Q 006831 407 ADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTD 486 (629)
Q Consensus 407 aDCg~~~p~w~s~n~Gv~lC~~CsgvHR~LG~hiSkVrSl~lD~~~w~~~~l~~~~~~GN~~~N~i~e~~l~~~~~~~~~ 486 (629)
||||+++|+|+|+|+||.+||+||||||+|||||||||||+|| .|+++.+.+|+.+||..+|.|||+.+++..
T Consensus 430 ~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD--~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~----- 502 (785)
T KOG0521|consen 430 CDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD--VWEPELLLLFKNLGNKYVNEIYEALLPSYD----- 502 (785)
T ss_pred hhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh--ccCcHHHHHHHHhCcchhhhhhhccccccc-----
Confidence 9999999999999999999999999999999999999999999 599999999999999999999999998731
Q ss_pred ccccCccccccccccccCCCCCCCCHHHHHHHHHHHhccCcccccCCCCcch----------------hhHHHHHHHHHh
Q 006831 487 ERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKRKDHHHL----------------LSVAQQLWESVR 550 (629)
Q Consensus 487 ~~~~~~~~~~~~~~~~~~kP~~~~~~~~re~fI~~KY~~k~f~~~~~~~~~~----------------~~~~~~l~~av~ 550 (629)
..+|.+..+...|+.||++||+++.|....+..... ..-..+++++|.
T Consensus 503 ----------------~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 566 (785)
T KOG0521|consen 503 ----------------SSKPTASSSRQAREAWIKAKYVERRFSVKEPQIKRLYLERLLEAIKSILESASASGVQISEGVS 566 (785)
T ss_pred ----------------ccCCCCccchhhhhHhhhcccceeeEeecccchhhhhhhhhhhhhhhhhhhhhhhhhhHhhccc
Confidence 368888777999999999999999999997654210 122456777776
Q ss_pred cCCHHH-HHHHHHhCCCCcccc
Q 006831 551 DNDKKA-VYRQIICSEPNVNAI 571 (629)
Q Consensus 551 ~~d~~~-~~~~l~~~gadvn~~ 571 (629)
.++.+. ++.+++....|.+..
T Consensus 567 ~~~~~~~v~~l~~~~~~d~~~~ 588 (785)
T KOG0521|consen 567 GSSREETVYHLIVSTLNDASIR 588 (785)
T ss_pred cCCccccceeeeccCccccccc
Confidence 777665 676665544455543
|
|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
| >smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional | Back alignment and domain information |
|---|
| >PLN03131 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins | Back alignment and domain information |
|---|
| >cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 | Back alignment and domain information |
|---|
| >cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like | Back alignment and domain information |
|---|
| >cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) | Back alignment and domain information |
|---|
| >cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase | Back alignment and domain information |
|---|
| >cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 | Back alignment and domain information |
|---|
| >cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 | Back alignment and domain information |
|---|
| >cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07609 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domain of fungal Snf1p-interacting protein 3 | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00721 BAR BAR domain | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >cd07608 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized fungal Arf GAP proteins | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins | Back alignment and domain information |
|---|
| >cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 | Back alignment and domain information |
|---|
| >cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A | Back alignment and domain information |
|---|
| >cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 | Back alignment and domain information |
|---|
| >cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 | Back alignment and domain information |
|---|
| >cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 | Back alignment and domain information |
|---|
| >cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins | Back alignment and domain information |
|---|
| >cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 | Back alignment and domain information |
|---|
| >cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II | Back alignment and domain information |
|---|
| >cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins | Back alignment and domain information |
|---|
| >PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules | Back alignment and domain information |
|---|
| >cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 | Back alignment and domain information |
|---|
| >cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 | Back alignment and domain information |
|---|
| >KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0517 consensus Beta-spectrin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family | Back alignment and domain information |
|---|
| >cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 629 | ||||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 6e-27 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 6e-27 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 6e-27 | ||
| 1dcq_A | 278 | Crystal Structure Of The Arf-Gap Domain And Ankyrin | 6e-21 | ||
| 3fm8_C | 392 | Crystal Structure Of Full Length Centaurin Alpha-1 | 1e-20 | ||
| 3feh_A | 386 | Crystal Structure Of Full Length Centaurin Alpha-1 | 1e-20 | ||
| 2b0o_E | 301 | Crystal Structure Of Uplc1 Gap Domain Length = 301 | 5e-20 | ||
| 3lvq_E | 497 | The Crystal Structure Of Asap3 In Complex With Arf6 | 6e-20 | ||
| 2iqj_A | 134 | Crystal Structure Of The Gap Domain Of Smap1l (Loc6 | 2e-16 | ||
| 2crr_A | 141 | Solution Structure Of Arfgap Domain From Human Smap | 5e-16 | ||
| 3sub_A | 163 | Crystal Structure Of The Catalytic Domain Of Plasmo | 3e-15 | ||
| 2p57_A | 144 | Gap Domain Of Znf289, An Id1-Regulated Zinc Finger | 3e-14 | ||
| 2crw_A | 149 | Solution Structure Of The Arfgap Domain Of Adp-Ribo | 9e-14 | ||
| 3o47_A | 329 | Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le | 4e-12 | ||
| 3dwd_A | 147 | Crystal Structure Of The Arfgap Domain Of Human Arf | 7e-12 | ||
| 2q13_A | 385 | Crystal Structure Of Bar-Ph Domain Of Appl1 Length | 2e-09 | ||
| 2owa_A | 138 | Crystal Structure Of Putative Gtpase Activating Pro | 7e-09 | ||
| 2z0o_A | 387 | Crystal Structure Of Appl1-Bar-Ph Domain Length = 3 | 3e-08 | ||
| 2elb_A | 396 | Crystal Structure Of The Bar-Ph Domain Of Human App | 6e-07 | ||
| 2olm_A | 140 | Arfgap Domain Of Hiv-1 Rev Binding Protein Length = | 9e-05 | ||
| 2z0n_A | 280 | Crystal Structure Of Appl1-Bar Domain Length = 280 | 3e-04 | ||
| 2q12_A | 265 | Crystal Structure Of Bar Domain Of Appl1 Length = 2 | 4e-04 | ||
| 2d9l_A | 134 | Solution Structure Of The Arfgap Domain Of Human Ri | 9e-04 |
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
|
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 | Back alignment and structure |
| >pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 | Back alignment and structure |
| >pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 | Back alignment and structure |
| >pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 | Back alignment and structure |
| >pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 | Back alignment and structure |
| >pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 | Back alignment and structure |
| >pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 | Back alignment and structure |
| >pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 | Back alignment and structure |
| >pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 | Back alignment and structure |
| >pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 | Back alignment and structure |
| >pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 | Back alignment and structure |
| >pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 | Back alignment and structure |
| >pdb|2Q13|A Chain A, Crystal Structure Of Bar-Ph Domain Of Appl1 Length = 385 | Back alignment and structure |
| >pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 | Back alignment and structure |
| >pdb|2Z0O|A Chain A, Crystal Structure Of Appl1-Bar-Ph Domain Length = 387 | Back alignment and structure |
| >pdb|2ELB|A Chain A, Crystal Structure Of The Bar-Ph Domain Of Human Appl1 Length = 396 | Back alignment and structure |
| >pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 | Back alignment and structure |
| >pdb|2Z0N|A Chain A, Crystal Structure Of Appl1-Bar Domain Length = 280 | Back alignment and structure |
| >pdb|2Q12|A Chain A, Crystal Structure Of Bar Domain Of Appl1 Length = 265 | Back alignment and structure |
| >pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 629 | |||
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 3e-54 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 3e-52 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-51 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 7e-51 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 2e-48 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 2e-28 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 5e-48 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 3e-47 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 2e-40 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 6e-39 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 2e-38 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 3e-37 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 1e-35 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 1e-35 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 2e-31 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 8e-23 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 4e-21 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 9e-21 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 3e-18 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 6e-18 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 9e-18 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 9e-17 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 1e-16 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 3e-16 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 4e-16 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 5e-16 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 5e-16 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 6e-16 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 7e-16 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 1e-15 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 2e-15 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 2e-15 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 2e-15 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 2e-15 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 3e-15 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 3e-15 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 1e-14 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 3e-14 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 4e-14 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 8e-14 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 1e-13 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 2e-13 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 2e-13 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 2e-13 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 4e-13 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 5e-13 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 5e-13 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 1e-12 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 4e-11 | |
| 1zww_A | 256 | SH3-containing GRB2-like protein 2; coiled coil, t | 4e-11 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 4e-11 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 7e-11 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 1e-10 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 1e-10 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 1e-10 | |
| 2z0v_A | 240 | SH3-containing GRB2-like protein 3; helix bundle, | 1e-10 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 3e-10 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 4e-10 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 2e-09 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 1e-08 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 2e-08 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 2e-08 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 4e-08 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 2e-07 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 2e-07 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 2e-07 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 5e-07 | |
| 1uru_A | 244 | Amphiphysin; endocytosis, coiled-coil, membrane cu | 7e-07 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 5e-06 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 7e-06 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 8e-06 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 9e-05 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 2e-04 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 9e-04 |
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
Score = 185 bits (471), Expect = 3e-54
Identities = 70/238 (29%), Positives = 104/238 (43%), Gaps = 42/238 (17%)
Query: 389 KNEKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTL 448
++ I ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTL
Sbjct: 3 LTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTL 62
Query: 449 DVKVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNP 508
D V S L L +++GN N + E L + KPNP
Sbjct: 63 D--VLGTSELLLAKNIGNAGFNEIMECCLPSED---------------------PVKPNP 99
Query: 509 DDSISVKEQYIHAKYAEKIFVHKRKDHHHLLSVAQQLWESVRDNDKKAVYRQIICS---- 564
+ ++ YI AKY E+ + K H + L E+V+ D + +
Sbjct: 100 GSDMIARKDYITAKYMERRYAR--KKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLT 157
Query: 565 ---------EPNVNAIHGQASYGKRLPLATVMEMEEHERDDKKIDCFDGDTLDDPLSY 613
EP+ A+H R L V + ++ + K G T L Y
Sbjct: 158 EKIPLANGHEPDETALHLAVRSVDRTSLHIVDFLVQNSGNLDKQTG-KGST---ALHY 211
|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 | Back alignment and structure |
|---|
| >1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Length = 244 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 629 | |||
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 100.0 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 100.0 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 100.0 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 100.0 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 100.0 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 100.0 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 100.0 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 100.0 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 100.0 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 100.0 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 99.97 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 99.97 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 99.97 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 99.96 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 99.96 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.92 | |
| 2q12_A | 265 | DIP13 alpha, DCC-interacting protein 13 alpha; APP | 99.84 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.83 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.81 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.8 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.76 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.76 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.75 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.75 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.75 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.75 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.75 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.75 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.75 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.74 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.74 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.74 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.74 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.73 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.73 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.73 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.73 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.73 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.73 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.73 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.73 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.72 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.72 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.72 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.72 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.72 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.72 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.72 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.71 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.71 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.7 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.7 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.7 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.7 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.69 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.69 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.69 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.69 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.68 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.68 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.67 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.66 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.66 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.65 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.64 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.62 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.59 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.57 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.56 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.56 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.53 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.46 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.4 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.35 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.32 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 99.29 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 99.28 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.22 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 99.07 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 99.04 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.99 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 98.9 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 98.87 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 98.86 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.77 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.76 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 98.36 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 98.26 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 98.17 | |
| 2z0v_A | 240 | SH3-containing GRB2-like protein 3; helix bundle, | 97.87 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 97.86 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 97.78 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 97.73 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 97.7 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 97.63 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 97.61 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.58 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 97.57 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.56 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 97.56 | |
| 1zww_A | 256 | SH3-containing GRB2-like protein 2; coiled coil, t | 97.5 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 97.47 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 97.35 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 97.18 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 97.12 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 97.1 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 97.1 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 97.03 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 96.95 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 96.78 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 96.7 | |
| 2fic_A | 251 | Bridging integrator 1; BAR domain, homodimer, coil | 96.52 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 96.4 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 96.37 | |
| 1uru_A | 244 | Amphiphysin; endocytosis, coiled-coil, membrane cu | 96.15 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 94.75 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 94.64 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 94.41 | |
| 4a3a_A | 243 | Amphiphysin; structural genomics, invagination, kn | 93.83 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 93.57 | |
| 4avm_A | 237 | Bridging integrator 2; protein binding, plasma mem | 93.43 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 93.08 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 92.74 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 91.64 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 91.34 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 89.59 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 88.16 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 87.58 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 87.4 | |
| 1i4d_A | 224 | Arfaptin 2, partner of RAC1; coiled coil, G-protei | 87.23 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 87.04 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 86.86 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 86.29 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 85.93 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 84.18 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 83.99 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 83.98 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 82.97 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 82.89 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 82.43 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 82.06 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 81.95 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 81.93 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 81.69 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 81.44 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 81.37 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 81.19 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 81.16 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 80.69 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 80.64 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 80.56 |
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-39 Score=350.96 Aligned_cols=248 Identities=27% Similarity=0.383 Sum_probs=195.9
Q ss_pred hhhhhhHhHHHHHHHHHHhcccCCCCcchH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHH
Q 006831 7 TVAFNGDGNFVLQAREKFLSLRKSTRMDVA-VVIEEDLHNARTSFEQARFNLVGALSNVEAKKRFELLEAVGGTMDAHLR 85 (629)
Q Consensus 7 ~~~Fe~~q~kyd~~~~ky~slsk~k~~~~~-~E~a~eL~~aRk~f~~asldyv~~l~~vq~kk~~e~le~l~~~~~a~~~ 85 (629)
-++||+++.+||++++||++++|+|+++.. .|++++|+++|+.|++++||||.+|+.++.++++++|+.++.||+++.+
T Consensus 130 kk~fek~~~~yd~al~k~~~~~k~k~~e~~~~ea~~~l~~~rk~f~~~~ldy~~~l~~l~~rk~~e~le~l~~~~~a~~~ 209 (385)
T 2q13_A 130 KEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQIS 209 (385)
T ss_dssp HHHHHHHHHHHHHHHHHHHTCCSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 368999999999999999999999988755 6777999999999999999999999999999999999999999999999
Q ss_pred HHhhhhHhh-hhchHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCCCCCCCchHHH
Q 006831 86 FFKQGYELL-HQMEPFINQVLAYAQQSRECSDYEQASLHQRMQDYLKQIDRESRQCLNGSLGSPSGDNVKPFPRNSNKLI 164 (629)
Q Consensus 86 ff~~g~e~~-~~l~p~~~~l~~~~q~~r~~~~~~~~~L~~~m~~~k~qi~~~~~~s~~~~~~~ps~~~~~~~~~~~~k~~ 164 (629)
||++|++++ ++++||+++|..++++.|.+++++++.+.+.++.++. ....+ +.|+++..
T Consensus 210 ff~~g~~~~~~~~~~~~~~l~~~l~~~r~~~~~~~~~~~~~~~~l~~----~~~~~-----~~~~~~~~----------- 269 (385)
T 2q13_A 210 FFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEV----ASDPL-----YVPDPDPT----------- 269 (385)
T ss_dssp HHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHGGG-----SSSSCCTT-----------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc----cCCCC-----CCCCCccc-----------
Confidence 999999998 5999999999999999999999998888877765442 11111 11221110
Q ss_pred HHHHhhhccCCcceeEeeeeeeccCC--CCCCceeEEEEEecCceEEEEeCCCCCCCcCCCcccccCCCCCCcccccccc
Q 006831 165 EAAMQSAVKGKVQTIKQGYLSKRSSN--LRADWKRRFFVLDSRGLLYYYRKPWSWNSAAGSQSSIQRSNPSETSQGLLSR 242 (629)
Q Consensus 165 ~~~~~~~~~~~~~~iKqGyL~Krs~~--~~k~WkRRwFvL~~~glLyYy~~~~~~~~g~~~~~~~~~~~~~~~g~g~l~~ 242 (629)
+ .......++|+|||+|+++. .++.|+||||||+ ++.|+||++. +.
T Consensus 270 ----~-~~~~~~~~~k~G~L~K~~~~~~~~~~WkkRwfvL~-~~~L~y~k~~-~~------------------------- 317 (385)
T 2q13_A 270 ----K-FPVNRNLTRKAGYLNARNKTGLVSSTWDRQFYFTQ-GGNLMSQARG-DV------------------------- 317 (385)
T ss_dssp ----T-SCCCCCCSCCEEEEEEC--------CCEEEEEEEE-TTEEEEECSS-CS-------------------------
T ss_pred ----c-cccCCCCccEEEEEEEecCCCCCcCCceeEEEEEE-CCEEEEecCC-Cc-------------------------
Confidence 0 00112367899999999876 3457999999998 5667787763 21
Q ss_pred ccccccCCCccccccceeeEeecccceeecCCCCCCCcceEEEeeCC--cEEEEEeCCHHHHHHHHHHHHHHHHHHhccC
Q 006831 243 WLSSHYHGGVHDEKSVARHTVNLLTSTIKPDADQSDLRFCFRIISPT--KVYTLQAENTLDQMDWIEKINGVIASLLSFQ 320 (629)
Q Consensus 243 ~~~~~~~g~v~d~~~~~~~~i~l~~~~vk~~~d~~drrfcF~Iit~~--rty~LqAeSe~E~~~WI~aI~~aI~~~l~~~ 320 (629)
.+.+.|+|..|++.+. +..+++|||+|++++ ++|+|||+|++|+++||.+|+.+|..++...
T Consensus 318 ---------------~~~~~i~l~~~~v~~~-~~~~r~~~F~i~t~~~~~~~~l~A~s~~e~~~Wi~ai~~~~~~~~~~~ 381 (385)
T 2q13_A 318 ---------------AGGLAMDIDNCSVMAV-DCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSE 381 (385)
T ss_dssp ---------------SCEEEEECTTCEEEEE-CCTTCSSEEEEECTTSCBCCCEECSSHHHHHHHHHHHHHHHTTCC---
T ss_pred ---------------CCCceEEccceEEEec-cccCCCceEEEEeCCCCeEEEEEeCCHHHHHHHHHHHHHHHHhhcccc
Confidence 1235688888988774 446889999999999 9999999999999999999999998766544
Q ss_pred Cc
Q 006831 321 TP 322 (629)
Q Consensus 321 ~~ 322 (629)
.|
T Consensus 382 ~~ 383 (385)
T 2q13_A 382 NP 383 (385)
T ss_dssp --
T ss_pred CC
Confidence 33
|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 629 | ||||
| d1dcqa2 | 122 | g.45.1.1 (A:247-368) Pyk2-associated protein beta | 5e-38 | |
| d2elba1 | 268 | a.238.1.1 (A:6-273) DCC-interacting protein 13-alp | 4e-21 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-18 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-17 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 6e-14 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 2e-13 | |
| d1urua_ | 217 | a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila | 3e-11 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 9e-11 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 9e-11 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 1e-10 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 2e-10 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 3e-10 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 4e-10 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 9e-10 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 9e-10 | |
| d2d4ca1 | 237 | a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap | 1e-09 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 4e-09 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 7e-09 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 7e-09 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 7e-09 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 1e-08 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 2e-08 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 2e-08 | |
| d1y2oa1 | 248 | a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain | 2e-07 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 2e-07 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 2e-07 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 5e-07 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 1e-06 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 2e-06 | |
| d2coaa1 | 112 | b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma | 2e-06 | |
| d1i4da_ | 200 | a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Hum | 2e-05 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 2e-05 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 3e-05 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 3e-05 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 4e-05 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 7e-05 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 2e-04 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 2e-04 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 2e-04 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 7e-04 | |
| d1zc3b1 | 109 | b.55.1.1 (B:171-279) Exocyst complex protein EXO84 | 0.001 | |
| d1ki1b2 | 142 | b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( | 0.002 | |
| d1w1ha_ | 147 | b.55.1.1 (A:) 3-phosphoinositide dependent protein | 0.004 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 134 bits (339), Expect = 5e-38
Identities = 53/142 (37%), Positives = 76/142 (53%), Gaps = 23/142 (16%)
Query: 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDV 450
++ I ++R+ GN+ C DCGA +P W S NLG+L CI+CSG+HR LGVH S+++SLTLD
Sbjct: 3 KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD- 61
Query: 451 KVWEPSVLNLFQSLGNIYANSVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDD 510
V S L L +++GN N + E L KPNP
Sbjct: 62 -VLGTSELLLAKNIGNAGFNEIMECCL---------------------PSEDPVKPNPGS 99
Query: 511 SISVKEQYIHAKYAEKIFVHKR 532
+ ++ YI AKY E+ + K+
Sbjct: 100 DMIARKDYITAKYMERRYARKK 121
|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 200 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 629 | |||
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 100.0 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.79 | |
| d2elba1 | 268 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.77 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.76 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.74 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.73 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.72 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.72 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.72 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.72 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.7 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.7 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.7 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.69 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.69 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.69 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.69 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.68 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.68 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.67 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.67 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.65 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.64 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.64 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.63 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.63 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.62 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.62 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.57 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.56 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.55 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 99.03 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.89 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.76 | |
| d1y2oa1 | 248 | BAP2/IRSp53 N-terminal domain {Human (Homo sapiens | 98.61 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 98.51 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 98.44 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 98.44 | |
| d1urua_ | 217 | Amphiphysin {Fruit fly (Drosophila melanogaster) [ | 98.41 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 98.37 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 98.25 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 98.25 | |
| d2d4ca1 | 237 | Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.09 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.89 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 97.7 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 97.0 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 95.52 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 93.58 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 93.32 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 92.42 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 92.27 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 91.81 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 91.21 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 89.47 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 89.1 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 89.1 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 88.68 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 87.18 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 86.63 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 86.54 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 86.15 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 86.12 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 86.02 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 85.27 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 84.83 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 84.64 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 84.62 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 84.37 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 83.83 | |
| d1u5ka2 | 157 | Recombinational repair protein RecO, C-terminal do | 83.78 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 83.62 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 83.34 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 80.91 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 80.84 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 80.36 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 80.27 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=1.4e-40 Score=300.83 Aligned_cols=119 Identities=45% Similarity=0.801 Sum_probs=111.8
Q ss_pred cchHHHHHhccCCCCCCCCCCCCCCceecccceeEeccccccccccCcccceeeEeecCCCcCChhHHHHHhhcChhHHH
Q 006831 391 EKPIDLLRRVYGNNKCADCGASEPDWASLNLGVLICIQCSGVHRNLGVHISKVRSLTLDVKVWEPSVLNLFQSLGNIYAN 470 (629)
Q Consensus 391 ~~~~~~l~~~p~N~~CaDCg~~~p~w~s~n~Gv~lC~~CsgvHR~LG~hiSkVrSl~lD~~~w~~~~l~~~~~~GN~~~N 470 (629)
++.++.|++.|||+.|||||+++|+|||+|+|||||++|||+||+||+|||+|||++|| .|++++|++|+.+||..+|
T Consensus 3 ~~~l~~l~~~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld--~w~~~~i~~~~~~GN~~~n 80 (122)
T d1dcqa2 3 KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD--VLGTSELLLAKNIGNAGFN 80 (122)
T ss_dssp HHHHHHHHHSTTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTS--CCCGGGGHHHHHSCHHHHH
T ss_pred HHHHHHHHhCCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccC--CCCHHHHHHHHHHhHHHHH
Confidence 46788999999999999999999999999999999999999999999999999999999 7999999999999999999
Q ss_pred HHHHhhhccCCCCCccccccCccccccccccccCCCCCCCCHHHHHHHHHHHhccCcccccC
Q 006831 471 SVWEELLRIGNNSLTDERHMGFSRTDKQKRFIVRKPNPDDSISVKEQYIHAKYAEKIFVHKR 532 (629)
Q Consensus 471 ~i~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~kP~~~~~~~~re~fI~~KY~~k~f~~~~ 532 (629)
.+||+++++.. ..||.++++...|++||++||++|+|+.+.
T Consensus 81 ~~~ea~~~~~~---------------------~~kp~~~~~~~~r~~fI~~KY~~k~f~~k~ 121 (122)
T d1dcqa2 81 EIMECCLPSED---------------------PVKPNPGSDMIARKDYITAKYMERRYARKK 121 (122)
T ss_dssp HHHTTTCCSSS---------------------CCSCCTTCCHHHHHHHHHHHHTTCTTSCCC
T ss_pred HHHHhhCCccc---------------------CcCCCCCccHHHHHHHHHHHHHhCcccccc
Confidence 99999998632 368999999999999999999999999763
|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|