Citrus Sinensis ID: 006839

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63

MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA

cccccccHHHHHHHHHHHHHHHHccccEEEEEEccEEEEccccccccccEEccccccccccccEEEEEEEEccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccEEEcEEEEEcHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEEEcccccEEEccccccccccccccccccccEEEEEEEEEEEEcEEEEEEEccccccccHHHHHHHccccccccccccccccccccc

ccccccHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEccHHHHccHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccEEEcEEEEEccHHHHHHHHHHcccEEEEEEEcHHccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccEEEccEEEEEEcccccccccHcHHHccccccEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHccccHHHHHHHHHHccccHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEEEEEEccEEcccccHHHHHHHHHHccccccccccccccccHHHHccccccccccccccEEEEcccccEEEEccccccEEEcccccEEEEccccccccccccccccccccccEEEEEEccccEEEEccccccccccccccccHHccccccccccccEEEcccccEEEEccccEEEEcccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc

MESHGSITLKLFLGFLILSLNVHTSVSRFVVEknslmvtspekikgshdsaignfgipqyggsmagavtypkenrkgcrefgdfgisfkakpgalpnfvlvdrGDCFFALKVWNAQKAGASAVLVADDIEEALitmdtpeedissakyienitipsalidKSFGETLKKALsggemvnvnldwreavphpddrveyelwtnsndecgvKCDMLMAFVKEfrgpaqilekggytqftphyitwycpmtftlsrqCKSQcinhgrycapdpeqdfssgyegkdvVLENLRQLCVFKVAkeskkpwvwwdYVTDfqircpmkdkkynKECAAAVIKSLGLDAKKIEkcmgdpdadadnpvlkeeqdaqvgkgsrgdvtilptlvvnnrqyrgklekGAVLKAICSgfeettepavclsgetnecldnnggcwqdktanvtackdtfrgrvcecplvdgvqfkgdgyshcevsgpgkckinnggcwheskdghtysacldsengkcqcppgfkgdgvkscvdideckerkacqcsecsckdtwgsyectcsgdllyirdhdtcISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQympldsqsevpnhvndera

MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITmdtpeedissaKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKvakeskkpwvwwdYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEqdaqvgkgsrgdvtilptlvvnnrqyrgkleKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKerkacqcsecsckdtwgsyECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYmpldsqsevpnhvndera

MESHGSITlklflgflilslNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWviliglamagggaylvyKYRLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA

******ITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVT**********SAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIE*****************************DVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYM*****************

**********LFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPE******KYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYM*****************

MESHGSITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLK**********SRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQS***********

*****SITLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSGETNECLDNNGGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLD**************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		629	2.2.26 [Sep-21-2011]
O80977		628	Vacuolar-sorting receptor	yes	no	0.958	0.960	0.842	0.0
Q56ZQ3		628	Vacuolar-sorting receptor	yes	no	0.958	0.960	0.833	0.0
P93484		623	Vacuolar-sorting receptor	N/A	no	0.972	0.982	0.814	0.0
P93026		623	Vacuolar-sorting receptor	no	no	0.968	0.977	0.688	0.0
O22925		625	Vacuolar-sorting receptor	no	no	0.966	0.972	0.661	0.0
Q9FYH7		631	Vacuolar-sorting receptor	no	no	0.961	0.958	0.622	0.0
Q8L7E3		625	Vacuolar-sorting receptor	no	no	0.974	0.980	0.607	0.0
O64758		618	Vacuolar-sorting receptor	no	no	0.963	0.980	0.579	0.0
Q8NDA2		5065	Hemicentin-2 OS=Homo sapi	yes	no	0.200	0.024	0.302	2e-06
O70244		3623	Cubilin OS=Rattus norvegi	yes	no	0.186	0.032	0.354	3e-06

>sp\|O80977\|VSR3_ARATH Vacuolar-sorting receptor 3 OS=Arabidopsis thaliana GN=VSR3 PE=2 SV=1	Back alignment and function desciption

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/605 (84%), Positives = 560/605 (92%), Gaps = 2/605 (0%)

Query: 27  SRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGI 86
           +RFVVEKNSL VTSPE IKG+HDSAIGNFGIPQYGGSMAG V YPKEN+K C+EF DF I
Sbjct: 24  ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI 83

Query: 87  SFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSA 146
           SFK++PGALP F+LVDRGDCFFALKVWNAQKAGASAVLVAD+++E LITMDTPEED+SSA
Sbjct: 84  SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA 143

Query: 147 KYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC 206
           KYIENITIPSAL+ K FGE LKKA+SGG+MVN+NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct: 144 KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC 203

Query: 207 GVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCA 266
           GVKCDMLM FVK+F+G AQILEKGG+TQF PHYITWYCP  FTLSRQCKSQCIN GRYCA
Sbjct: 204 GVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCA 263

Query: 267 PDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKE 326
           PDPEQDFSSGY+GKDVV+ENLRQLCV+KVA E+ KPWVWWDYVTDFQIRCPMK+KKYNKE
Sbjct: 264 PDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKE 323

Query: 327 CAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 386
           CA +VIKSLG+D+KK++KCMGDPDAD DNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ
Sbjct: 324 CADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 383

Query: 387 YRGKLEKGAVLKAICSGFEETTEPAVCLSG--ETNECLDNNGGCWQDKTANVTACKDTFR 444
           YRGKLEK AVLKA+CSGFEETTEPA+CLS   E+NECLDNNGGCWQDK+AN+TACKDTFR
Sbjct: 384 YRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFR 443

Query: 445 GRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQC 504
           GRVCECP VDGVQFKGDGYSHCE SGPG+C INNGGCWHE +DGH +SAC+D ++ KC+C
Sbjct: 444 GRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGCWHEERDGHAFSACVDKDSVKCEC 503

Query: 505 PPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTA 564
           PPGFKGDG K C DI+ECKE+KACQC ECSCK+TWGSYEC+CSGDLLYIRDHDTCISKT 
Sbjct: 504 PPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCISKTG 563

Query: 565 TEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVPNHV 624
            +VRSAWAAVW+I++ L +A  GAYLVYKYRLR YMDSEIRAIMAQYMPLDSQ E+PNHV
Sbjct: 564 AQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIPNHV 623

Query: 625 NDERA 629
           NDERA
Sbjct: 624 NDERA 628

Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q56ZQ3\|VSR4_ARATH Vacuolar-sorting receptor 4 OS=Arabidopsis thaliana GN=VSR4 PE=2 SV=2	Back alignment and function description

>sp\|P93484\|VSR1_PEA Vacuolar-sorting receptor 1 OS=Pisum sativum GN=BP80 PE=1 SV=1	Back alignment and function description

>sp\|P93026\|VSR1_ARATH Vacuolar-sorting receptor 1 OS=Arabidopsis thaliana GN=VSR1 PE=1 SV=2	Back alignment and function description

>sp\|O22925\|VSR2_ARATH Vacuolar-sorting receptor 2 OS=Arabidopsis thaliana GN=VSR2 PE=2 SV=1	Back alignment and function description

>sp\|Q9FYH7\|VSR6_ARATH Vacuolar-sorting receptor 6 OS=Arabidopsis thaliana GN=VSR6 PE=2 SV=3	Back alignment and function description

>sp\|Q8L7E3\|VSR7_ARATH Vacuolar-sorting receptor 7 OS=Arabidopsis thaliana GN=VSR7 PE=2 SV=2	Back alignment and function description

>sp\|O64758\|VSR5_ARATH Vacuolar-sorting receptor 5 OS=Arabidopsis thaliana GN=VSR5 PE=2 SV=1	Back alignment and function description

>sp\|Q8NDA2\|HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens GN=HMCN2 PE=2 SV=2	Back alignment and function description

>sp\|O70244\|CUBN_RAT Cubilin OS=Rattus norvegicus GN=Cubn PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		629
224056244		630	predicted protein [Populus trichocarpa]	0.988	0.987	0.868	0.0
255573159		633	zinc finger protein, putative [Ricinus c	1.0	0.993	0.860	0.0
224105715		630	predicted protein [Populus trichocarpa]	0.971	0.969	0.893	0.0
225428981		636	PREDICTED: vacuolar-sorting receptor 3-l	0.988	0.977	0.844	0.0
296083057		631	unnamed protein product [Vitis vinifera]	0.988	0.985	0.844	0.0
356575734		631	PREDICTED: vacuolar-sorting receptor 1-l	0.988	0.985	0.835	0.0
297831944		627	hypothetical protein ARALYDRAFT_899691 [	0.958	0.961	0.846	0.0
356536097		631	PREDICTED: vacuolar-sorting receptor 1-l	0.988	0.985	0.835	0.0
15225998		628	vacuolar-sorting receptor 3 [Arabidopsis	0.958	0.960	0.842	0.0
356575736		636	PREDICTED: vacuolar-sorting receptor 1-l	0.988	0.977	0.825	0.0

>gi\|224056244\|ref\|XP_002298772.1\| predicted protein [Populus trichocarpa] gi\|222846030\|gb\|EEE83577.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/624 (86%), Positives = 586/624 (93%), Gaps = 2/624 (0%)

Query: 8   TLKLFLGFLILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGA 67
           +L LFLGFL++SL    S++RFVVEKNSL VTSP+KIKG++DSAIGNFGIPQYGGSMAGA
Sbjct: 7   SLNLFLGFLVISLIAPRSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGA 66

Query: 68  VTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVAD 127
           V YPK+N+KGC+EF  FGISF++KPGALP FVLVDRGDCFFALKVWNAQKAGASAVLVAD
Sbjct: 67  VVYPKDNKKGCKEFDGFGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVAD 126

Query: 128 DIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAV 187
           D+EE LITMDTP ED SSA+YIENITIPSALI+KSF ETLKKALS G+MVNVNLDWREAV
Sbjct: 127 DMEEPLITMDTPAEDASSAQYIENITIPSALIEKSFSETLKKALSNGDMVNVNLDWREAV 186

Query: 188 PHPDDRVEYELWTNSNDECGVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMT 247
           PHPDDRVEYELWTNSNDECGVKCDMLM FVK+FRG AQILEKGGYTQFTPHYITWYCP  
Sbjct: 187 PHPDDRVEYELWTNSNDECGVKCDMLMEFVKDFRGAAQILEKGGYTQFTPHYITWYCPQA 246

Query: 248 FTLSRQCKSQCINHGRYCAPDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWD 307
           FTLSRQCKSQCINHGRYCAPDPEQDFSSGY+GKDVVLENLRQLCVFKVA E+KKPWVWWD
Sbjct: 247 FTLSRQCKSQCINHGRYCAPDPEQDFSSGYDGKDVVLENLRQLCVFKVANETKKPWVWWD 306

Query: 308 YVTDFQIRCPMKDKKYNKECAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVG 367
           YVTDFQIRCPMK+KKYNKECA AVIKSLGLD KKI+KCMGDP A++DNPVLKEEQDAQVG
Sbjct: 307 YVTDFQIRCPMKEKKYNKECADAVIKSLGLDGKKIDKCMGDPKANSDNPVLKEEQDAQVG 366

Query: 368 KGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETTEPAVCLSG--ETNECLDNN 425
           KG+RGDVTILPTLVVNNRQYRGKLEKGAVLKA+CSGFEETTEPAVCLSG  ETNECLDNN
Sbjct: 367 KGTRGDVTILPTLVVNNRQYRGKLEKGAVLKALCSGFEETTEPAVCLSGDVETNECLDNN 426

Query: 426 GGCWQDKTANVTACKDTFRGRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHES 485
           GGCWQDK AN+TAC+DTFRGRVCECPLVDGVQFKGDGY +CEVSG G+CKINNGGCWHES
Sbjct: 427 GGCWQDKIANITACRDTFRGRVCECPLVDGVQFKGDGYKNCEVSGSGRCKINNGGCWHES 486

Query: 486 KDGHTYSACLDSENGKCQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECT 545
           +DGHT+SACLD + GKCQCPPGFKGDGVKSC+D+DECKERKACQC  CSCKDTWGSYEC+
Sbjct: 487 QDGHTFSACLDVDGGKCQCPPGFKGDGVKSCLDVDECKERKACQCPACSCKDTWGSYECS 546

Query: 546 CSGDLLYIRDHDTCISKTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIR 605
           CSGDLLY+RDHDTCISK+ TEV+SAW  VWVI IGLAMA GG YLVYK++LRSYMDSEIR
Sbjct: 547 CSGDLLYMRDHDTCISKSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEIR 606

Query: 606 AIMAQYMPLDSQSEVPNHVNDERA 629
           AIMAQYMPLDSQ+EVPNHV++ERA
Sbjct: 607 AIMAQYMPLDSQAEVPNHVHEERA 630

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255573159\|ref\|XP_002527509.1\| zinc finger protein, putative [Ricinus communis] gi\|223533149\|gb\|EEF34907.1\| zinc finger protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224105715\|ref\|XP_002313909.1\| predicted protein [Populus trichocarpa] gi\|222850317\|gb\|EEE87864.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225428981\|ref\|XP_002264769.1\| PREDICTED: vacuolar-sorting receptor 3-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296083057\|emb\|CBI22461.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356575734\|ref\|XP_003555992.1\| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|297831944\|ref\|XP_002883854.1\| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. lyrata] gi\|297329694\|gb\|EFH60113.1\| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356536097\|ref\|XP_003536576.1\| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi|15225998|ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana] gi|30679229|ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana] gi|71153403|sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal growth factor receptor-like protein 2a; Short=AtELP2a; Flags: Precursor gi|3252813|gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana] gi|20197383|gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana] gi|330251234|gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana] gi|330251235|gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356575736\|ref\|XP_003555993.1\| PREDICTED: vacuolar-sorting receptor 1-like isoform 2 [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		629
TAIR\|locus:2046911		628	VSR3 "vaculolar sorting recept	0.958	0.960	0.828	2.8e-295
TAIR\|locus:2046931		628	VSR4 "vacuolar sorting recepto	0.958	0.960	0.818	4.7e-293
TAIR\|locus:2085136		623	VSR1 "vacuolar sorting recepto	0.950	0.959	0.682	8.4e-248
TAIR\|locus:2015726		631	VSR6 "VACUOLAR SORTING RECEPTO	0.928	0.925	0.620	5.2e-216
TAIR\|locus:2044782		618	VSR5 "VACUOLAR SORTING RECEPTO	0.928	0.944	0.582	3.6e-199
UNIPROTKB\|Q5TCP6		240	HMCN1 "Hemicentin-1" [Homo sap	0.203	0.533	0.335	2.2e-10
DICTYBASE\|DDB_G0272434		1362	DDB_G0272434 [Dictyostelium di	0.349	0.161	0.271	7.4e-10
ZFIN\|ZDB-GENE-090112-4		1902	fbn2a "fibrillin 2a" [Danio re	0.233	0.077	0.304	1.1e-09
UNIPROTKB\|F1LRJ5		909	Scube1 "Protein Scube1" [Rattu	0.206	0.143	0.308	6.1e-07
UNIPROTKB\|I3LVG5		481	EGF "Pro-epidermal growth fact	0.136	0.178	0.368	3e-09

TAIR\|locus:2046911 VSR3 "vaculolar sorting receptor 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2835 (1003.0 bits), Expect = 2.8e-295, P = 2.8e-295
 Identities = 501/605 (82%), Positives = 547/605 (90%)

Query:    27 SRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFGDFGI 86
             +RFVVEKNSL VTSPE IKG+HDSAIGNFGIPQYGGSMAG V YPKEN+K C+EF DF I
Sbjct:    24 ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI 83

Query:    87 SFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSA 146
             SFK++PGALP F+LVDRGDCFFALKVWNAQKAGASAVLVAD+++E LITMDTPEED+SSA
Sbjct:    84 SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA 143

Query:   147 KYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWREAVPHPDDRVEYELWTNSNDEC 206
             KYIENITIPSAL+ K FGE LKKA+SGG+MVN+NLDWREAVPHPDDRVEYELWTNSNDEC
Sbjct:   144 KYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDEC 203

Query:   207 GVKCDMLMAFVKEFRGPAQILEKGGYTQFTPHYITWYCPMTFTLSRQCKSQCINHGRYCA 266
             GVKCDMLM FVK+F+G AQILEKGG+TQF PHYITWYCP  FTLSRQCKSQCIN GRYCA
Sbjct:   204 GVKCDMLMEFVKDFKGAAQILEKGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCA 263

Query:   267 PDPEQDFSSGYEGKDVVLENLRQLCVFKVAKESKKPWVWWDYVTDFQIRCPMKDKKYNKE 326
             PDPEQDFSSGY+GKDVV+ENLRQLCV+KVA E+ KPWVWWDYVTDFQIRCPMK+KKYNKE
Sbjct:   264 PDPEQDFSSGYDGKDVVVENLRQLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKE 323

Query:   327 CAAAVIKSLGLDAKKIEKCMGDPDADADNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 386
             CA +VIKSLG+D+KK++KCMGDPDAD DNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ
Sbjct:   324 CADSVIKSLGIDSKKLDKCMGDPDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQ 383

Query:   387 YRGKLEKGAVLKAICSGFEETTEPAVCLSG--ETNECLDNNGGCWQDKTANVTACKDTFR 444
             YRGKLEK AVLKA+CSGFEETTEPA+CLS   E+NECLDNNGGCWQDK+AN+TACKDTFR
Sbjct:   384 YRGKLEKSAVLKALCSGFEETTEPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFR 443

Query:   445 GRVCECPLVDGVQFKGDGYSHCEVSGPGKCKINNGGCWHESKDGHTYSACLDSENGKCQC 504
             GRVCECP VDGVQFKGDGYSHCE SGPG+C INNGGCWHE +DGH +SAC+D ++ KC+C
Sbjct:   444 GRVCECPTVDGVQFKGDGYSHCEPSGPGRCTINNGGCWHEERDGHAFSACVDKDSVKCEC 503

Query:   505 PPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCISKTA 564
             PPGFKGDG K C DI+ECKE+KACQC ECSCK+TWGSYEC+CSGDLLYIRDHDTCISKT 
Sbjct:   504 PPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCISKTG 563

Query:   565 TEVRSAWAAVWXXXXXXXXXXXXXXXXXKYRLRSYMDSEIRAIMAQYMPLDSQSEVPNHV 624
              +VRSAWAAVW                 KYRLR YMDSEIRAIMAQYMPLDSQ E+PNHV
Sbjct:   564 AQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIPNHV 623

Query:   625 NDERA 629
             NDERA
Sbjct:   624 NDERA 628

GO:0005509 "calcium ion binding" evidence=IEA

GO:0005887 "integral to plasma membrane" evidence=ISS

GO:0006623 "protein targeting to vacuole" evidence=ISS;IMP;TAS

GO:0006886 "intracellular protein transport" evidence=ISS

GO:0017119 "Golgi transport complex" evidence=IPI

GO:0016020 "membrane" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0005768 "endosome" evidence=IDA

GO:0005802 "trans-Golgi network" evidence=IDA

TAIR\|locus:2046931 VSR4 "vacuolar sorting receptor 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085136 VSR1 "vacuolar sorting receptor homolog 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2015726 VSR6 "VACUOLAR SORTING RECEPTOR 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2044782 VSR5 "VACUOLAR SORTING RECEPTOR 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5TCP6 HMCN1 "Hemicentin-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272434 DDB_G0272434 [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-090112-4 fbn2a "fibrillin 2a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LRJ5 Scube1 "Protein Scube1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LVG5 EGF "Pro-epidermal growth factor" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P93484	VSR1_PEA	No assigned EC number	0.8148	0.9729	0.9823	N/A	no
Q56ZQ3	VSR4_ARATH	No assigned EC number	0.8330	0.9586	0.9601	yes	no
O80977	VSR3_ARATH	No assigned EC number	0.8429	0.9586	0.9601	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_I4100	hypothetical protein (630 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		629
cd02125		127	cd02125, PA_VSR, PA_VSR: Protease-associated (PA)	4e-70
cd04818		118	cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas	2e-17
cd02123		153	cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a	3e-17
cd00538		126	cd00538, PA, PA: Protease-associated (PA) domain	2e-16
cd04816		122	cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-	2e-11
cd02132		139	cd02132, PA_GO-like, PA_GO-like: Protease-associat	1e-10
pfam02225		96	pfam02225, PA, PA domain	1e-10
cd04813		117	cd04813, PA_1, PA_1: Protease-associated (PA) doma	8e-09
cd02133		143	cd02133, PA_C5a_like, PA_C5a_like: Protease-associ	7e-08
cd02130		122	cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-as	4e-07
cd02127		118	cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-	1e-05
cd02129		120	cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-as	1e-05
cd02126		126	cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as	1e-04
smart00179		39	smart00179, EGF_CA, Calcium-binding EGF-like domai	3e-04
cd00054		38	cd00054, EGF_CA, Calcium-binding EGF-like domain,	7e-04
pfam12662		24	pfam12662, cEGF, Complement Clr-like EGF-like	0.001
cd02124		129	cd02124, PA_PoS1_like, PA_PoS1_like: Protease-asso	0.002
cd02122		138	cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-a	0.002

>gnl\|CDD\|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR)	Back alignment and domain information

 Score =  222 bits (568), Expect = 4e-70
 Identities = 83/128 (64%), Positives = 100/128 (78%), Gaps = 1/128 (0%)

Query: 54  NFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVW 113
           NFG+PQYGG++ G V YPKENR GC+EF  F    K++PG  P  +L+DRG CFF LK W
Sbjct: 1   NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAW 60

Query: 114 NAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSG 173
           NAQ+AGA+AVLVAD+++E L+TMDTPEE   SA YIE ITIPSALI K+FGE LKKA+S 
Sbjct: 61  NAQQAGAAAVLVADNVDEPLLTMDTPEES-GSADYIEKITIPSALITKAFGEKLKKAISN 119

Query: 174 GEMVNVNL 181
           GEMV + L
Sbjct: 120 GEMVVIKL 127

This group includes various PA domain-containing VSRs such as garden pea BP-80, pumpkin PV72, and various Arabidopsis VSRs including AtVSR1. In contrast to most eukaryotes, which only have one or two VSRs, plants have several. This may in part be a reflection of having a more complex vacuolar system with both lytic vacuoles and storage vacuoles. The lytic vacuole is thought to be equivalent to the mammalian lysosome and the yeast vacuole. Pea BP-80 is a type 1 transmembrane protein, involved in the targeting of proteins to the lytic vacuole; it has been suggested that this protein also mediates targeting to the storage vacuole. PV72 and AtVSR1 may mediate transport of seed storage proteins to protein storage vacuoles. The significance of the PA domain to VSRs has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 127

>gnl\|CDD\|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1	Back alignment and domain information

>gnl\|CDD\|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like	Back alignment and domain information

>gnl\|CDD\|238300 cd00538, PA, PA: Protease-associated (PA) domain	Back alignment and domain information

>gnl\|CDD\|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH)	Back alignment and domain information

>gnl\|CDD\|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10	Back alignment and domain information

>gnl\|CDD\|216938 pfam02225, PA, PA domain	Back alignment and domain information

>gnl\|CDD\|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1	Back alignment and domain information

>gnl\|CDD\|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase	Back alignment and domain information

>gnl\|CDD\|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY)	Back alignment and domain information

>gnl\|CDD\|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa)	Back alignment and domain information

>gnl\|CDD\|239044 cd02129, PA_hSPPL_like, PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like	Back alignment and domain information

>gnl\|CDD\|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins	Back alignment and domain information

>gnl\|CDD\|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain	Back alignment and domain information

>gnl\|CDD\|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>gnl\|CDD\|221695 pfam12662, cEGF, Complement Clr-like EGF-like	Back alignment and domain information

>gnl\|CDD\|239039 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-associated (PA) domain PoS1-like	Back alignment and domain information

>gnl\|CDD\|239037 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		629
cd02125		127	PA_VSR PA_VSR: Protease-associated (PA) domain-con	99.95
cd02123		153	PA_C_RZF_like PA_C-RZF_ like: Protease-associated	99.88
cd02126		126	PA_EDEM3_like PA_EDEM3_like: protease associated d	99.88
cd02127		118	PA_hPAP21_like PA_hPAP21_like: Protease-associated	99.88
cd02122		138	PA_GRAIL_like PA _GRAIL_like: Protease-associated	99.87
cd02132		139	PA_GO-like PA_GO-like: Protease-associated domain	99.86
KOG1214		1289	consensus Nidogen and related basement membrane pr	99.81
cd02129		120	PA_hSPPL_like PA_hSPPL_like: Protease-associated d	99.81
cd04813		117	PA_1 PA_1: Protease-associated (PA) domain subgrou	99.8
cd04816		122	PA_SaNapH_like PA_SaNapH_like: Protease-associated	99.78
cd02130		122	PA_ScAPY_like PA_ScAPY_like: Protease-associated d	99.74
cd04818		118	PA_subtilisin_1 PA_subtilisin_1: Protease-associat	99.73
KOG3920		193	consensus Uncharacterized conserved protein, conta	99.69
cd04817		139	PA_VapT_like PA_VapT_like: Protease-associated dom	99.68
cd02124		129	PA_PoS1_like PA_PoS1_like: Protease-associated (PA	99.67
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	99.66
KOG2442		541	consensus Uncharacterized conserved protein, conta	99.53
KOG1219		4289	consensus Uncharacterized conserved protein, conta	99.51
cd00538		126	PA PA: Protease-associated (PA) domain. The PA dom	99.49
PF02225		101	PA: PA domain; InterPro: IPR003137 The PA (Proteas	99.49
cd02133		143	PA_C5a_like PA_C5a_like: Protease-associated domai	99.39
cd04819		127	PA_2 PA_2: Protease-associated (PA) domain subgrou	99.36
cd04815		134	PA_M28_2 PA_M28_2: Protease-associated (PA) domain	99.27
cd02120		126	PA_subtilisin_like PA_subtilisin_like: Protease-as	99.11
cd02128		183	PA_TfR PA_TfR: Protease-associated domain containi	99.03
KOG1214		1289	consensus Nidogen and related basement membrane pr	98.91
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	98.69
KOG1219		4289	consensus Uncharacterized conserved protein, conta	98.6
KOG4289		2531	consensus Cadherin EGF LAG seven-pass G-type recep	98.6
cd02121		220	PA_GCPII_like PA_GCPII_like: Protease-associated d	98.53
cd04822		151	PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do	98.44
KOG4289		2531	consensus Cadherin EGF LAG seven-pass G-type recep	98.43
cd04814		142	PA_M28_1 PA_M28_1: Protease-associated (PA) domain	98.33
PF07645		42	EGF_CA: Calcium-binding EGF domain; InterPro: IPR0	98.3
cd04820		137	PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do	98.2
KOG1217		487	consensus Fibrillins and related proteins containi	98.05
cd02131		153	PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso	98.04
KOG4260		350	consensus Uncharacterized conserved protein [Funct	97.99
KOG1217		487	consensus Fibrillins and related proteins containi	97.97
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	97.97
KOG4260		350	consensus Uncharacterized conserved protein [Funct	97.95
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	97.93
PF14670		36	FXa_inhibition: Coagulation Factor Xa inhibitory s	97.82
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.68
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	97.64
PF12662		24	cEGF: Complement Clr-like EGF-like	97.5
PF12947		36	EGF_3: EGF domain; InterPro: IPR024731 This entry	97.35
PF12662		24	cEGF: Complement Clr-like EGF-like	97.27
PF02128		378	Peptidase_M36: Fungalysin metallopeptidase (M36);	97.26
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	96.87
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	96.7
smart00179		39	EGF_CA Calcium-binding EGF-like domain.	96.58
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	96.57
smart00181		35	EGF Epidermal growth factor-like domain.	95.86
cd00053		36	EGF Epidermal growth factor domain, found in epide	95.73
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	95.5
PHA03099		139	epidermal growth factor-like protein (EGF-like pro	95.07
KOG1225		525	consensus Teneurin-1 and related extracellular mat	94.77
PF06247		197	Plasmod_Pvs28: Plasmodium ookinete surface protein	94.53
cd00054		38	EGF_CA Calcium-binding EGF-like domain, present in	94.51
PF00008		32	EGF: EGF-like domain This is a sub-family of the P	94.46
KOG1225		525	consensus Teneurin-1 and related extracellular mat	94.3
cd04821		157	PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do	94.29
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	93.01
cd00053		36	EGF Epidermal growth factor domain, found in epide	92.74
PF12946		37	EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730	92.03
KOG2195		702	consensus Transferrin receptor and related protein	91.13
smart00181		35	EGF Epidermal growth factor-like domain.	88.43
KOG1226		783	consensus Integrin beta subunit (N-terminal portio	88.39
PF12955		103	DUF3844: Domain of unknown function (DUF3844); Int	86.54
PF12661		13	hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E	85.96
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	84.89

>cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR)	Back alignment and domain information

Probab=99.95  E-value=4.9e-27  Score=210.19  Aligned_cols=127  Identities=65%  Similarity=1.100  Sum_probs=106.2

Q ss_pred             CcCCCCCCCCceeeEeccCCCcCCCCCCCCCCCccccCCCCCCcEEEEeCCCcCHHHHHHHHHHcCCcEEEEEECCCCCc
Q 006839           54 NFGIPQYGGSMAGAVTYPKENRKGCREFGDFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEAL  133 (629)
Q Consensus        54 ~Fg~~~~~~~~~g~l~~~~~~~~gC~~~~~~~~~~~~~~~~~~~i~Lv~RG~C~F~~K~~nAq~aGA~avII~n~~~~~~  133 (629)
                      +||.++||+++.|.|++|+++.+||+++.....+.+.++...++||||+||+|+|.+|++|||++||+||||||+.++++
T Consensus         1 ~FG~~~yg~~~~G~l~~~~~~~~gC~~~~~~~~~~~~~~~~~~~IvLv~RG~C~F~~K~~~Aq~aGA~avII~n~~~~~~   80 (127)
T cd02125           1 NFGLPQYGGTLTGVVVYPKENRTGCKEFDVFFKPKKSEPGRRPVILLLDRGGCFFTLKAWNAQQAGAAAVLVADNVDEPL   80 (127)
T ss_pred             CCCCCCcCCeeEEEEEecCCccccCCCCcccccccccccCCCceEEEEECCCcCHHHHHHHHHHCCCcEEEEEECCCCcc
Confidence            69999999999999999988999999997632122222345589999999999999999999999999999999998878


Q ss_pred             eecCCCCCccccccccCcccccEEEEeHHHHHHHHHHHcCCCeEEEEE
Q 006839          134 ITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNL  181 (629)
Q Consensus       134 ~~m~~~~~~~~~~~~~~~i~IP~~~I~~~~G~~l~~~l~~~~~v~~~~  181 (629)
                      +.|..+.++. +.++..+|+||++||++++|+.|+++|++|..|+|+|
T Consensus        81 ~~m~~~~~~~-~~~~~~~i~IP~v~Is~~~G~~L~~~l~~g~~V~v~~  127 (127)
T cd02125          81 LTMDTPEESG-SADYIEKITIPSALITKAFGEKLKKAISNGEMVVIKL  127 (127)
T ss_pred             ccccCccccc-ccccCCCceEeEEEECHHHHHHHHHHHhcCCeEEEeC
Confidence            8886554321 1134567899999999999999999999999998875

>cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like	Back alignment and domain information

>cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins	Back alignment and domain information

>cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa)	Back alignment and domain information

>cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like	Back alignment and domain information

>cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10	Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like	Back alignment and domain information

>cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1	Back alignment and domain information

>cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH)	Back alignment and domain information

>cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY)	Back alignment and domain information

>cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1	Back alignment and domain information

>KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only]	Back alignment and domain information

>cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530	Back alignment and domain information

>cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only]	Back alignment and domain information

>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]	Back alignment and domain information

>cd00538 PA PA: Protease-associated (PA) domain	Back alignment and domain information

>PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A []	Back alignment and domain information

>cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase	Back alignment and domain information

>cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2	Back alignment and domain information

>cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2	Back alignment and domain information

>cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases	Back alignment and domain information

>cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR)	Back alignment and domain information

>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures]	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]	Back alignment and domain information

>cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like	Back alignment and domain information

>cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3	Back alignment and domain information

>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]	Back alignment and domain information

>cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1	Back alignment and domain information

>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins	Back alignment and domain information

>cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1	Back alignment and domain information

>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2)	Back alignment and domain information

>KOG4260 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms]	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>KOG4260 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins	Back alignment and domain information

>PF12662 cEGF: Complement Clr-like EGF-like	Back alignment and domain information

>PF02128 Peptidase_M36: Fungalysin metallopeptidase (M36); InterPro: IPR001842 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>smart00179 EGF_CA Calcium-binding EGF-like domain	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium

Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional	Back alignment and domain information

>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium	Back alignment and domain information

>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins	Back alignment and domain information

>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins	Back alignment and domain information

>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

Back alignment and domain information

>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein	Back alignment and domain information

>KOG2195 consensus Transferrin receptor and related proteins containing the protease-associated (PA) domain [Posttranslational modification, protein turnover, chaperones; Inorganic ion transport and metabolism; General function prediction only]	Back alignment and domain information

>smart00181 EGF Epidermal growth factor-like domain	Back alignment and domain information

>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures]	Back alignment and domain information

>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species	Back alignment and domain information

>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		629
3p5c_L		440	The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE		6e-04

>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440

Back alignment and structure

Iteration: 1
 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 37/78 (47%), Gaps = 13/78 (16%)
Query: 470 GPGKCKINNGGCWHESKDGHTYSACLDSENG-KCQCPPGFKGDGVKSCVDIDECKERKAC 528
           G  +C  NNGGC H          C D + G +C CP GF+    + C DIDEC++   C
Sbjct: 39  GTNECLDNNGGCSH---------VCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTC 89
Query: 529 QCSECSCKDTWGSYECTC 546
                 C +  G Y+C C
Sbjct: 90  S---QLCVNLEGGYKCQC 104

PyMOL of 3p5c

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		629
3icu_A		194	E3 ubiquitin-protein ligase RNF128; E3 ligase, ene	6e-21
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	1e-14
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	4e-13
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	6e-13
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	3e-12
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	1e-04
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	7e-12
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	2e-11
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	9e-06
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	1e-04
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	5e-11
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	7e-04
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	1e-10
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	6e-05
2bou_A		143	EGF-like module containing mucin-like hormone rece	6e-10
2bou_A		143	EGF-like module containing mucin-like hormone rece	8e-07
2bou_A		143	EGF-like module containing mucin-like hormone rece	8e-06
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	6e-10
1aut_L		114	Activated protein C; serine proteinase, plasma cal	8e-08
1aut_L		114	Activated protein C; serine proteinase, plasma cal	8e-07
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	9e-08
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	9e-06
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	2e-07
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	9e-05
2vh0_B		134	Activated factor XA light chain; serine protease,	3e-07
2vh0_B		134	Activated factor XA light chain; serine protease,	6e-07
3v65_B		386	Low-density lipoprotein receptor-related protein;	6e-07
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	9e-07
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	1e-06
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	6e-06
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	5e-05
1xf1_A		926	C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St	1e-06
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	2e-06
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	2e-06
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	2e-04
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	3e-06
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	3e-06
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	3e-05
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	3e-06
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	9e-04
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	6e-06
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	1e-05
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	2e-05
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	3e-05
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	3e-05
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	7e-05
2wph_E		59	Coagulation factor IXA light chain; serine proteas	1e-04
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	2e-04
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	2e-04
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	2e-04
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	2e-04
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	5e-04
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	2e-04
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	5e-04
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	6e-04
3gmf_A		205	Protein-disulfide isomerase; oxidoreductase, PSI-2	7e-04
3bci_A		186	Disulfide bond protein A; thiol-disulfide oxidored	9e-04

>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194	Back alignment and structure

 Score = 90.2 bits (223), Expect = 6e-21
 Identities = 24/141 (17%), Positives = 50/141 (35%), Gaps = 12/141 (8%)

Query: 46  GSHDSAIGNFGIPQYGGSMAGAVTYPKE--NRKGCREFGDFGISFKAKPGALPNFV-LVD 102
               S  G +G       +AG +  P        C    +F +          +++ L+ 
Sbjct: 52  VWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQ 111

Query: 103 RGD-CFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDISSAKYIENITIPSALIDK 161
           RG  C FA K+  A + GAS  ++ +        +           +   + I + +I  
Sbjct: 112 RGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVI--------PMSHPGAVDIVAIMIGN 163

Query: 162 SFGETLKKALSGGEMVNVNLD 182
             G  + +++  G  V + ++
Sbjct: 164 LKGTKILQSIQRGIQVTMVIE 184

PyMOL of 3icu

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690	Back alignment and structure

>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926	Back alignment and structure

>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142

Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Length = 175	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53	Back alignment and structure

>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Length = 205	Back alignment and structure

>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Length = 186	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		629
3icu_A		194	E3 ubiquitin-protein ligase RNF128; E3 ligase, ene	99.9
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.66
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.66
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.61
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.6
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.59
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	99.58
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	99.58
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	99.52
1yo8_A		634	Thrombospondin-2; EGF, Ca(2+)-binding domains, lec	99.49
1z1y_A		186	Ookinete surface protein PVS25; four EGF-like doma	99.4
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.38
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.37
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	99.33
2vj3_A		135	Neurogenic locus notch homolog protein 1; transcri	99.31
2bou_A		143	EGF-like module containing mucin-like hormone rece	99.31
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.19
3iib_A		444	Peptidase M28; YP_926796.1, structural genomics, J	99.18
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	99.16
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	99.12
1emn_A		82	Fibrillin; extracellular matrix, calcium-binding,	99.12
1lmj_A		86	Fibrillin 1; EGF, calcium, microfibril, neonatal,	99.11
1aut_L		114	Activated protein C; serine proteinase, plasma cal	99.08
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	99.06
1uzk_A		162	Fibrillin-1; glycoprotein, extra-cellular matrix,	99.04
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	99.03
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	99.02
1z6c_A		87	Vitamin K-dependent protein S; EGF module, blood c	99.01
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	99.0
2vh0_B		134	Activated factor XA light chain; serine protease,	98.99
2ek8_A		421	Aminopeptidase; metalloproteinase, hydrolase; 1.80	98.98
1x7a_L		146	Coagulation factor IX, light chain; inhibition, bl	98.94
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.92
4d90_A		143	EGF-like repeat and discoidin I-like domain-conta	98.91
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	98.91
1aut_L		114	Activated protein C; serine proteinase, plasma cal	98.89
3fed_A		707	Glutamate carboxypeptidase III; metallopeptidase,	98.89
2w2n_E		107	LDL receptor, low-density lipoprotein receptor; hy	98.86
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.83
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	98.83
1dx5_I		118	Thrombomodulin; serine proteinase, EGF-like domain	98.78
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	98.76
2w86_A		147	Fibrillin-1, fibrillin1; phosphoprotein, EGF-like	98.75
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	98.74
3v65_B		386	Low-density lipoprotein receptor-related protein;	98.73
1nfu_B		195	Coagulation factor XA, light chain; hydrolase; HET	98.67
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	98.66
2vh0_B		134	Activated factor XA light chain; serine protease,	98.62
2c4f_L		142	Coagulation factor VII precursor; blood coagulatio	98.61
4fbr_A		267	Lectin, myxobacterial hemagglutinin; beta-barrel,	98.58
1tpg_A		91	T-plasminogen activator F1-G; plasminogen activati	98.57
3kas_A		640	Transferrin receptor protein 1; transferrin recept	98.57
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	98.56
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	98.47
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	98.36
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	98.33
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	98.31
2ygq_A		324	WIF-1, WNT inhibitory factor 1; signaling protein,	98.27
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	98.25
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	98.22
1kli_L		69	Factor VIIA; extrinsic coagulation pathway, serine	98.14
2jkh_L		55	Factor X light chain; plasma, calcium, zymogen, se	98.13
3fcs_B		690	Integrin beta-3; beta propeller, rossmann fold, EG	98.11
3i6s_A		649	Subtilisin-like protease; PA-domain, FN3-domain, h	98.11
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	98.09
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	98.04
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	97.97
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.91
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	97.88
1apq_A		53	Complement protease C1R; EGF, calcium binding, ser	97.82
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	97.8
1xf1_A		926	C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St	97.73
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	97.71
1kig_L		51	Factor XA; glycoprotein, serine protease, plasma,	97.7
2wph_E		59	Coagulation factor IXA light chain; serine proteas	97.69
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	97.66
1y9z_A		441	Alkaline serine protease; subtilisin-like alpha/be	97.64
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	97.64
2vj2_A		169	Jagged-1; signalling, polymorphism, glycoprotein,	97.58
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	97.54
2bz6_L		53	Blood coagulation factor VIIA; serine protease, en	97.47
2wph_E		59	Coagulation factor IXA light chain; serine proteas	97.39
3u7u_G		55	Neuregulin 1; signaling protein, transferase-trans	97.38
1szb_A		170	Mannose binding lectin-associated serine protease-	97.35
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	97.35
2kl7_A		71	Fibulin-4; secreted, calcium, disease mutation, di	97.3
1gl4_A		285	Nidogen-1, entactin; immunoglobulin-like domain, e	97.26
1n1i_A		105	Merozoite surface protein-1; MSP1, malaria, surfac	97.23
1edm_B		39	Factor IX; epidermal growth factor, EGF, calcium-	97.23
1ob1_C		99	Major merozoite surface protein; immune system, im	97.17
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	97.16
1ob1_C		99	Major merozoite surface protein; immune system, im	97.11
2k2s_B		61	Micronemal protein 6; microneme protein complex, c	96.88
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	96.88
1nzi_A		159	Complement C1S component; calcium, innate immunity	96.8
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	96.8
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	96.77
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	96.71
1szb_A		170	Mannose binding lectin-associated serine protease-	96.64
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	96.62
1egf_A		53	Epidermal growth factor; NMR {Mus musculus} SCOP:	96.48
3k6s_B		687	Integrin beta-2; cell receptor, adhesion molecule,	96.46
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	96.41
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	96.35
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	96.25
3f1s_B		283	Vitamin K-dependent protein Z; PZ, ZPI, complex, s	96.14
1hae_A		63	Heregulin-alpha; growth factor; NMR {Homo sapiens}	96.08
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	95.83
3f1s_B		283	Vitamin K-dependent protein Z; PZ, ZPI, complex, s	95.75
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	95.7
1a3p_A		45	Epidermal growth factor; disulfide connectivities,	95.47
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	95.31
1nzi_A		159	Complement C1S component; calcium, innate immunity	95.24
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	94.93
1k36_A		46	Epiregulin; EGF-like fold, hormone/growth factor c	94.89
1g1s_A		162	P-selectin; selectin, lectin, EGF, sulphated, SLEX	94.47
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	94.08
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	93.86
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	93.84
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	93.15
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	92.93
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	92.69
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	92.57
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	92.49
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	92.2
1nql_B		53	Epidermal growth factor; cell surface receptor, ty	91.83
3vta_A		621	Cucumisin; subtilisin-like fold, serine protease,	91.8
4aqs_A		525	Laminin subunit beta-1; cell adhesion; HET: NAG BM	91.78
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	91.61
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	91.17
1b9w_A		95	Protein (merozoite surface protein 1); MSP-1, cand	90.91
1b9w_A		95	Protein (merozoite surface protein 1); MSP-1, cand	90.66
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	90.22
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	89.64
1q4g_A		553	Prostaglandin G/H synthase 1; cyclooxygenase, non-	89.62
3zyj_B		426	Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA	89.12
2p28_B		217	Integrin beta-2; hybrid domain, PSI domain, I-EGF	88.28
2fd6_A		122	Urokinase-type plasminogen activator; UPAR, ATF, A	86.9
3ca7_A		52	Protein spitz; argos, EGF, developmental protein,	86.57
1g1t_A		157	E-selectin; EGF, adhesion molecule, SLEX, immune s	86.0
3nt1_A		587	Prostaglandin-endoperoxide synthase 2; prostagland	85.96
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	85.8
2rnl_A		50	Amphiregulin; AR, colorectum cell-derived growth f	84.33
3asi_A		410	Neurexin-1-alpha; beta-sandwich, cell adhesion, sy	83.63
3ltf_D		58	Protein spitz; receptor-ligand complex ectodomain	83.44
3cfw_A		164	L-selectin; EGF, cell adhesion, EGF-like domain, g	83.32
1xdt_R		79	Hbegf, heparin-binding epidermal growth factor; co	82.3
3dem_A		278	Complement factor MAsp-3; complement system, innat	81.76
1nt0_A		286	MAsp2, mannose-binding protein associated serine p	80.2
3e50_C		50	Protransforming growth factor alpha; IDE, TGF-alph	80.02

>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens}	Back alignment and structure

Probab=99.90  E-value=1e-22  Score=192.78  Aligned_cols=128  Identities=21%  Similarity=0.319  Sum_probs=104.4

Q ss_pred             cccccccCcCCCCCCCCceeeEeccC--CCcCCCCCCCCCCCccc-cCCCCCCcEEEEeCCC-cCHHHHHHHHHHcCCcE
Q 006839           47 SHDSAIGNFGIPQYGGSMAGAVTYPK--ENRKGCREFGDFGISFK-AKPGALPNFVLVDRGD-CFFALKVWNAQKAGASA  122 (629)
Q Consensus        47 ~~~~~~a~Fg~~~~~~~~~g~l~~~~--~~~~gC~~~~~~~~~~~-~~~~~~~~i~Lv~RG~-C~F~~K~~nAq~aGA~a  122 (629)
                      .+....|.||...+.+.+.|.|+++.  .+.+||++++++..+.. ......++||||+||+ |+|.+|++|||++||+|
T Consensus        53 ~~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~gkIaLV~RG~~CsF~~Kv~nAq~aGA~a  132 (194)
T 3icu_A           53 WELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASG  132 (194)
T ss_dssp             EEEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCCEEEEEESCTTCCHHHHHHHHHHTTCSE
T ss_pred             eecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCCeEEEEECCCCcCHHHHHHHHHHCCCcE
Confidence            46688999999999999999999875  47899999876432211 0012348999999999 99999999999999999


Q ss_pred             EEEEECCC--CCceecCCCCCccccccccCcccccEEEEeHHHHHHHHHHHcCCCeEEEEEEec
Q 006839          123 VLVADDIE--EALITMDTPEEDISSAKYIENITIPSALIDKSFGETLKKALSGGEMVNVNLDWR  184 (629)
Q Consensus       123 vII~n~~~--~~~~~m~~~~~~~~~~~~~~~i~IP~~~I~~~~G~~l~~~l~~~~~v~~~~~~~  184 (629)
                      |||||+.+  +.+++|..++          ..+||++||++++|+.|+++|++|..|+++|.+.
T Consensus       133 vIIyNn~~~g~~~~~m~~~~----------~~~IPsv~Is~~~G~~L~~~L~~G~~Vtvti~vg  186 (194)
T 3icu_A          133 AVIFNFPGTRNEVIPMSHPG----------AVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVG  186 (194)
T ss_dssp             EEEECCTTCTTCCCCCCCTT----------CCSSEEEEECHHHHHHHHHHHHTTCCEEEEEEEE
T ss_pred             EEEEeCCCCCCceeeecCCC----------CCceeEEEECHHHHHHHHHHHHCCCeEEEEEECC
Confidence            99999852  3456775321          3479999999999999999999999999998873

PyMOL of 3icu

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A*	Back alignment and structure

>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A*	Back alignment and structure

>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B}	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A	Back alignment and structure

>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1	Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens}	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A*	Back alignment and structure

>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L*	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens}	Back alignment and structure

Back alignment and structure

>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L*	Back alignment and structure

>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ...	Back alignment and structure

>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A	Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens}	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L*	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ...	Back alignment and structure

Back alignment and structure

>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A*	Back alignment and structure

>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A	Back alignment and structure

>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens}	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L*	Back alignment and structure

>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ...	Back alignment and structure

>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B*	Back alignment and structure

>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A*	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A*	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L*	Back alignment and structure

>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B*	Back alignment and structure

>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens}	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A	Back alignment and structure

>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4	Back alignment and structure

>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A	Back alignment and structure

>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A	Back alignment and structure

>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens}	Back alignment and structure

>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens}	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A	Back alignment and structure

>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C*	Back alignment and structure

>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo}	Back alignment and structure

>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A	Back alignment and structure

>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ...	Back alignment and structure

>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A	Back alignment and structure

>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A	Back alignment and structure

>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D	Back alignment and structure

>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A	Back alignment and structure

>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ...	Back alignment and structure

>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus}	Back alignment and structure

>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster}	Back alignment and structure

>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens}	Back alignment and structure

>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1	Back alignment and structure

>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens}	Back alignment and structure

>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1	Back alignment and structure

>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		629
d1emoa1		43	g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa	1e-06
d1rfnb_		57	g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens	2e-05
d1kigl_		51	g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo	2e-05
d1lmja2		42	g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien	5e-05
d2p3ua1		51	g.3.11.1 (A:87-137) Factor X, N-terminal module {H	9e-05
d2bz6l1		53	g.3.11.1 (L:90-142) Coagulation factor VIIa {Human	1e-04
d1lmja1		44	g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens	2e-04
d1autl2		50	g.3.11.1 (L:97-146) Activated protein c (autoproth	3e-04
d1de4c2		193	c.8.4.1 (C:190-382) Transferrin receptor ectodomai	4e-04
d1uzka2		43	g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa	5e-04
d1uzka1		43	g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa	0.002
d1apqa_		53	g.3.11.1 (A:) Complement protease C1R {Human (Homo	0.002
d3bpse1		40	g.3.11.1 (E:293-332) Low density lipoprotein (LDL)	0.004
d1dx5i3		40	g.3.11.1 (I:423-462) Thrombomodulin, different EGF	0.004

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43	Back information, alignment and structure


class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.6 bits (103), Expect = 1e-06
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 515 SCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCI 560
           S VD+DECKE   C+  +  C +T GSY C C     YI   + C+
Sbjct: 1   SAVDMDECKEPDVCKHGQ--CINTDGSYRCECPFG--YILAGNECV 42

PyMOL of d1emoa1

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50	Back information, alignment and structure

>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} Length = 193	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		629
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.83
d1de4c2		193	Transferrin receptor ectodomain, apical domain {Hu	98.81
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	98.8
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.8
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.79
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.77
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	98.75
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.72
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	98.67
d1szba2		45	Mannose-binding protein associated serine protease	98.66
d1nt0a3		45	Mannose-binding protein associated serine protease	98.63
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.61
d1uzka1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.59
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	98.59
d1i0ua2		41	Low density lipoprotein (LDL) receptor, different	98.48
d3bi1a2		233	Glutamate carboxypeptidase II {Human (Homo sapiens	98.47
d1lmja2		42	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.47
d1uzka2		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.44
d1emoa1		43	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.43
d1nt0a3		45	Mannose-binding protein associated serine protease	98.42
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	98.4
d1szba2		45	Mannose-binding protein associated serine protease	98.38
d1apqa_		53	Complement protease C1R {Human (Homo sapiens) [Tax	98.37
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	98.27
d1lmja1		44	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	98.26
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	98.25
d3bpse1		40	Low density lipoprotein (LDL) receptor, different	98.22
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	98.17
d1nzia2		42	Complement C1S component {Human (Homo sapiens) [Ta	98.14
d2vj3a1		42	Neurogenic locus notch homolog protein 1, Notch1 {	98.11
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	98.1
d1dx5i3		40	Thrombomodulin, different EGF-like domains {Human	98.09
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	97.93
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	97.85
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	97.83
d1autl2		50	Activated protein c (autoprothrombin IIa) {Human (	97.77
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	97.75
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	97.74
d2p3ua1		51	Factor X, N-terminal module {Human (Homo sapiens)	97.74
d2c4fl1		37	Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	97.74
d1edmb_		39	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	97.67
d1kigl_		51	Factor X, N-terminal module {Cow (Bos taurus) [Tax	97.66
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	97.63
d2vj3a2		39	Neurogenic locus notch homolog protein 1, Notch1 {	97.61
d1gl4a2		40	EGF-like domain of nidogen-1 {Mouse (Mus musculus)	97.59
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	97.48
d1ijqa2		50	Low density lipoprotein (LDL) receptor, different	97.44
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	97.38
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	97.33
d2vj3a3		35	Neurogenic locus notch homolog protein 1, Notch1 {	97.33
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	97.3
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	97.27
d1xkba1		39	Factor X, N-terminal module {Human (Homo sapiens)	97.25
d1rfnb_		57	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	97.09
d1rfnb_		57	Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606	97.08
d2bz6l1		53	Coagulation factor VIIa {Human (Homo sapiens) [Tax	96.97
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	96.86
d2bz6l1		53	Coagulation factor VIIa {Human (Homo sapiens) [Tax	96.82
d1g1ta2		39	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	96.81
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	96.72
d1g1sa2		40	E-selectin, EGF-domain {Human (Homo sapiens) [TaxI	96.69
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	96.4
d1tpga1		41	Plasminogen activator (tissue-type), t-PA {Human (	96.4
d1autl1		48	Activated protein c (autoprothrombin IIa) {Human (	96.33
d1emoa2		39	Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	95.85
d1cvua2		41	Prostaglandin H2 synthase-1, EGF-like module {Mous	95.8
d1q4ga2		42	Prostaglandin H2 synthase-1, EGF-like module {Shee	95.42
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	95.31
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	94.54
d1haea_		63	Heregulin-alpha, EGF-like domain {Human (Homo sapi	94.32
d3egfa_		53	Epidermal growth factor, EGF {Mouse (Mus musculus)	93.11
d1dx5i1		43	Thrombomodulin, different EGF-like domains {Human	90.41
d1nqlb_		48	Epidermal growth factor, EGF {Human (Homo sapiens)	90.19
d1k36a_		46	Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI	89.48
d1dx5i1		43	Thrombomodulin, different EGF-like domains {Human	87.91
d1ioxa_		50	Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]	86.62
d1moxc_		49	Transforming growth factor alpha {Human (Homo sapi	84.83

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.83  E-value=9.3e-10  Score=75.99  Aligned_cols=42  Identities=29%  Similarity=0.639  Sum_probs=36.8

Q ss_pred             CCCCCCCCC-CCCCCCCCceeeCCCceeEecCCCCcccCCCCcccc
Q 006839          517 VDIDECKER-KACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCIS  561 (629)
Q Consensus       517 ~dideC~~~-~~C~~~~~~C~nt~Gsy~C~C~~G~~~~~~g~~C~~  561 (629)
                      +|||||+.. ..|+   +.|+|++|+|+|.|++||.+..++.+|..
T Consensus         1 TDidEC~~~~~~c~---~~C~Nt~G~y~C~C~~Gy~l~~d~~~C~D   43 (43)
T d1uzka1           1 TDVNECLDPTTCIS---GNCVNTPGSYICDCPPDFELNPTRVGCVD   43 (43)
T ss_dssp             CCCCGGGSTTSSBT---SEEEEETTEEEEECCTTCEECTTSSBEEC
T ss_pred             CCccccCCCCcCcC---CEeECCCCCEEEecCCCCEECCCCCcccC
Confidence            489999876 4455   89999999999999999999999999863

PyMOL of d1uzka1

>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure