Citrus Sinensis ID: 006894
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 627 | ||||||
| 359489252 | 619 | PREDICTED: protein WAX2-like [Vitis vini | 0.966 | 0.978 | 0.656 | 0.0 | |
| 359489254 | 619 | PREDICTED: protein WAX2-like [Vitis vini | 0.964 | 0.977 | 0.658 | 0.0 | |
| 297734710 | 631 | unnamed protein product [Vitis vinifera] | 0.963 | 0.957 | 0.653 | 0.0 | |
| 359489250 | 619 | PREDICTED: protein WAX2-like [Vitis vini | 0.964 | 0.977 | 0.649 | 0.0 | |
| 356504497 | 627 | PREDICTED: protein WAX2-like [Glycine ma | 0.966 | 0.966 | 0.653 | 0.0 | |
| 356520717 | 624 | PREDICTED: protein WAX2-like [Glycine ma | 0.966 | 0.971 | 0.651 | 0.0 | |
| 359489248 | 619 | PREDICTED: protein WAX2-like [Vitis vini | 0.964 | 0.977 | 0.649 | 0.0 | |
| 297734709 | 2763 | unnamed protein product [Vitis vinifera] | 0.950 | 0.215 | 0.649 | 0.0 | |
| 225454042 | 620 | PREDICTED: protein WAX2 [Vitis vinifera] | 0.966 | 0.977 | 0.636 | 0.0 | |
| 225454040 | 620 | PREDICTED: protein WAX2 [Vitis vinifera] | 0.966 | 0.977 | 0.636 | 0.0 |
| >gi|359489252|ref|XP_002263787.2| PREDICTED: protein WAX2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 839 bits (2168), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 415/632 (65%), Positives = 510/632 (80%), Gaps = 26/632 (4%)
Query: 1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
MASKPGILT+WPW PLG++K+VVLAPWA+H++Y F+ + ERD A+FLIFPFLL RMLH
Sbjct: 1 MASKPGILTDWPWTPLGNFKYVVLAPWAIHAMYSFLVKDEKERDVAHFLIFPFLLWRMLH 60
Query: 61 DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
+Q+WISLSR+RTAK NNRIVDK IEF+QVDRERNWDDQI+FNG+IFY+ +P + S++
Sbjct: 61 NQLWISLSRHRTAKGNNRIVDKGIEFEQVDRERNWDDQIIFNGIIFYVAYFTLPGA-SHM 119
Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
WR+DGV++TIL+H GPVEFLYYW HRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PLWRADGVVVTILLHTGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179
Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
EHI YFLLF+IPL+T + SI SFVGYI Y+DFMNNMGHCNFE +P WLF++FP LK
Sbjct: 180 EHIGYFLLFSIPLLTVIFTGTRSIVSFVGYISYIDFMNNMGHCNFELVPKWLFSIFPFLK 239
Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
+LMYTPS+HSLHHTQFRTNYSLFMP YDY+YGT+D+SSD +YEKSL R EES
Sbjct: 240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYMYGTMDKSSDVLYEKSLTRP----EESP--- 292
Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
DVVHLTHLTTP+SIYH+R+GFAS+ASKP+ +S+WYL+L+WP T+S +L+ WI R
Sbjct: 293 DVVHLTHLTTPDSIYHIRLGFASVASKPY-----ISKWYLRLMWPLTSSYMMLI-WICSR 346
Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
TFV E N +KLKLQTWV+P+Y +QY L W+ E INSLIEEAIL+A+ +GV V+SLGLLN
Sbjct: 347 TFVLERNHFNKLKLQTWVIPKYRIQYFLKWQNEPINSLIEEAILDAEQRGVNVLSLGLLN 406
Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
QGEELN GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T VL RG ++ KVA
Sbjct: 407 QGEELNIYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGKLS--KVAYF 463
Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAH---------KTEQARA 531
A +LCQ GI+VAT +++Y K+ +++ + L LS +YA K EQ +A
Sbjct: 464 TALALCQKGIQVATFHEEEYAKINMKLNTKLGGKLALSKNYAHKIWLVGDGLTKEEQLKA 523
Query: 532 PKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIH 591
PKGT+FIP++Q PP+++RKDCFYH+TPAM+ P S NM SCENWL RR MSAWR+AGI+H
Sbjct: 524 PKGTLFIPFSQFPPKRMRKDCFYHTTPAMMSPTSFENMDSCENWLPRRAMSAWRVAGILH 583
Query: 592 ALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 623
ALEGW+++ECG + DI ++W ASL+HGFRPL
Sbjct: 584 ALEGWNVHECGHAIFDIEKIWEASLQHGFRPL 615
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359489254|ref|XP_002265189.2| PREDICTED: protein WAX2-like [Vitis vinifera] gi|297734711|emb|CBI16762.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734710|emb|CBI16761.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489250|ref|XP_003633900.1| PREDICTED: protein WAX2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356504497|ref|XP_003521032.1| PREDICTED: protein WAX2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356520717|ref|XP_003529007.1| PREDICTED: protein WAX2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359489248|ref|XP_002265685.2| PREDICTED: protein WAX2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734709|emb|CBI16760.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225454042|ref|XP_002262785.1| PREDICTED: protein WAX2 [Vitis vinifera] gi|297744850|emb|CBI38118.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225454040|ref|XP_002262647.1| PREDICTED: protein WAX2 [Vitis vinifera] gi|297744851|emb|CBI38119.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 627 | ||||||
| UNIPROTKB|Q7XDI3 | 621 | Os10g0471100 "CER1 protein, pu | 0.969 | 0.979 | 0.529 | 3.8e-181 | |
| UNIPROTKB|Q109K1 | 595 | LOC_Os10g33250 "CER1 protein, | 0.693 | 0.731 | 0.544 | 1.7e-176 | |
| TAIR|locus:2204813 | 627 | AT1G02190 "AT1G02190" [Arabido | 0.968 | 0.968 | 0.524 | 2.8e-176 | |
| TAIR|locus:2040666 | 613 | AT2G37700 "AT2G37700" [Arabido | 0.961 | 0.983 | 0.522 | 5.6e-171 | |
| TAIR|locus:2174368 | 632 | CER3 "ECERIFERUM 3" [Arabidops | 0.955 | 0.947 | 0.324 | 5.6e-84 | |
| UNIPROTKB|Q6ETL8 | 628 | P0544B02.10 "Os02g0178800 prot | 0.958 | 0.957 | 0.307 | 2.3e-71 |
| UNIPROTKB|Q7XDI3 Os10g0471100 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 1758 (623.9 bits), Expect = 3.8e-181, P = 3.8e-181
Identities = 335/633 (52%), Positives = 428/633 (67%)
Query: 1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
MA+ PG+ TEWPWK LGS+K+V+LAPW H Y E D Y I P LLLRMLH
Sbjct: 1 MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH 60
Query: 61 DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
+Q WI++SR + A+ +IV + IEFDQVDRERNWDDQI+ +G++ Y+ + +P +L
Sbjct: 61 NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGG-QHL 119
Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFXXXXXXXXXXXXXXXXXXXXVVTEPITSVIHPFA 180
WR+DG L L+H GPVEFLYYWF +VTEPITSVIHPFA
Sbjct: 120 PLWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFA 179
Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
E + Y LLF+IPL+ + ASI +F Y+IY+DFMNNMGHCNFE +P WLFT FPPLK
Sbjct: 180 ELVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLK 239
Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGXXXXXSADDV 300
+LMYTPS+HSLHHTQFRTNYSLFMP YDYIY T+D+SSD++YE SLK + + V
Sbjct: 240 YLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNN-----EEEEAV 294
Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
DVVHLTHLTT SIYH+R GFA AS+P+ +S+WY++++WP + S++++W YG
Sbjct: 295 DVVHLTHLTTLHSIYHMRPGFAEFASRPY-----VSRWYMRMMWPLSW-LSMVLTWTYGS 348
Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
+F E N + K+++Q+W +PRY Y L W +EAIN LIE+A+ EAD G KV+SLGLLN
Sbjct: 349 SFTVERNVMKKIRMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLN 408
Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGXXXXXXXXXX 480
Q LN++GE YL + P KL ++VDG+SLAAAVVVNS+P+ T V+L G
Sbjct: 409 QAHTLNKSGEQYLLKYP-KLGARIVDGTSLAAAVVVNSIPQGTDQVILAGNVSKVARAVA 467
Query: 481 XXSSLCQMGIKVATICKDDYEKLKLRIPVEAQHNLVLSTSYAAH---------KTEQARA 531
+LC+ IKV K DY LK IP NL S + A EQ RA
Sbjct: 468 --QALCKKNIKVTMTNKQDYHLLKPEIPETVADNLSFSKTGTAKVWLIGDGLDSAEQFRA 525
Query: 532 PKGTIFIPYTQIPPRKLRKD-CFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGII 590
KGT+FIPY+Q PP+ +RKD C Y +TPAM +P +L N+HSCENWL RRVMSAWRIAGI+
Sbjct: 526 QKGTLFIPYSQFPPKMVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGIL 585
Query: 591 HALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 623
HALEGW+ +ECG + D+ +VW A++ HGF P+
Sbjct: 586 HALEGWNEHECGDKVLDMDKVWSAAIMHGFCPV 618
|
|
| UNIPROTKB|Q109K1 LOC_Os10g33250 "CER1 protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204813 AT1G02190 "AT1G02190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040666 AT2G37700 "AT2G37700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174368 CER3 "ECERIFERUM 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ETL8 P0544B02.10 "Os02g0178800 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00010554001 | SubName- Full=Chromosome undetermined scaffold_268, whole genome shotgun sequence; (618 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 627 | |||
| PLN02869 | 620 | PLN02869, PLN02869, fatty aldehyde decarbonylase | 0.0 | |
| pfam12076 | 164 | pfam12076, Wax2_C, WAX2 C-terminal domain | 1e-75 | |
| pfam04116 | 114 | pfam04116, FA_hydroxylase, Fatty acid hydroxylase | 1e-17 | |
| COG3000 | 271 | COG3000, ERG3, Sterol desaturase [Lipid metabolism | 2e-16 |
| >gnl|CDD|166510 PLN02869, PLN02869, fatty aldehyde decarbonylase | Back alignment and domain information |
|---|
Score = 1018 bits (2633), Expect = 0.0
Identities = 438/633 (69%), Positives = 525/633 (82%), Gaps = 27/633 (4%)
Query: 1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLH 60
MASKPGILT+WPWKPLGS+K+VVLAPW +HSIY F+ + ERD +YFLIFPFLL RMLH
Sbjct: 1 MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLH 60
Query: 61 DQIWISLSRYRTAKRNNRIVDKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNL 120
+Q+WISLSRYRTAK NNRIVDK IEF+QVDRERNWDDQI+FNG++FY+ M++P + S++
Sbjct: 61 NQLWISLSRYRTAKGNNRIVDKGIEFEQVDRERNWDDQILFNGILFYVGYMILPGA-SHM 119
Query: 121 RFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYHSHHHSSVVTEPITSVIHPFA 180
WR+DGV++TIL+HMGPVEFLYYW HRALHHHYLYSRYHSHHHSS+VTEPITSVIHPFA
Sbjct: 120 PLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYHSHHHSSIVTEPITSVIHPFA 179
Query: 181 EHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240
EHI YFLLFAIPL+TT+ ASIA+F GYI Y+DFMNNMGHCNFE IP WLF++FPPLK
Sbjct: 180 EHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK 239
Query: 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDV 300
+LMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGT+D+SSD++YEKSLKR EE
Sbjct: 240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLKR----PEEI---P 292
Query: 301 DVVHLTHLTTPESIYHLRIGFASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGR 360
DVVHLTHLTTP+SIYHLR+GFASLASKP+ +WYL+L+WP T S S++++WIYGR
Sbjct: 293 DVVHLTHLTTPDSIYHLRLGFASLASKPYIS-----KWYLRLMWPVT-SWSMMLTWIYGR 346
Query: 361 TFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIEEAILEADAKGVKVISLGLLN 420
TFV E N +KL LQTWV+P+Y +QY L W+ E+INSLIEEAILEAD +GVKV+SLGLLN
Sbjct: 347 TFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIEEAILEADKRGVKVLSLGLLN 406
Query: 421 QGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480
QGEELNR GE+Y+ R P KLKIKVVDGSSLA AVV+NS+PK T VL RG ++ KVA
Sbjct: 407 QGEELNRYGELYIHRNP-KLKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLS--KVAYF 463
Query: 481 VASSLCQMGIKVATICKDDYEKLKLRIP-VEAQHNLVLSTSYAAH---------KTEQAR 530
+AS+LCQ GI+VAT +D+YEKL ++P E L+LS +Y+ + EQ +
Sbjct: 464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNYSEKIWLVGDGLTEEEQKK 523
Query: 531 APKGTIFIPYTQIPPRKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGII 590
A KGT+FIP++Q PP++LRKDCFYH+TPAM+ P S N+ SCENWL RR MSAWR+AGI+
Sbjct: 524 ASKGTLFIPFSQFPPKRLRKDCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAGIL 583
Query: 591 HALEGWDLNECGQTMCDIHQVWHASLRHGFRPL 623
HALEGW+++ECG TM DI ++W ASL+HGFRPL
Sbjct: 584 HALEGWNVHECGYTMFDIEKIWEASLQHGFRPL 616
|
Length = 620 |
| >gnl|CDD|192933 pfam12076, Wax2_C, WAX2 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217907 pfam04116, FA_hydroxylase, Fatty acid hydroxylase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|225546 COG3000, ERG3, Sterol desaturase [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| PLN02869 | 620 | fatty aldehyde decarbonylase | 100.0 | |
| PF12076 | 164 | Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 | 100.0 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 100.0 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 100.0 | |
| KOG0873 | 283 | consensus C-4 sterol methyl oxidase [Lipid transpo | 100.0 | |
| COG3000 | 271 | ERG3 Sterol desaturase [Lipid metabolism] | 99.94 | |
| KOG0872 | 312 | consensus Sterol C5 desaturase [Lipid transport an | 99.9 | |
| KOG0874 | 287 | consensus Sphingolipid hydroxylase [Lipid transpor | 99.79 | |
| PF04116 | 114 | FA_hydroxylase: Fatty acid hydroxylase superfamily | 99.68 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 99.29 | |
| PLN02434 | 237 | fatty acid hydroxylase | 99.05 | |
| KOG0539 | 240 | consensus Sphingolipid fatty acid hydroxylase [Lip | 97.75 | |
| PLN02601 | 303 | beta-carotene hydroxylase | 97.57 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 97.17 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 97.08 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 96.9 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 96.79 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.68 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 96.39 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.06 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 95.94 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 95.93 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 95.88 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 95.75 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 95.73 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 95.55 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 95.48 | |
| PRK06407 | 301 | ornithine cyclodeaminase; Provisional | 95.4 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 95.37 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 95.21 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 95.19 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 95.18 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 95.15 | |
| PF02423 | 313 | OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst | 95.1 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 95.09 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 95.05 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 95.05 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 94.96 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 94.9 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 94.9 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 94.88 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 94.86 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 94.85 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 94.83 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 94.82 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.79 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.75 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 94.74 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 94.73 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 94.68 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 94.68 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 94.66 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 94.66 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 94.63 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 94.57 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 94.52 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 94.52 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 94.49 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 94.49 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 94.47 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 94.46 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 94.44 | |
| PF10520 | 178 | Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme | 94.38 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 94.38 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 94.35 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 94.33 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 94.32 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 94.31 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 94.3 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 94.3 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 94.27 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.26 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 94.25 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 94.23 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 94.21 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 94.2 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 94.16 | |
| COG2423 | 330 | Predicted ornithine cyclodeaminase, mu-crystallin | 94.15 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 94.15 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.14 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 94.14 | |
| PRK08643 | 256 | acetoin reductase; Validated | 94.13 | |
| PRK07589 | 346 | ornithine cyclodeaminase; Validated | 94.07 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 94.06 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 94.01 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 94.0 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 93.98 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 93.98 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 93.93 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 93.9 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 93.88 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 93.87 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 93.87 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 93.83 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 93.82 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.82 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 93.82 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 93.81 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 93.81 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 93.75 | |
| PRK05717 | 255 | oxidoreductase; Validated | 93.74 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 93.74 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 93.73 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 93.72 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 93.68 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 93.65 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 93.64 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 93.64 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 93.63 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 93.62 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 93.62 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.62 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 93.6 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 93.54 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 93.54 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 93.53 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 93.52 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 93.51 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.51 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 93.51 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 93.48 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 93.46 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 93.44 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 93.4 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.4 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 93.39 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 93.38 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 93.36 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 93.35 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 93.34 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 93.33 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 93.32 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 93.29 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 93.28 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 93.27 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 93.26 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 93.2 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 93.19 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 93.19 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 93.18 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 93.16 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 93.15 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 93.06 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 93.05 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 93.03 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 93.0 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 93.0 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.99 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 92.9 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.89 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 92.87 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.85 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 92.82 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 92.82 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 92.76 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 92.75 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.75 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 92.73 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 92.72 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 92.72 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.66 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 92.64 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 92.6 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 92.57 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 92.57 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 92.56 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 92.56 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 92.54 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 92.53 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 92.47 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 92.39 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.36 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.32 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 92.3 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 92.24 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 92.23 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 92.21 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 92.18 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 92.17 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.12 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 92.09 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 92.08 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 92.0 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.97 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 91.96 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 91.95 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 91.94 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 91.86 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 91.84 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 91.83 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.76 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 91.75 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 91.75 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 91.72 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.66 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 91.61 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.53 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 91.52 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 91.47 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 91.44 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.43 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.39 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.38 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 91.38 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.37 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 91.36 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 91.25 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 91.23 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 91.2 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 91.11 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 91.02 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 90.91 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 90.9 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 90.86 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 90.86 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 90.77 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 90.74 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 90.73 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 90.55 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 90.54 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 90.54 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 90.5 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 90.44 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 90.39 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 90.39 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 90.33 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 90.27 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 90.27 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 90.27 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 90.19 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.08 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 90.07 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 90.06 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 90.06 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 90.05 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 90.05 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 90.02 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.98 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 89.97 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 89.9 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.84 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 89.79 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.78 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.66 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 89.65 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 89.62 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 89.62 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 89.49 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 89.49 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 89.47 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 89.39 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 89.3 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 89.24 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 89.22 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 89.21 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.2 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 89.14 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 89.08 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 89.01 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 88.98 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.92 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 88.81 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 88.69 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.68 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.67 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 88.67 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 88.63 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 88.6 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 88.6 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 88.29 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 88.18 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 88.15 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 88.15 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 88.08 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 88.06 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 87.98 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 87.87 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 87.84 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 87.79 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.59 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 87.53 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 87.52 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 87.43 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 87.39 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 87.38 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.36 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.35 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 87.3 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 87.27 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 87.14 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 86.98 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 86.94 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 86.82 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 86.81 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 86.73 | |
| PLN02775 | 286 | Probable dihydrodipicolinate reductase | 86.59 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 86.52 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.52 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 86.47 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 86.41 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.29 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 86.25 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 86.2 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.15 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.15 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.1 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 85.88 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.87 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 85.8 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 85.77 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 85.74 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.69 | |
| PLN00015 | 308 | protochlorophyllide reductase | 85.66 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 85.65 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 85.63 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.5 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 85.44 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 85.4 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.34 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 85.2 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 85.03 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 85.02 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 85.0 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 84.56 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.56 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 84.46 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.26 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 84.03 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 83.97 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 83.93 | |
| COG3268 | 382 | Uncharacterized conserved protein [Function unknow | 83.85 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 83.79 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 83.79 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 83.71 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 83.61 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 83.6 | |
| KOG2380 | 480 | consensus Prephenate dehydrogenase (NADP+) [Amino | 83.51 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 83.34 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 83.19 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 83.06 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 83.06 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 82.52 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 82.38 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 82.28 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.09 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 82.06 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 81.97 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 81.77 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 81.29 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 81.22 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 81.13 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 81.11 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 81.08 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 81.05 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 81.03 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 80.83 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 80.79 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 80.75 | |
| PLN02494 | 477 | adenosylhomocysteinase | 80.74 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 80.64 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 80.62 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 80.4 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 80.36 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 80.24 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 80.13 |
| >PLN02869 fatty aldehyde decarbonylase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-192 Score=1566.82 Aligned_cols=608 Identities=72% Similarity=1.270 Sum_probs=582.4
Q ss_pred CCCCCCCCCCCCCCCCCCcceEeehHHHhhhhhhhhcCccccccccchhHHHHHHHHHHHHhHHHHHhhchhhHhcCcCC
Q 006894 1 MASKPGILTEWPWKPLGSYKHVVLAPWAMHSIYCFIGSRKSERDYAYFLIFPFLLLRMLHDQIWISLSRYRTAKRNNRIV 80 (627)
Q Consensus 1 ~~~~~~~l~~wpw~~lg~~ky~~~~P~v~~~~~~~~~~~~~~~~~~~~~il~~~~lRyl~~~~wi~~~~~~~~~~k~kIq 80 (627)
||++||+||+|||++||||||++|+|+|+|++|++.++++++.|+.|++|++++++|++++|+|++++|++++++|+||+
T Consensus 1 ma~~pg~lt~wpW~~lG~~Ky~~~~p~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~r~l~~q~W~s~sr~~~~~~~~ri~ 80 (620)
T PLN02869 1 MASKPGILTDWPWKPLGSFKYVVLAPWVIHSIYSFVVKDEKERDLSYFLIFPFLLWRMLHNQLWISLSRYRTAKGNNRIV 80 (620)
T ss_pred CCCCCcccccCcccccCCeeeeeehHHHHHHHHHHHhcccccccccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhceeee
Confidence 99999999999999999999999999999999999988777777789999999999999999999999999999999999
Q ss_pred CCCccccchhhhhccchhhHHHHHHHHHHHhhcCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHhhchhhhhhhcc
Q 006894 81 DKAIEFDQVDRERNWDDQIVFNGLIFYIVRMLIPPSYSNLRFWRSDGVILTILVHMGPVEFLYYWFHRALHHHYLYSRYH 160 (627)
Q Consensus 81 ~~~~~~~qvdrE~~~~n~iil~~li~~l~~~~~p~~~~~lP~W~~~gli~~lll~~l~~Df~~Yw~HRllH~~~ly~r~H 160 (627)
+|+++|+|+|||++||||+|+++++++++++.+| +.+++|.|++.|++..+++|+++.|++|||+||++|++++||++|
T Consensus 81 ~~~i~f~QvDre~~wDd~iil~~l~~~~~~~~~p-~~~~~P~W~~~g~l~~~Llhv~~~Df~fYW~HRllH~~~LYwr~H 159 (620)
T PLN02869 81 DKGIEFEQVDRERNWDDQILFNGILFYVGYMILP-GASHMPLWRTDGVLITILLHMGPVEFLYYWLHRALHHHYLYSRYH 159 (620)
T ss_pred ccCCCceeeccccccchHHHHHHHHHHHHHHhhh-hhhcCcccccchHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHH
Confidence 9999999999999999999999999999999999 789999999999999999999999999999999999999999999
Q ss_pred cCCCcCcCCChhhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHhhcccCceecccccccccCCcc
Q 006894 161 SHHHSSVVTEPITSVIHPFAEHIVYFLLFAIPLVTTMVLKNASIASFVGYIIYVDFMNNMGHCNFEFIPMWLFTVFPPLK 240 (627)
Q Consensus 161 ~~HH~s~~p~~~ta~~~hplE~ll~~~l~~iPll~~~llg~~s~~~~~~y~i~~~~~~~~~Hsg~e~~P~~~~~~lp~L~ 240 (627)
++||++.+|+|+|+..+++.|++.+.+++.+|+++..+++..|+.++++|+++.++.++++|||+|++|+++++.+|+++
T Consensus 160 kvHHss~~~~P~Ts~~HP~~E~L~y~ll~~IPLllli~~g~~hi~t~~~yli~~~f~~~~gHSN~El~P~~~~~~~ppLk 239 (620)
T PLN02869 160 SHHHSSIVTEPITSVIHPFAEHIAYFLLFAIPLLTTIFTGTASIAAFFGYISYIDFMNNMGHCNFELIPKWLFSIFPPLK 239 (620)
T ss_pred hhccCCCCCCchhhhcCcHHHHHHHHHHHHHHHHHHhhcccchHHHHHHHHHHHHHHhcccccCccccccchhccCCcch
Confidence 99999999999998754445778777778899988777777789999999999999999999999999999988889999
Q ss_pred cccCChhhhhhhhcCCCCCcCCCchhhhhhcCCCCCCCchHHHHHhhcCCccccccCCCCceeeecccCCccccccccch
Q 006894 241 FLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTIDRSSDSVYEKSLKRSGEEEEESADDVDVVHLTHLTTPESIYHLRIG 320 (627)
Q Consensus 241 ~li~tp~~H~lHH~~~~~NYG~~f~~WDrLFGT~~~~~~~~~~~~~~r~~~~~~~~~~~p~~v~l~h~~~~~s~~h~~~~ 320 (627)
|+++||++|++||+++++|||++|++||+||||+++++++++|+... +.++ +||||||||+||++|+||+|||
T Consensus 240 yll~TPsfHdlHHs~fd~NYGlfF~~WDrLFGT~d~~s~~l~e~~~~--~~~~-----~pd~V~l~H~t~~~s~~h~~~~ 312 (620)
T PLN02869 240 YLMYTPSYHSLHHTQFRTNYSLFMPIYDYIYGTMDKSSDTLYEKSLK--RPEE-----IPDVVHLTHLTTPDSIYHLRLG 312 (620)
T ss_pred heecCchHHhHHhccCCcCcccchHHHHhccCCCCCCchhHHHHhhc--Cccc-----CCCEEEEeccCCHHHhhccchH
Confidence 99999999999999999999999999999999999999999999987 4344 9999999999999999999999
Q ss_pred hhhhccCCccccccCcchhhcchhhHHHHHHHHHHHHhcceEEEeecccCcceeeEEEEeccCcccccchhhHHHHHHHH
Q 006894 321 FASLASKPHRYTYTLSQWYLQLLWPFTASCSVLVSWIYGRTFVSESNTLDKLKLQTWVVPRYIVQYNLPWRREAINSLIE 400 (627)
Q Consensus 321 ~~~~~s~p~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~w~~pr~~~~y~~~~~~~~in~~Ie 400 (627)
|||+||+||+ ++||||||||+|+++|+++ |+|||||++|+|+|||+++|||+||||||||++|+++|+||++||
T Consensus 313 ~~s~as~p~~-----~~~~l~~~wp~~~~~m~~~-w~~~~~f~~~~~~~~~~~~~tw~vpr~~~qy~~~~~~~~in~~Ie 386 (620)
T PLN02869 313 FASLASKPYI-----SKWYLRLMWPVTSWSMMLT-WIYGRTFVLERNRFNKLNLQTWVIPKYKIQYLLKWQNESINSLIE 386 (620)
T ss_pred HHHhccCCcc-----chhHHHHHHHHHHHHHHHH-HHhCCceEeeeeeccceeeeEEEeccccccccCchhhhhHHHHHH
Confidence 9999999999 9999999999999999999 799999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHcCCcEEEecccccccccccCCceeEecCCCcccceeecCChhHHHHHHhcCCCCCcEEEEeccCCChhhHHH
Q 006894 401 EAILEADAKGVKVISLGLLNQGEELNRNGEIYLERQPNKLKIKVVDGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANA 480 (627)
Q Consensus 401 ~Ai~~A~~~G~kv~~LG~ln~~e~ln~~g~~~~~r~p~~L~irvv~Gnsltaavv~~~ip~~~~~V~l~Gatg~~kig~a 480 (627)
+||++|||+||||+|||+|||+|+|||+|++||+|||+ ||||||||||||||||+|+||++++|||++|||+ |||+|
T Consensus 387 ~ail~ad~~Gvkv~sLg~LNk~~~LN~~G~l~v~k~p~-L~vrvv~G~tLtaAvvln~ip~~~~~vfl~G~~s--K~~ra 463 (620)
T PLN02869 387 EAILEADKRGVKVLSLGLLNQGEELNRYGELYIHRNPK-LKIKVVDGSSLAVAVVLNSIPKGTTQVLFRGNLS--KVAYF 463 (620)
T ss_pred HHHHHHHhcCCEEEechhcchhhhhcCCceEeeecCCC-cceEEEeCCchHHHHHHHhcCCCCceEEEecCcc--HHHHH
Confidence 99999999999999999999999999999999999999 9999999999999999999999999999999996 99999
Q ss_pred HHHHHhccCceEEecchhhhHHHHhhCch-hhcccceeccchhhcc---------HHHhcCCCCcEEeeCcCCCCcCCCC
Q 006894 481 VASSLCQMGIKVATICKDDYEKLKLRIPV-EAQHNLVLSTSYAAHK---------TEQARAPKGTIFIPYTQIPPRKLRK 550 (627)
Q Consensus 481 va~~L~~~~~~v~l~~~~~~~~l~~~~~~-~~~~~lv~~~~~~~a~---------~e~~~a~~G~~~~~~sq~P~~~~R~ 550 (627)
||.+|||||||+++.++|||++||+|+++ ++|++|+++|+|.... +||++|||||+|+||||+|+++.||
T Consensus 464 ia~~lc~r~i~~~t~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~k~w~vg~~~~~~eq~~A~~gt~f~~~~~~p~~~~R~ 543 (620)
T PLN02869 464 IASALCQRGIQVATFREDEYEKLNKKLPNTECGSKLLLSKNYSEKIWLVGDGLTEEEQKKASKGTLFIPFSQFPPKRLRK 543 (620)
T ss_pred HHHHHHhcCCeEeecCHHHHHHHHHhccchhhhhhEEEeeccCceeEEecCCCCHHHHhhCCCCCeecccccCCchhhhc
Confidence 99999999999655899999999999999 8999999999875432 8999999999999999999999999
Q ss_pred CeeEeccCccccCCCccccccccccccchhHHHHHHhHHHhhhcCCCCCccchh-hhhHHHHHHHHHhcCCccCCCC
Q 006894 551 DCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQT-MCDIHQVWHASLRHGFRPLFPV 626 (627)
Q Consensus 551 dc~~~~~p~~~~P~~~~~~~~~e~~~pr~~~~Ac~a~~~~~alEg~~~~e~G~i-v~~i~~i~~aa~kHGF~p~~~~ 626 (627)
||+|+++|||++|+++||++|||||||||+|+||||||||||||||++|||| + |++||++|+||+||||+|+...
T Consensus 544 dC~Y~~~pam~~p~~~~~~~sce~~l~r~v~~a~~~~givh~legw~~he~g-~~v~~id~~W~aal~hgf~p~~~~ 619 (620)
T PLN02869 544 DCFYHTTPAMMSPKSFENVDSCENWLPRRAMSAWRVAGILHALEGWNVHECG-YTMFDIEKIWEASLQHGFRPLLIP 619 (620)
T ss_pred cccccCCccccCChhhcccchhhccccchhhhHhhhcceeeeecCccccccc-cccccHHHHHHHHHHcCCccCCCC
Confidence 9999999999999999999999999999999999999999999999999999 8 9999999999999999998754
|
|
| >PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0873 consensus C-4 sterol methyl oxidase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3000 ERG3 Sterol desaturase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0872 consensus Sterol C5 desaturase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0874 consensus Sphingolipid hydroxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF04116 FA_hydroxylase: Fatty acid hydroxylase superfamily; InterPro: IPR006694 This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PLN02434 fatty acid hydroxylase | Back alignment and domain information |
|---|
| >KOG0539 consensus Sphingolipid fatty acid hydroxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02601 beta-carotene hydroxylase | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06407 ornithine cyclodeaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10520 Kua-UEV1_localn: Kua-ubiquitin conjugating enzyme hybrid localisation domain; InterPro: IPR019547 This entry represents part of the transcript of the fusion of two genes, the UEV1 | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK07589 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02775 Probable dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >COG3268 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 627 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 49.5 bits (117), Expect = 3e-06
Identities = 75/569 (13%), Positives = 162/569 (28%), Gaps = 167/569 (29%)
Query: 151 HHHYLYSRYHSHHHSSVVTEPI----TSVIHPFAEHIVY-FLLFAIPLVTTMVLKNASIA 205
HHH HHH T ++ F + V F + + +L I
Sbjct: 1 HHH--------HHHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEID 52
Query: 206 SFVG---------YI----------IYVDFMNNMGHCNFEFIPMWLFTVF------PPLK 240
+ + + F+ + N++ +L + P +
Sbjct: 53 HIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYK----FLMSPIKTEQRQPSMM 108
Query: 241 FLMYTPSYHSLH----------------HTQFRTN-YSLFMPIYDYIYGTIDRSSDSVYE 283
MY L+ + + R L I G + S +
Sbjct: 109 TRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLG-SGKTWVA 167
Query: 284 KSLKRSGEEEEESADDVDVVHLTHLTTPESI--------YHLRIGFASLASKPHRYTYTL 335
+ S + + + + ++L + +PE++ Y + + S + +
Sbjct: 168 LDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRI 227
Query: 336 SQWYLQLLWPFTASCSVLVSWIYGRTF-----VSESNTLDKLKL--QTWVVPRYIVQYNL 388
+L +L S Y V + + L + + R+
Sbjct: 228 HSIQAELR-------RLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRF------ 274
Query: 389 PWRREAINSLIEEAILEADAKGVKVISLGLLNQGEELNRNGEI---YLERQPNKLKIKVV 445
++ + L A ISL + + + YL+ +P L +V+
Sbjct: 275 ---KQVTDFL--------SAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVL 323
Query: 446 DGSSLAAAVVVNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKL 505
+ +++ S+ A V +K+ + SSL + + +++L +
Sbjct: 324 TTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLE---PAEYRKMFDRLSV 380
Query: 506 -----RIPVEAQHNLVLSTSYAAHKTE---------------QARAPKGTIFIPYTQIPP 545
IP +LS + + + + TI IP +
Sbjct: 381 FPPSAHIPTI-----LLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYL-- 433
Query: 546 RKLRKDCFYHSTPAMIIPPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTM 605
+L+ + +H R ++ + I + +D ++
Sbjct: 434 -ELKVKL-----------ENEYALH-------RSIVDHYNI------PKTFDSDDLIPPY 468
Query: 606 CD----IHQVWH-ASLRHG-----FRPLF 624
D H H ++ H FR +F
Sbjct: 469 LDQYFYSHIGHHLKNIEHPERMTLFRMVF 497
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 96.79 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 96.13 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 95.98 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 95.87 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 95.78 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 95.78 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 95.74 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 95.73 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 95.7 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 95.67 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.66 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 95.58 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 95.56 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 95.56 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.55 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 95.53 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 95.52 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 95.51 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 95.51 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 95.5 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 95.5 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 95.49 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 95.48 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 95.47 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.47 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 95.44 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.42 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.41 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 95.41 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 95.41 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 95.4 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 95.38 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 95.34 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 95.33 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 95.31 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 95.3 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 95.29 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 95.28 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 95.28 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.27 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 95.26 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 95.25 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 95.24 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 95.24 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 95.24 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 95.24 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 95.23 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 95.22 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 95.22 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 95.22 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 95.21 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 95.2 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 95.2 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 95.2 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 95.18 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 95.16 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 95.14 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 95.13 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 95.13 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 95.12 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 95.12 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 95.12 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 95.11 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 95.11 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 95.11 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 95.11 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 95.1 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 95.09 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 95.09 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 95.09 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 95.09 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 95.08 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.08 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 95.06 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 95.06 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 95.05 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 95.05 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 95.05 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 95.05 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 95.04 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 95.04 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 95.04 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 95.03 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 95.03 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 95.03 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 95.02 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 95.02 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 95.02 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 95.0 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 94.99 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 94.99 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 94.98 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 94.98 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 94.96 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 94.96 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 94.95 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 94.91 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.91 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 94.91 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 94.88 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 94.87 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 94.87 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 94.86 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 94.83 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 94.82 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 94.81 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 94.81 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.81 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 94.8 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 94.8 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 94.8 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 94.76 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 94.75 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 94.73 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 94.68 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 94.65 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 94.63 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 94.63 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 94.63 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 94.63 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 94.6 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 94.59 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 94.58 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 94.58 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 94.57 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 94.55 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 94.54 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 94.5 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 94.5 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 94.5 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 94.49 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 94.46 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 94.44 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 94.44 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 94.43 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 94.4 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 94.36 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 94.34 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 94.31 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 94.29 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 94.27 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 94.26 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 94.24 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 94.21 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 94.19 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 94.17 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 94.17 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 94.16 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 94.15 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 94.14 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 94.13 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 94.12 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 94.12 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 94.11 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 94.11 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 94.1 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 94.09 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 94.08 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 94.02 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 94.02 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 94.0 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 93.97 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 93.96 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 93.96 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 93.95 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 93.94 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 93.93 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 93.87 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 93.84 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 93.8 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 93.79 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 93.79 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 93.77 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 93.73 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 93.71 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 93.66 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 93.63 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 93.63 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 93.6 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 93.6 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 93.55 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 93.55 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 93.52 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 93.5 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 93.49 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 93.46 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 93.4 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 93.35 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 93.34 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 93.33 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 93.3 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 93.28 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 93.27 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 93.26 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 93.26 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 93.21 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 93.18 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 93.17 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 93.16 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 93.15 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 93.13 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.08 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 93.07 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 93.04 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 93.03 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 92.98 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 92.95 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 92.92 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 92.91 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 92.86 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 92.82 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 92.78 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 92.76 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 92.72 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 92.69 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 92.68 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 92.65 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 92.64 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 92.63 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.58 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 92.52 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 92.51 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 92.47 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 92.46 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 92.44 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 92.41 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 92.41 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 92.4 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 92.39 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 92.38 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 92.37 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 92.31 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 92.31 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 92.28 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 92.27 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 92.26 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 92.12 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 92.08 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 92.07 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 92.04 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 92.0 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 91.99 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 91.98 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 91.97 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 91.97 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 91.94 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 91.92 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 91.9 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 91.9 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 91.89 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 91.8 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 91.79 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 91.75 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 91.67 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 91.57 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 91.49 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 91.32 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 91.3 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 91.28 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 91.27 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 91.25 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 91.25 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 91.24 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 91.16 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 91.16 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 91.12 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 91.12 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 91.08 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 91.0 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 90.99 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 90.97 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 90.96 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 90.91 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 90.9 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 90.82 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 90.78 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 90.74 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 90.74 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 90.64 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 90.63 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 90.61 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 90.61 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 90.59 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 90.5 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 90.49 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 90.46 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 90.42 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 90.41 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 90.38 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 90.37 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 90.35 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 90.33 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 90.33 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 90.27 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 89.99 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 89.96 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 89.89 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 89.74 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 89.72 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 89.68 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 89.5 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 89.1 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 89.09 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 89.08 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 89.02 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 88.91 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 88.85 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 88.77 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 88.75 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 88.69 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 88.65 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 88.65 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 88.61 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 88.53 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 88.46 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 88.39 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 88.3 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 88.27 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 88.17 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 88.16 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 88.11 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 88.06 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 88.0 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 87.94 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 87.83 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 87.75 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 87.73 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 87.7 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 87.69 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 87.59 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 87.39 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 87.35 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 87.18 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 87.17 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 86.99 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 86.9 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 86.76 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 86.76 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 86.65 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 86.6 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 86.6 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 86.58 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 86.56 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 86.48 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 86.38 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 86.36 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 86.3 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 86.28 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 86.16 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 86.14 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 86.09 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 86.07 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 86.03 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 85.9 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 85.88 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 85.85 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 85.8 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 85.79 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 85.78 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 85.68 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 85.66 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 85.52 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 85.47 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 85.45 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 85.38 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 85.3 | |
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 85.3 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 85.11 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 84.95 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 84.93 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 84.87 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 84.86 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 84.84 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 84.83 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 84.81 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 84.81 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 84.76 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 84.75 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 84.69 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 84.68 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 84.55 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 84.43 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 84.24 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 84.14 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 83.97 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 83.92 | |
| 4f2g_A | 309 | Otcase 1, ornithine carbamoyltransferase 1; struct | 83.91 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 83.89 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 83.88 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 83.81 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 83.53 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 83.5 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 83.19 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 83.01 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 82.78 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 82.78 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 82.56 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 82.53 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 82.47 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 82.34 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 82.26 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 82.16 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 82.03 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 81.38 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 81.3 | |
| 3gd5_A | 323 | Otcase, ornithine carbamoyltransferase; structural | 81.26 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 81.05 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 81.04 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 80.98 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 80.78 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 80.7 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 80.56 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 80.49 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 80.1 |
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
Probab=96.79 E-value=0.0011 Score=60.14 Aligned_cols=80 Identities=21% Similarity=0.270 Sum_probs=53.2
Q ss_pred CCcEEEEeccCCChhhHHHHHHHHhccCceEEe--cchhhhHHHHhhCchh-----------hcccce-eccchhhccHH
Q 006894 462 TTAHVLLRGTVTANKVANAVASSLCQMGIKVAT--ICKDDYEKLKLRIPVE-----------AQHNLV-LSTSYAAHKTE 527 (627)
Q Consensus 462 ~~~~V~l~Gatg~~kig~ava~~L~~~~~~v~l--~~~~~~~~l~~~~~~~-----------~~~~lv-~~~~~~~a~~e 527 (627)
..++|.++|+ | .+|+++++.|+++|.+|++ |++++.+++.++.... .+.++| ..|.......+
T Consensus 20 ~~~~v~iiG~-G--~iG~~~a~~l~~~g~~v~v~~r~~~~~~~~a~~~~~~~~~~~~~~~~~~~~Divi~at~~~~~~~~ 96 (144)
T 3oj0_A 20 GGNKILLVGN-G--MLASEIAPYFSYPQYKVTVAGRNIDHVRAFAEKYEYEYVLINDIDSLIKNNDVIITATSSKTPIVE 96 (144)
T ss_dssp CCCEEEEECC-S--HHHHHHGGGCCTTTCEEEEEESCHHHHHHHHHHHTCEEEECSCHHHHHHTCSEEEECSCCSSCSBC
T ss_pred cCCEEEEECC-C--HHHHHHHHHHHhCCCEEEEEcCCHHHHHHHHHHhCCceEeecCHHHHhcCCCEEEEeCCCCCcEee
Confidence 4779999997 7 9999999999999999777 8889888887664311 112222 22222222233
Q ss_pred HhcCCCCcEEeeCcCCCC
Q 006894 528 QARAPKGTIFIPYTQIPP 545 (627)
Q Consensus 528 ~~~a~~G~~~~~~sq~P~ 545 (627)
.+.+++|.+++|.+ .|+
T Consensus 97 ~~~l~~g~~vid~~-~p~ 113 (144)
T 3oj0_A 97 ERSLMPGKLFIDLG-NPP 113 (144)
T ss_dssp GGGCCTTCEEEECC-SSC
T ss_pred HHHcCCCCEEEEcc-CCc
Confidence 46667777777777 553
|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.93 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 96.76 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.71 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.6 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 96.41 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 96.34 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 96.32 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 96.29 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 96.24 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 96.18 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 96.15 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 96.12 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.11 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 96.1 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 96.09 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 96.07 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.07 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 96.07 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 96.05 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 96.01 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 95.98 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 95.96 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 95.93 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 95.92 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 95.86 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 95.86 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 95.86 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 95.83 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 95.83 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 95.82 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 95.79 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 95.77 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 95.76 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 95.75 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 95.75 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 95.69 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 95.48 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 95.48 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 95.46 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 95.4 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 95.39 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 95.33 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 95.26 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 95.24 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 95.15 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 95.14 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 95.13 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 94.98 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 94.91 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 94.88 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.8 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 94.8 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 94.77 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 94.7 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 94.61 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 94.43 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 94.38 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 94.26 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 94.21 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 94.07 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 94.03 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 93.86 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 93.83 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 93.68 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 93.68 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 93.65 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 93.57 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 93.51 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 93.41 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 93.36 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 93.06 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 93.05 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 92.97 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 92.82 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 92.74 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 92.73 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 92.37 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 92.24 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 92.22 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 92.2 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 92.1 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 91.95 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 91.88 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 91.84 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 91.77 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 91.7 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 91.7 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 91.54 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 91.51 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 91.45 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 91.37 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 91.3 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 91.14 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 91.06 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 90.86 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 90.82 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 90.74 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 90.66 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 90.35 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 90.21 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 90.13 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 90.09 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 89.71 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 89.37 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 89.22 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 89.17 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 88.87 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 88.68 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 88.57 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 88.5 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 88.39 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 88.21 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 88.18 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 87.81 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 87.54 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 87.48 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 86.71 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 86.3 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 86.04 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 86.0 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 85.93 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 85.81 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 85.78 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 85.75 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 85.58 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 85.08 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 85.06 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 84.74 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 83.9 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 83.83 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 83.75 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 83.64 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 83.62 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 83.47 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 83.22 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 83.1 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 82.84 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 81.69 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 81.47 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 81.41 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 81.38 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 81.32 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 81.26 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 81.08 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 80.95 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 80.33 |
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Aminoacid dehydrogenase-like, C-terminal domain domain: Methylene-tetrahydromethanopterin dehydrogenase species: Methylobacterium extorquens [TaxId: 408]
Probab=96.93 E-value=0.00032 Score=65.09 Aligned_cols=51 Identities=14% Similarity=0.027 Sum_probs=45.3
Q ss_pred CCcEEEEeccCCChhhHHHHHHHHhccCceEEe--cchhhhHHHHhhCchhhccc
Q 006894 462 TTAHVLLRGTVTANKVANAVASSLCQMGIKVAT--ICKDDYEKLKLRIPVEAQHN 514 (627)
Q Consensus 462 ~~~~V~l~Gatg~~kig~ava~~L~~~~~~v~l--~~~~~~~~l~~~~~~~~~~~ 514 (627)
..+.|+++|++| -||+++|+.|.++|.+|.+ |++++.+++.+++....+..
T Consensus 22 ~gK~vlItGasg--GIG~~ia~~la~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~ 74 (191)
T d1luaa1 22 KGKKAVVLAGTG--PVGMRSAALLAGEGAEVVLCGRKLDKAQAAADSVNKRFKVN 74 (191)
T ss_dssp TTCEEEEETTTS--HHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHHHHHTCC
T ss_pred CCCEEEEECCCH--HHHHHHHHHHHhhccchhhcccchHHHHHHHHHHHhccchh
Confidence 478999999998 9999999999999999999 99999999998877755433
|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|