Citrus Sinensis ID: 007057

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620
MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSRSKTSNWFH
ccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccHHHHHHHHcHHcccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccEEEEccEEEEEEcccccccccccEEEEEcccccEEEEccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccccccEEEEcccccccccccEEcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccc
ccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHHHcccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEcHHHHHcccccEEEEccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccccccEEEEEccccccEccHcccccccccccccccccccccccccccEEEccccccEEcccEEEccccEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccccEEEEHHEEEEcccHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHccccEEEEEEEccccEEEEEEEEccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEHHHHHHHHHcHHHHccccccccc
MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQsqpldlstIEDIAGILNSavsgqllspseiCAVRRTLRAVNNVWKKLTEAAeldgdslqrYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQaggidkplitKRRSRMCVGIkashkyllpdgialnvsssgatyfmepkgavefnnmevrlsnseiAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFaqwmdgvcpilssqshvsfdssiniegikhplllgsslrslsaassnsnplksdvensemtvgslskgisdfpvpidikvecETRVVvitgpntggktaSMKTLGLASLMSkaglylpaknhprlpwfdLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDeigsgtdpsegVALATSILQYLRDRVGLAVVTTHYadlsclkdkdtrFENAATEFSLETLRPTYRilwgstgdsnaLNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLlplwsrsktsnwfh
mghavvqkaqipfgksLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTeaaeldgdsLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFqaggidkplitkrRSRMCVGIKAshkyllpdgIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSnsnplksdvensEMTVGSLSKGISDFPVPIDIKVECETRVVvitgpntggktasMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEigsgtdpsegVALATSILQYLRDRVGLAVVTTHYadlsclkdkdtRFENaatefsletlrptyRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVerlrperqqhrkselYQSLMEERRKLESQARTAASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLlplwsrsktsnwfh
MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHplllgsslrslsaassnsnplksDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSRSKTSNWFH
***************************************DLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLL*********************************GISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKL***********************************SLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSR********
MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLEL**************************GGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGS************************************PVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLV*************************************************************************************
MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLR************************SLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEE**********AASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSRSKTSNWFH
*GHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSL*********************MTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSR********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGHAVVQKAQIPFGKSxxxxxxxxxxxxxxxxxxxxxPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIIxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSExxxxxxxxxxxxxxxxxxxxxxxxxxxxVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELxxxxxxxxxxxxxxxxxxxxxHAEIMDLYREVYTFCIIISHAKRAFCFTVAIFLKLLPLWSRSKTSNWFH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query620 2.2.26 [Sep-21-2011]
P73625 822 MutS2 protein OS=Synechoc N/A no 0.830 0.626 0.347 9e-80
B8D298 791 MutS2 protein OS=Halother yes no 0.754 0.591 0.369 1e-73
A5D0W6 785 MutS2 protein OS=Pelotoma yes no 0.735 0.580 0.352 1e-71
A6TNX0 789 MutS2 protein OS=Alkaliph yes no 0.759 0.596 0.341 2e-69
A0PZP4 785 MutS2 protein OS=Clostrid yes no 0.825 0.652 0.347 2e-68
A3DE67 793 MutS2 protein OS=Clostrid yes no 0.820 0.641 0.333 4e-68
Q67QE3 793 MutS2 protein OS=Symbioba yes no 0.809 0.633 0.328 7e-68
C5D5Q8 784 MutS2 protein OS=Geobacil yes no 0.740 0.585 0.343 1e-67
A9KR74 796 MutS2 protein OS=Clostrid yes no 0.798 0.621 0.340 3e-67
Q8EPI1 782 MutS2 protein OS=Oceanoba yes no 0.748 0.593 0.336 3e-67
>sp|P73625|MUTS2_SYNY3 MutS2 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutSB PE=3 SV=1 Back     alignment and function desciption
 Score =  298 bits (763), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 204/587 (34%), Positives = 306/587 (52%), Gaps = 72/587 (12%)

Query: 18  EESQKLLNQTSAALAMMQSQPLD--LSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAV 75
           EES++LL QT A  ++  S   +     I DI   L     G L++  E+ A+  TL  V
Sbjct: 49  EESRELLAQTQAVESIENSPESNWHFKGIADITEPLARVERGGLVTGLELLAIAGTLAGV 108

Query: 76  NNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCI--DCKLLIILDRASE 133
             + + + E  +L+         L  L+     L ELE+ I  C+  D K   + +RAS 
Sbjct: 109 RRLRRVIEERDDLEI--------LQTLVAEVRTLPELEQAIHHCLGEDGK---VAERASP 157

Query: 134 DLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDG 193
            L  IR + K   E +   L+K+  +  Q+  + + +IT+R  R  + IKA +K  +P G
Sbjct: 158 KLGEIRQKLKAVREQIQQKLQKIIQR--QSNALQEAVITQRGDRFVLPIKAGYKEQMP-G 214

Query: 194 IALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMD 253
           I  + S+SG T ++EP+  VE  N   +    E  EE  IL  L+ ++ +   ++++L+ 
Sbjct: 215 IVHDSSASGNTLYVEPQAIVELGNKLRQARRQEQTEEERILRQLSDQVLEVLLDLEHLLA 274

Query: 254 RVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASS 313
               +DLA AR  ++ W+    P   +      +  I +  ++HPLL   + +    A  
Sbjct: 275 IATRLDLATARVRYSFWLGAHPPQWLTPGD---EKPITLRQLRHPLLHWQAEKEGGPAV- 330

Query: 314 NSNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGL 373
                                      VPI + ++ + RV+ ITGPNTGGKT ++KTLGL
Sbjct: 331 ---------------------------VPITLTIDSQIRVIAITGPNTGGKTVTLKTLGL 363

Query: 374 ASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSR-- 431
            +LM+K GLY+PAK    +PWF  ILADIGD QSL+QNLSTFSGHI RI+ IL+ +    
Sbjct: 364 VALMAKVGLYIPAKETVEMPWFAQILADIGDEQSLQQNLSTFSGHICRIIRILQALPSGV 423

Query: 432 ----------------ESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYAD 475
                            SLVL+DE+G+GTDP+EG ALA ++L++L D+  L V TTHY +
Sbjct: 424 QDVLDPEIDSPNHPIFPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPCLTVATTHYGE 483

Query: 476 LSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLV 535
           L  LK +D RFENA+ EF  ++L PTYR+LWG  G SNAL IA+ +G    I+++A+  +
Sbjct: 484 LKALKYQDARFENASVEFDDQSLSPTYRLLWGIPGRSNALAIAQRLGLPLAIVEQAKDKL 543

Query: 536 ERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREV 582
                +  Q     +   L  +RR+ E +A  A  L  E    Y++V
Sbjct: 544 GGFSEDINQ-----VIAGLESQRREQEQKAANAQKLLQETEIFYQQV 585

Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
>sp|B8D298|MUTS2_HALOH MutS2 protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|A5D0W6|MUTS2_PELTS MutS2 protein OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|A6TNX0|MUTS2_ALKMQ MutS2 protein OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|A0PZP4|MUTS2_CLONN MutS2 protein OS=Clostridium novyi (strain NT) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|A3DE67|MUTS2_CLOTH MutS2 protein OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|Q67QE3|MUTS2_SYMTH MutS2 protein OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|C5D5Q8|MUTS2_GEOSW MutS2 protein OS=Geobacillus sp. (strain WCH70) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|A9KR74|MUTS2_CLOPH MutS2 protein OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS2 PE=3 SV=1 Back     alignment and function description
>sp|Q8EPI1|MUTS2_OCEIH MutS2 protein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutS2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
224079239 908 predicted protein [Populus trichocarpa] 0.930 0.635 0.686 0.0
255556027 873 DNA mismatch repair protein muts2, putat 0.882 0.626 0.662 0.0
358346679 913 MutS2 family protein [Medicago truncatul 0.932 0.633 0.643 0.0
356521351 902 PREDICTED: mutS2 protein-like isoform 2 0.933 0.641 0.638 0.0
356521349 914 PREDICTED: mutS2 protein-like isoform 1 0.933 0.633 0.638 0.0
449457723 890 PREDICTED: mutS2 protein-like [Cucumis s 0.898 0.625 0.621 0.0
334183641 876 DNA mismatch repair protein MutS2 [Arabi 0.891 0.631 0.593 0.0
15217840 857 DNA mismatch repair protein MutS2 [Arabi 0.891 0.645 0.593 0.0
297840849 891 predicted protein [Arabidopsis lyrata su 0.888 0.618 0.582 0.0
32487407 921 OSJNBb0017I01.21 [Oryza sativa Japonica 0.911 0.613 0.542 1e-176
>gi|224079239|ref|XP_002305805.1| predicted protein [Populus trichocarpa] gi|222848769|gb|EEE86316.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/591 (68%), Positives = 489/591 (82%), Gaps = 14/591 (2%)

Query: 1   MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLL 60
           MG ++ + A+IP GKS EESQKLL+QT+AALA+M+S PLD S IEDI  IL+SAVSG LL
Sbjct: 72  MGQSITRNAKIPIGKSKEESQKLLDQTAAALAVMESGPLDFSGIEDITRILDSAVSGTLL 131

Query: 61  SPSEICAVRRTLRAVNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCI 120
           +  E+CAVRRTLRA   V ++L ++    GD  +RY+PLLE+L+NC+F  ELE+K+GFCI
Sbjct: 132 TVGELCAVRRTLRAARAVLERLKDS----GDCSERYAPLLEILQNCSFQIELEKKVGFCI 187

Query: 121 DCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCV 180
           DC L  ILDRASEDLE+IR+ERKRNMENLD LLK ++A+IFQAGGIDKPL+TKRRSR+CV
Sbjct: 188 DCNLSKILDRASEDLEIIRSERKRNMENLDRLLKGISARIFQAGGIDKPLVTKRRSRLCV 247

Query: 181 GIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAE 240
           G++ASH+YL+PDG+ LNVSSSG TYFMEP  AVE NN+EV LS+SE AEE AILSLLT+E
Sbjct: 248 GVRASHRYLIPDGVVLNVSSSGVTYFMEPGEAVELNNLEVMLSDSEKAEEIAILSLLTSE 307

Query: 241 IAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHV-------SFDSSINIE 293
           IA+S R+IKY++D ++E+DL+FARA +A WM+GV PI +S+           +  SI+IE
Sbjct: 308 IAESARDIKYMLDGIIEVDLSFARAAYAYWMNGVRPIWTSEGCGGISSSGGDYLLSIDIE 367

Query: 294 GIKHPLLLGSSLRSLSA--ASSNSNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECET 351
           GI+HPLL G+S + LS    S++ N ++ D E+S +  G  SK +S+FPVPI+IKVEC T
Sbjct: 368 GIRHPLLNGTSRKRLSNILGSNSLNSMEVD-EDSMLDTGKPSKNVSEFPVPINIKVECGT 426

Query: 352 RVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQN 411
           RVVVI+GPNTGGKTASMKTLG+ASLMSKAGLYLPAKN P+LPWFD +LADIGDHQSLEQN
Sbjct: 427 RVVVISGPNTGGKTASMKTLGVASLMSKAGLYLPAKNTPKLPWFDFVLADIGDHQSLEQN 486

Query: 412 LSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTT 471
           LSTFSGHISRI  ILE+ S ESLVL+DEI SGTDPSEGVAL+TSIL YLRD V LAVVTT
Sbjct: 487 LSTFSGHISRICKILEVASNESLVLVDEICSGTDPSEGVALSTSILHYLRDHVNLAVVTT 546

Query: 472 HYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRA 531
           HYADLS LKDKD+RFENAA EFSLETL+PTY+ILWG TGDSNAL+IAKSIGFD  II+RA
Sbjct: 547 HYADLSLLKDKDSRFENAAMEFSLETLQPTYQILWGCTGDSNALSIAKSIGFDSNIIERA 606

Query: 532 QKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLYREV 582
           +K VE+L PE+QQ R   LYQSL+EER +LE+QAR  ASLH EIM+LY E+
Sbjct: 607 RKWVEKLVPEKQQERSGMLYQSLLEERNRLEAQARKGASLHTEIMELYHEI 657

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255556027|ref|XP_002519048.1| DNA mismatch repair protein muts2, putative [Ricinus communis] gi|223541711|gb|EEF43259.1| DNA mismatch repair protein muts2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358346679|ref|XP_003637393.1| MutS2 family protein [Medicago truncatula] gi|355503328|gb|AES84531.1| MutS2 family protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356521351|ref|XP_003529320.1| PREDICTED: mutS2 protein-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356521349|ref|XP_003529319.1| PREDICTED: mutS2 protein-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|449457723|ref|XP_004146597.1| PREDICTED: mutS2 protein-like [Cucumis sativus] gi|449531305|ref|XP_004172627.1| PREDICTED: mutS2 protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|334183641|ref|NP_001185315.1| DNA mismatch repair protein MutS2 [Arabidopsis thaliana] gi|6227005|gb|AAF06041.1|AC009360_6 Contains similarity to gb|D90908 DNA mismatch repair protein MutS2 from Synechocystis sp. and is a member of PF|00488 Muts family of mismatch repair proteins [Arabidopsis thaliana] gi|332196205|gb|AEE34326.1| DNA mismatch repair protein MutS2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15217840|ref|NP_176687.1| DNA mismatch repair protein MutS2 [Arabidopsis thaliana] gi|332196204|gb|AEE34325.1| DNA mismatch repair protein MutS2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297840849|ref|XP_002888306.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334147|gb|EFH64565.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|32487407|emb|CAE05741.1| OSJNBb0017I01.21 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query620
UNIPROTKB|Q3ABU1 777 mutS2 "MutS2 protein" [Carboxy 0.391 0.312 0.405 2.2e-61
TIGR_CMR|CHY_1564 777 CHY_1564 "DNA mismatch repair 0.391 0.312 0.405 2.2e-61
TIGR_CMR|BA_4794 786 BA_4794 "MutS2 family protein" 0.382 0.301 0.409 3.6e-61
UNIPROTKB|Q720J7 785 mutS2 "MutS2 protein" [Listeri 0.380 0.300 0.421 5.2e-59
UNIPROTKB|Q81YJ6633 BAS3289 "Putative MutS family 0.412 0.404 0.329 1.7e-55
TIGR_CMR|BA_3547633 BA_3547 "MutS family protein, 0.412 0.404 0.329 1.7e-55
UNIPROTKB|Q76DY7 744 mutS2 "MutS2 protein" [Thermus 0.335 0.279 0.451 5.4e-55
TIGR_CMR|GSU_0547 792 GSU_0547 "MutS2 family protein 0.351 0.275 0.412 2e-49
UNIPROTKB|A8HMH7 1204 CHLREDRAFT_146712 "Predicted p 0.275 0.142 0.491 9.4e-48
UNIPROTKB|O66652859 mutS "DNA mismatch repair prot 0.382 0.275 0.273 7.9e-22
UNIPROTKB|Q3ABU1 mutS2 "MutS2 protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
 Score = 464 (168.4 bits), Expect = 2.2e-61, Sum P(2) = 2.2e-61
 Identities = 105/259 (40%), Positives = 155/259 (59%)

Query:   341 VPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILA 400
             VP D+ +  E  +++ITGPNTGGKT ++KT+G+ ++M++AGL++PA     +  F  +  
Sbjct:   311 VPFDLTLGKEFDLLIITGPNTGGKTVTLKTIGILTIMARAGLFIPASPETEIGLFGEVYV 370

Query:   401 DIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYL 460
             DIGD QS+ Q+LSTFS H+  +  ILE      LVL+DE+G+GTDP EG ALA +IL+ L
Sbjct:   371 DIGDEQSIVQSLSTFSSHLLNLKFILENAREGDLVLLDELGTGTDPREGAALAKAILEEL 430

Query:   461 RDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKS 520
             R +    V TTH ++L+    +  R ENA+ EF  E+L+PTYR+  G  G SNAL IA+ 
Sbjct:   431 RGKKVKVVATTHTSELAAYAIETERVENASVEFDPESLKPTYRLHIGKPGRSNALYIAQG 490

Query:   521 IGFDRKIIQRAQ-----------KLVERLRPERQQHRKSE-----LYQSLMEERRKLESQ 564
             +G   +II++A+           KL+  +  E++Q  K++     L  SL E+  KL  +
Sbjct:   491 LGLKEQIIEKAKSFLKEEELKLDKLIFDVEQEKRQLEKAKEEVANLLISLKEKEAKLNDE 550

Query:   565 ARTAASLHAEIMDLYREVY 583
                      EI+  YRE Y
Sbjct:   551 LENLEKTKEEIIRKYREKY 569
GO:0003824 "catalytic activity" evidence=ISS
GO:0006281 "DNA repair" evidence=ISS
TIGR_CMR|CHY_1564 CHY_1564 "DNA mismatch repair protein MutS" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4794 BA_4794 "MutS2 family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q720J7 mutS2 "MutS2 protein" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|Q81YJ6 BAS3289 "Putative MutS family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3547 BA_3547 "MutS family protein, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q76DY7 mutS2 "MutS2 protein" [Thermus thermophilus (taxid:274)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0547 GSU_0547 "MutS2 family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|A8HMH7 CHLREDRAFT_146712 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|O66652 mutS "DNA mismatch repair protein MutS" [Aquifex aeolicus VF5 (taxid:224324)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.3160.1
hypothetical protein (865 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_X6520
hypothetical protein (888 aa)
• •   • 0.516
gw1.XIX.1944.1
annotation not avaliable (727 aa)
  •   • 0.413

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 1e-139
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 1e-106
COG1193 753 COG1193, COG1193, Mismatch repair ATPase (MutS fam 5e-95
cd03280200 cd03280, ABC_MutS2, ATP-binding cassette domain of 5e-94
smart00534185 smart00534, MUTSac, ATPase domain of DNA mismatch 8e-59
cd03243202 cd03243, ABC_MutS_homologs, ATP-binding cassette d 2e-47
COG0249843 COG0249, MutS, Mismatch repair ATPase (MutS family 5e-44
cd03284216 cd03284, ABC_MutS1, ATP-binding cassette domain of 8e-31
pfam00488235 pfam00488, MutS_V, MutS domain V 7e-30
TIGR01070840 TIGR01070, mutS1, DNA mismatch repair protein MutS 7e-28
cd03287222 cd03287, ABC_MSH3_euk, ATP-binding cassette domain 3e-26
cd03285222 cd03285, ABC_MSH2_euk, ATP-binding cassette domain 8e-26
cd03282204 cd03282, ABC_MSH4_euk, ATP-binding cassette domain 8e-25
cd03286218 cd03286, ABC_MSH6_euk, ATP-binding cassette domain 1e-24
cd03281213 cd03281, ABC_MSH5_euk, ATP-binding cassette domain 2e-22
cd03283199 cd03283, ABC_MutS-like, ATP-binding cassette domai 5e-18
PRK05399854 PRK05399, PRK05399, DNA mismatch repair protein Mu 3e-14
pfam05192290 pfam05192, MutS_III, MutS domain III 3e-13
smart00533308 smart00533, MUTSd, DNA-binding domain of DNA misma 2e-12
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 9e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 7e-08
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information 
 Score =  423 bits (1091), Expect = e-139
 Identities = 212/572 (37%), Positives = 299/572 (52%), Gaps = 62/572 (10%)

Query: 16  SLEESQKLLNQTSAALAMMQSQP-LDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRA 74
             EE ++LL +T  A  +++ +       ++DI   L  A  G +LS  E+  + +TLR 
Sbjct: 39  DFEEVEELLEETDEAAKLLRLKGLPPFEGVKDIDDALKRAEKGGVLSGDELLEIAKTLRY 98

Query: 75  VNNVWKKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASED 134
              + K+  E  E + +       L E +     L ELE++I  CID +  +  D ASE 
Sbjct: 99  FRQL-KRFIEDLEEEEE----LPILEEWVAKIRTLPELEQEIHNCIDEEGEV-KDSASEK 152

Query: 135 LELIRAERKRNMENLDSLLKKVAAQIFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGI 194
           L  IR + +R    +   L+ +         +   +IT R  R  + +KA +K+ +  GI
Sbjct: 153 LRGIRRQLRRKKSRIREKLESIIRSKSLQKYLQDTIITIRNDRYVLPVKAEYKHAIK-GI 211

Query: 195 ALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTAEIAKSEREIKYLMDR 254
             + SSSGAT ++EP+  VE NN    L N E  E   IL  L+A++AK+   +K+L   
Sbjct: 212 VHDQSSSGATLYIEPQSVVELNNEIRELRNKEEQEIERILKELSAKVAKNLDFLKFLNKI 271

Query: 255 VLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSN 314
             E+D  FARA +A+ +    P+ + +        I++   +HPLL G  +         
Sbjct: 272 FDELDFIFARARYAKALKATFPLFNDEGK------IDLRQARHPLLDGEKV--------- 316

Query: 315 SNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLA 374
                                     VP DI +  +  V+VITGPNTGGKT ++KTLGLA
Sbjct: 317 --------------------------VPKDISLGFDKTVLVITGPNTGGKTVTLKTLGLA 350

Query: 375 SLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESL 434
           +LM+K+GL +PA     +P F  I ADIGD QS+EQ+LSTFSGH++ IV ILE   + SL
Sbjct: 351 ALMAKSGLPIPANEPSEIPVFKEIFADIGDEQSIEQSLSTFSGHMTNIVRILEKADKNSL 410

Query: 435 VLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEFS 494
           VL DE+G+GTDP EG ALA SIL+YLR R    + TTHY +L  L       ENA+ EF 
Sbjct: 411 VLFDELGAGTDPDEGAALAISILEYLRKRGAKIIATTHYKELKALMYNREGVENASVEFD 470

Query: 495 LETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLV----ERLRPERQQHRKSEL 550
            ETLRPTYR+L G  G SNA  IAK +G    II+ A+KL+    E+L         +EL
Sbjct: 471 EETLRPTYRLLIGIPGKSNAFEIAKRLGLPENIIEEAKKLIGEDKEKL---------NEL 521

Query: 551 YQSLMEERRKLESQARTAASLHAEIMDLYREV 582
             SL E  R+LE +A  A +L  E   L  E+
Sbjct: 522 IASLEELERELEQKAEEAEALLKEAEKLKEEL 553

Length = 782
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 Back     alignment and domain information
>gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs Back     alignment and domain information
>gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog Back     alignment and domain information
>gnl|CDD|215944 pfam00488, MutS_V, MutS domain V Back     alignment and domain information
>gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS Back     alignment and domain information
>gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog Back     alignment and domain information
>gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog Back     alignment and domain information
>gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog Back     alignment and domain information
>gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog Back     alignment and domain information
>gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog Back     alignment and domain information
>gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog Back     alignment and domain information
>gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>gnl|CDD|218489 pfam05192, MutS_III, MutS domain III Back     alignment and domain information
>gnl|CDD|214710 smart00533, MUTSd, DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 620
PRK00409 782 recombination and DNA strand exchange inhibitor pr 100.0
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 100.0
TIGR01070840 mutS1 DNA mismatch repair protein MutS. 100.0
PRK05399854 DNA mismatch repair protein MutS; Provisional 100.0
COG1193 753 Mismatch repair ATPase (MutS family) [DNA replicat 100.0
COG0249843 MutS Mismatch repair ATPase (MutS family) [DNA rep 100.0
KOG02181070 consensus Mismatch repair MSH3 [Replication, recom 100.0
KOG0219902 consensus Mismatch repair ATPase MSH2 (MutS family 100.0
KOG0221849 consensus Mismatch repair ATPase MSH5 (MutS family 100.0
KOG02171125 consensus Mismatch repair ATPase MSH6 (MutS family 100.0
KOG0220867 consensus Mismatch repair ATPase MSH4 (MutS family 100.0
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 100.0
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 100.0
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 100.0
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 100.0
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 100.0
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 100.0
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 100.0
smart00533308 MUTSd DNA-binding domain of DNA mismatch repair MU 100.0
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 100.0
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 100.0
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.97
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.97
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.97
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
COG1127263 Ttg2A ABC-type transport system involved in resist 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.97
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.96
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.96
COG4152300 ABC-type uncharacterized transport system, ATPase 99.96
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.96
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.96
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.95
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.95
PRK13537306 nodulation ABC transporter NodI; Provisional 99.95
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.95
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.95
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.95
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.95
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.95
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.95
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.95
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.95
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.95
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.95
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.95
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.95
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.95
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.95
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.95
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.95
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.95
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.94
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.94
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.94
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.94
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.94
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.94
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.94
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.94
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.94
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.94
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.94
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.94
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.94
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.94
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.94
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.94
COG0411250 LivG ABC-type branched-chain amino acid transport 99.94
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.94
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.94
PRK10908222 cell division protein FtsE; Provisional 99.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.94
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.94
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.94
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.94
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.94
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.94
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.94
COG0488 530 Uup ATPase components of ABC transporters with dup 99.94
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.94
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.94
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.94
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.94
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.94
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.94
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.94
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.94
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.94
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.94
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.94
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.94
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.94
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.94
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.94
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.94
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.94
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.94
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.94
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.94
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.94
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.94
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.94
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.94
COG0488530 Uup ATPase components of ABC transporters with dup 99.94
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.94
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.94
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.93
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.93
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.93
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.93
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.93
PRK09984262 phosphonate/organophosphate ester transporter subu 99.93
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.93
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.93
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.93
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.93
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.93
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.93
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.93
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.93
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK10938 490 putative molybdenum transport ATP-binding protein 99.93
COG0410237 LivF ABC-type branched-chain amino acid transport 99.93
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.93
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.93
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.93
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.93
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.93
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.93
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.93
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.93
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.93
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.93
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.93
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.93
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.93
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.93
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.93
cd03246173 ABCC_Protease_Secretion This family represents the 99.93
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.93
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.93
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.93
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.93
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.93
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.93
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.93
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.93
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.93
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.93
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.93
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.93
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.93
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.93
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.93
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.93
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.93
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.93
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.93
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.93
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.92
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.92
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.92
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.92
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.92
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.92
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.92
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.92
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.92
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.92
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.92
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.92
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.92
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.92
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.92
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.92
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.92
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.92
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.92
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.92
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.92
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.92
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.92
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.92
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.92
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.92
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.92
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.92
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.92
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.92
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.92
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.92
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.92
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.92
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.92
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.92
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.92
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.92
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.92
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.92
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.92
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.92
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.92
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.92
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.92
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.92
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.92
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.92
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.92
PRK11147 635 ABC transporter ATPase component; Reviewed 99.92
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.92
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.92
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.91
PRK10938490 putative molybdenum transport ATP-binding protein 99.91
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.91
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.91
COG4586325 ABC-type uncharacterized transport system, ATPase 99.91
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.91
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.91
COG4559259 ABC-type hemin transport system, ATPase component 99.91
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.91
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.91
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.91
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.91
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.91
cd03234226 ABCG_White The White subfamily represents ABC tran 99.91
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.91
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.91
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.91
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.91
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.91
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.91
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.91
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.91
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.91
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.91
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.91
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.91
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.91
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.91
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.91
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.91
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.91
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.91
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.91
PRK13409590 putative ATPase RIL; Provisional 99.91
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.91
PLN03073718 ABC transporter F family; Provisional 99.9
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.9
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.9
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.9
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.9
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.9
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.9
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.9
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.9
COG4181228 Predicted ABC-type transport system involved in ly 99.9
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.9
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.9
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.9
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.9
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.9
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.9
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.9
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.9
PLN03073 718 ABC transporter F family; Provisional 99.89
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.89
COG1123 539 ATPase components of various ABC-type transport sy 99.89
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.89
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.89
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.89
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.89
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.89
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.89
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.89
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.89
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.88
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.88
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.88
COG1123539 ATPase components of various ABC-type transport sy 99.88
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.88
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.88
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.88
PRK13409 590 putative ATPase RIL; Provisional 99.88
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.88
COG4987573 CydC ABC-type transport system involved in cytochr 99.88
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.88
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.88
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.87
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.87
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.87
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.87
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.87
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.87
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.87
PLN03211 659 ABC transporter G-25; Provisional 99.87
COG4619223 ABC-type uncharacterized transport system, ATPase 99.87
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.87
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.87
KOG0062 582 consensus ATPase component of ABC transporters wit 99.87
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.87
COG4988559 CydD ABC-type transport system involved in cytochr 99.87
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.87
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.87
COG4133209 CcmA ABC-type transport system involved in cytochr 99.87
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.86
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.86
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.86
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.86
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.86
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.86
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.86
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.86
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.86
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.85
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.85
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.85
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.85
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.84
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.83
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.83
COG4136213 ABC-type uncharacterized transport system, ATPase 99.83
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.83
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.82
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.82
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.82
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.81
PLN03140 1470 ABC transporter G family member; Provisional 99.81
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.81
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.81
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.81
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.81
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.81
PLN032321495 ABC transporter C family member; Provisional 99.81
COG4172 534 ABC-type uncharacterized transport system, duplica 99.8
PLN031301622 ABC transporter C family member; Provisional 99.8
COG4172534 ABC-type uncharacterized transport system, duplica 99.8
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.8
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.8
PLN03130 1622 ABC transporter C family member; Provisional 99.8
PLN03232 1495 ABC transporter C family member; Provisional 99.8
PTZ002431560 ABC transporter; Provisional 99.79
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.79
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.79
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.79
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.78
PTZ00243 1560 ABC transporter; Provisional 99.77
KOG0062582 consensus ATPase component of ABC transporters wit 99.76
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.76
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.76
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.76
PLN03140 1470 ABC transporter G family member; Provisional 99.75
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.75
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.74
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.74
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.73
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.73
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.72
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.72
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.71
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.71
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.7
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.7
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.67
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.66
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.65
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 99.65
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.62
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.62
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.62
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.61
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.6
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.6
COG4178604 ABC-type uncharacterized transport system, permeas 99.59
KOG00541381 consensus Multidrug resistance-associated protein/ 99.59
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.55
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.53
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.51
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.5
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.5
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.46
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.45
PF05192204 MutS_III: MutS domain III C-terminus.; InterPro: I 99.42
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.38
PRK006351809 excinuclease ABC subunit A; Provisional 99.38
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.37
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.21
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.2
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.18
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.17
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.14
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.14
COG3910233 Predicted ATPase [General function prediction only 99.09
PRK13695174 putative NTPase; Provisional 99.07
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.99
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.88
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.87
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.83
TIGR00634563 recN DNA repair protein RecN. All proteins in this 98.76
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.72
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 98.71
PRK10869553 recombination and repair protein; Provisional 98.68
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.67
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.67
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.66
PRK06067234 flagellar accessory protein FlaH; Validated 98.57
PRK03918880 chromosome segregation protein; Provisional 98.56
PHA02562562 46 endonuclease subunit; Provisional 98.55
PRK01156895 chromosome segregation protein; Provisional 98.49
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.48
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.44
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.43
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.42
smart00382148 AAA ATPases associated with a variety of cellular 98.41
PRK102461047 exonuclease subunit SbcC; Provisional 98.4
cd01128249 rho_factor Transcription termination factor rho is 98.37
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.33
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.28
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.2
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.08
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 98.07
PRK02224880 chromosome segregation protein; Provisional 98.03
PF0519092 MutS_IV: MutS family domain IV C-terminus.; InterP 98.02
PRK13830818 conjugal transfer protein TrbE; Provisional 98.01
COG4637373 Predicted ATPase [General function prediction only 97.98
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.95
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 97.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.95
PRK09183259 transposase/IS protein; Provisional 97.95
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.91
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.91
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.9
PRK00064361 recF recombination protein F; Reviewed 97.89
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.88
TIGR00767415 rho transcription termination factor Rho. Members 97.88
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.87
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 97.81
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.81
PF1355562 AAA_29: P-loop containing region of AAA domain 97.73
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 97.71
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.7
PRK04296190 thymidine kinase; Provisional 97.69
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 97.67
TIGR00611365 recf recF protein. All proteins in this family for 97.65
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.65
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.64
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.63
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathw 97.57
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.57
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.56
PRK06526254 transposase; Provisional 97.56
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.56
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.53
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.52
PRK09862506 putative ATP-dependent protease; Provisional 97.52
PRK06893229 DNA replication initiation factor; Validated 97.51
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.5
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=3.5e-83  Score=739.49  Aligned_cols=537  Identities=39%  Similarity=0.559  Sum_probs=483.5

Q ss_pred             CchHhHhccCCCCCCCHHHHHHHHHHHHHHHHHHh-cCCCCCCCCcCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHH
Q 007057            1 MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQ-SQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVW   79 (620)
Q Consensus         1 ~G~~~~~~~~l~~~~~~~~i~~~l~~t~e~~~~l~-~~~~~l~~i~Di~~~l~r~~~g~~l~~~el~~i~~~l~~~~~l~   79 (620)
                      ||++++++  +.|..++++|+++|++|+++..++. .+.+||.+++|+++++.++..|.+++|.||++|+++|..+..++
T Consensus        26 ~Gk~~l~~--l~P~~~~~~i~~~l~~~~e~~~~~~~~~~~~l~~~~Di~~~l~r~~~g~~l~~~eL~~i~~~l~~~~~l~  103 (782)
T PRK00409         26 LGKEKVLQ--LDPETDFEEVEELLEETDEAAKLLRLKGLPPFEGVKDIDDALKRAEKGGVLSGDELLEIAKTLRYFRQLK  103 (782)
T ss_pred             HHHHHHHc--CCCCCCHHHHHHHHHHHHHHHHHHHhcCCCCCCCCccHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            69999999  9999999999999999999998886 78899999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhccCCcccccchHHHHHhcCCChHHHHHHHhhhhccCCCcccCCcCHHHHHHHHHHHHhHHHHHHHHHHHHHH
Q 007057           80 KKLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCKLLIILDRASEDLELIRAERKRNMENLDSLLKKVAAQ  159 (620)
Q Consensus        80 ~~l~~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~I~~~id~~~~~I~d~as~~L~~iR~~~~~~~~~l~~~l~~~~~~  159 (620)
                      +++.....     ...++.|..++..+.+++++.+.|.+|||+++ .|+|+||++|+.||+.+++.++++++.+.+....
T Consensus       104 ~~l~~~~~-----~~~~~~L~~~~~~l~~~~~l~~~i~~~id~~g-~i~d~aS~eL~~iR~~~~~~~~~i~~~l~~~~~~  177 (782)
T PRK00409        104 RFIEDLEE-----EEELPILEEWVAKIRTLPELEQEIHNCIDEEG-EVKDSASEKLRGIRRQLRRKKSRIREKLESIIRS  177 (782)
T ss_pred             HHHHhccc-----ccchhHHHHHHHcCcCcHHHHHHHHHHhCCCC-EECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99975200     01256788899999999999999999999885 8999999999999999998888888887775443


Q ss_pred             HHHhcCCCCcccccccCceEEEEecccccCCCCcEEEEEecCCcEEEeccchhhhhhhHHHHHhHHHHHHHHHHHHHHHH
Q 007057          160 IFQAGGIDKPLITKRRSRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETAILSLLTA  239 (620)
Q Consensus       160 ~~~~~~~~~~~i~~r~~r~~i~vk~~~~~~~~~g~~~~~s~~g~~~~~ep~~~~~l~n~~~~l~~~e~~ee~~il~~L~~  239 (620)
                      ......+++.++++|++||||||++++++.+| |++|+.|++|+|+|++|..++++||++.++..++.+++.+|+++|+.
T Consensus       178 ~~~~~~L~d~~it~r~~r~~i~vk~~~~~~~~-g~v~~~s~sg~t~y~ep~~~~~ln~~l~~l~~~~~~~~~~il~~l~~  256 (782)
T PRK00409        178 KSLQKYLQDTIITIRNDRYVLPVKAEYKHAIK-GIVHDQSSSGATLYIEPQSVVELNNEIRELRNKEEQEIERILKELSA  256 (782)
T ss_pred             cccccccccceEEEECCEEEEEechhhhccCC-CceeeEECCCCEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            22234577889999999999999999999998 99999999999999999999999999999999999999999999999


Q ss_pred             HHHhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccceecCCCCCCCcceEEEcccccCccccchhhhcccccCCCCCCc
Q 007057          240 EIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLK  319 (620)
Q Consensus       240 ~i~~~~~~l~~~~~~~~~lD~~~a~a~~a~~~~~~~P~~~~~~~~~~~~~i~i~~~rHPll~~~~~~~~~~~~~~~~~~~  319 (620)
                      .|..+.+.|..+++.+++||+++|+|.||.+++||+|.|++++      .+.++++|||+|..      .          
T Consensus       257 ~i~~~~~~l~~~~~~l~~lD~l~a~a~~a~~~~~~~P~~~~~~------~i~l~~~rHPll~~------~----------  314 (782)
T PRK00409        257 KVAKNLDFLKFLNKIFDELDFIFARARYAKALKATFPLFNDEG------KIDLRQARHPLLDG------E----------  314 (782)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCccceEcCCC------cEEEcCcCCceecc------C----------
Confidence            9999999999999999999999999999999999999998653      69999999999832      0          


Q ss_pred             CCCCCCeEEEeeeeeecCCccccccceecCCceEEEEEcCCCCcHhHHHHHHhhhHHHHhhCccccCCCCCCccHHHHHH
Q 007057          320 SDVENSEMTVGSLSKGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLIL  399 (620)
Q Consensus       320 ~~~g~~~l~~~~l~~~y~~~~v~vsl~i~~g~~~~~I~GpNGsGKSTlLk~iGli~~~a~~G~~vp~~~~~~l~~~d~i~  399 (620)
                                         .+||+|+.+..+.++++|||||||||||+||++|++++|+|+|+|||+...+.+++|++++
T Consensus       315 -------------------~~Vpndi~l~~~~~~~iITGpN~gGKTt~lktigl~~~maq~G~~vpa~~~~~i~~~~~i~  375 (782)
T PRK00409        315 -------------------KVVPKDISLGFDKTVLVITGPNTGGKTVTLKTLGLAALMAKSGLPIPANEPSEIPVFKEIF  375 (782)
T ss_pred             -------------------ceECceeEECCCceEEEEECCCCCCcHHHHHHHHHHHHHHHhCCCcccCCCccccccceEE
Confidence                               2679999998766899999999999999999999999999999999998657899999999


Q ss_pred             HHcCCchhhccccccchHHHHHHHHHHHhcCCCcEEEEcCCCCCCCHHHHHHHHHHHHHHHhcCCcEEEEEccChhHHhh
Q 007057          400 ADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCL  479 (620)
Q Consensus       400 ~~ig~~~~~~~~~s~lSgg~krl~~i~~l~~~~~LlLLDEpt~glD~~~~~~l~~all~~l~~~~~~vli~TH~~~l~~~  479 (620)
                      +++|+.+++.+.+|+||+||+++..++..+++|+|+||||||+||||.++.+++.++++++.+.++++|++||+.++..+
T Consensus       376 ~~ig~~~si~~~lStfS~~m~~~~~Il~~~~~~sLvLlDE~~~GtDp~eg~ala~aile~l~~~~~~vIitTH~~el~~~  455 (782)
T PRK00409        376 ADIGDEQSIEQSLSTFSGHMTNIVRILEKADKNSLVLFDELGAGTDPDEGAALAISILEYLRKRGAKIIATTHYKELKAL  455 (782)
T ss_pred             EecCCccchhhchhHHHHHHHHHHHHHHhCCcCcEEEecCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECChHHHHHH
Confidence            99999999999999999999998888777799999999999999999999999999999998888999999999999888


Q ss_pred             ccccceeeCceEEEecCccccchhhccCCCCCchHHHHHHHcCCCHHHHHHHHHHHHHhcchHHHhHHHHHHHHHHHHHH
Q 007057          480 KDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERR  559 (620)
Q Consensus       480 ~~~~~~~~~g~~~~~~~~l~~~y~l~~g~~~~s~a~~ia~~~g~~~~v~~~a~~~~~~~~~~~~~~~~e~~~~~le~~~~  559 (620)
                      +.....+.++++.|+.+++.|+|++..|.++.|+|+.+|+++|+|++++++|++.+..     +..+++.++++|++++.
T Consensus       456 ~~~~~~v~~~~~~~d~~~l~~~Ykl~~G~~g~S~a~~iA~~~Glp~~ii~~A~~~~~~-----~~~~~~~li~~l~~~~~  530 (782)
T PRK00409        456 MYNREGVENASVEFDEETLRPTYRLLIGIPGKSNAFEIAKRLGLPENIIEEAKKLIGE-----DKEKLNELIASLEELER  530 (782)
T ss_pred             HhcCCCeEEEEEEEecCcCcEEEEEeeCCCCCcHHHHHHHHhCcCHHHHHHHHHHHhh-----hhhHHHHHHHHHHHHHH
Confidence            7777788899999999999999999999999999999999999999999999998863     34577888888888888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007057          560 KLESQARTAASLHAEIMDLYREVYTFCIIISHA  592 (620)
Q Consensus       560 ~le~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  592 (620)
                      +++++.++++....++++++++++++.+++++-
T Consensus       531 ~~e~~~~~~~~~~~e~~~~~~~l~~~~~~l~~~  563 (782)
T PRK00409        531 ELEQKAEEAEALLKEAEKLKEELEEKKEKLQEE  563 (782)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            888887777777777777777776666655443

>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0218 consensus Mismatch repair MSH3 [Replication, recombination and repair] Back     alignment and domain information
>KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>KOG0221 consensus Mismatch repair ATPase MSH5 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>KOG0217 consensus Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>KOG0220 consensus Mismatch repair ATPase MSH4 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF05192 MutS_III: MutS domain III C-terminus Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05190 MutS_IV: MutS family domain IV C-terminus Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>COG4637 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
1nne_A765 Crystal Structure Of The Muts-adpbef3-dna Complex L 3e-21
1ewq_A765 Crystal Structure Taq Muts Complexed With A Heterod 3e-19
1fw6_A768 Crystal Structure Of A Taq Muts-Dna-Adp Ternary Com 3e-19
1ewr_A649 Crystal Structure Of Taq Muts Length = 649 3e-19
1ng9_A800 E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt 2e-18
3thw_B918 Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo 2e-18
1wb9_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 3e-18
1wbb_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 3e-18
1wbd_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 3e-18
1oh5_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 3e-18
2o8b_B1022 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 6e-18
2o8b_A934 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 9e-18
2o8e_A934 Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, 1e-17
3k0s_A799 Crystal Structure Of E.Coli Dna Mismatch Repair Pro 1e-17
1e3m_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 3e-16
>pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 105/196 (53%), Gaps = 3/196 (1%)
Query: 341 VPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILA 400
           VP D+++  E  +V+ITGPN  GK+  ++   L +L+++ G ++PA+    LP FD I  
Sbjct: 568 VPNDLEMAHE--LVLITGPNMAGKSTFLRQTALIALLAQVGSFVPAEEA-HLPLFDGIYT 624
Query: 401 DIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYL 460
            IG    L    STF   +  +  IL+  +  SLVL+DE+G GT   +GVA+AT++ + L
Sbjct: 625 RIGASDDLAGGKSTFMVEMEEVALILKEATENSLVLLDEVGRGTSSLDGVAIATAVAEAL 684
Query: 461 RDRVGLAVVTTHYADLSCLKDKDTRFENAATEFSLETLRPTYRILWGSTGDSNALNIAKS 520
            +R    +  THY +L+ L     +  + A       L   +++L G    S  + +A  
Sbjct: 685 HERRAYTLFATHYFELTALGLPRLKNLHVAAREEAGGLVFYHQVLPGPASKSYGVEVAAM 744
Query: 521 IGFDRKIIQRAQKLVE 536
            G  ++++ RA+ L++
Sbjct: 745 AGLPKEVVARARALLQ 760
>pdb|1EWQ|A Chain A, Crystal Structure Taq Muts Complexed With A Heteroduplex Dna At 2.2 A Resolution Length = 765 Back     alignment and structure
>pdb|1FW6|A Chain A, Crystal Structure Of A Taq Muts-Dna-Adp Ternary Complex Length = 768 Back     alignment and structure
>pdb|1EWR|A Chain A, Crystal Structure Of Taq Muts Length = 649 Back     alignment and structure
>pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 Back     alignment and structure
>pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 Back     alignment and structure
>pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 Back     alignment and structure
>pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 Back     alignment and structure
>pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 Back     alignment and structure
>pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 Back     alignment and structure
>pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 Back     alignment and structure
>pdb|1E3M|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A G:t Mismatch Length = 800 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query620
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 2e-21
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 4e-17
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 2e-16
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 4e-14
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-05
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 Back     alignment and structure
 Score = 98.2 bits (245), Expect = 2e-21
 Identities = 77/363 (21%), Positives = 152/363 (41%), Gaps = 46/363 (12%)

Query: 227 IAEETAILSLLTAEIAKSEREIKYLMDRVLEID--LAFARAGFAQWMDGVCPILSSQSHV 284
              + AI+  +    +     ++ L D + ++D  ++FA       +  V P +      
Sbjct: 571 EEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAI----LE 626

Query: 285 SFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLKSDVENSEMTVGSLSKGISDFPVPID 344
                I ++  +H  +                         E+           F +P D
Sbjct: 627 KGQGRIILKASRHACV-------------------------EVQDEI------AF-IPND 654

Query: 345 IKVECET-RVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIG 403
           +  E +     +ITGPN GGK+  ++  G+  LM++ G ++P +    +   D ILA +G
Sbjct: 655 VYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCE-SAEVSIVDCILARVG 713

Query: 404 DHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRDR 463
              S  + +STF   +     IL   +++SL++IDE+G GT   +G  LA +I +Y+  +
Sbjct: 714 AGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATK 773

Query: 464 VG-LAVVTTHYADLSCLKDKDTRFEN---AATEFSLETLRPTYRILWGSTGDSNALNIAK 519
           +G   +  TH+ +L+ L ++     N    A     ETL   Y++  G    S  +++A+
Sbjct: 774 IGAFCMFATHFHELTALANQIPTVNNLHVTALTTE-ETLTMLYQVKKGVCDQSFGIHVAE 832

Query: 520 SIGFDRKIIQRAQKLVERLRPERQQHRKSELYQSLMEERRKLESQARTAASLHAEIMDLY 579
              F + +I+ A++    L  E Q   +S+ Y  +    +K   +      +  E +   
Sbjct: 833 LANFPKHVIECAKQKALELE-EFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKV 891

Query: 580 REV 582
           +++
Sbjct: 892 KQM 894
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 100.0
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 100.0
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 100.0
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 100.0
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.97
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.97
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.96
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.96
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.96
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.96
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.96
1g6h_A257 High-affinity branched-chain amino acid transport 99.96
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.96
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.96
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.96
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.96
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.96
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.96
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.96
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.95
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.95
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.95
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.95
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.95
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.95
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.95
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.95
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.95
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.95
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.95
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.95
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.95
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.95
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.95
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.95
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.94
2ghi_A260 Transport protein; multidrug resistance protein, M 99.94
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.94
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.94
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.93
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.92
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.92
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.91
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.91
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.91
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.91
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.91
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.91
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.91
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.91
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.9
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.9
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.9
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.9
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.9
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.88
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.88
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.86
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.85
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.84
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.83
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.82
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.82
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.81
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.8
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.8
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.79
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.78
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.78
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.77
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.74
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.68
1e69_A322 Chromosome segregation SMC protein; structural mai 99.68
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.66
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.66
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.56
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.55
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.52
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.51
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.51
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.48
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.47
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.43
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.42
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.42
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.41
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.41
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.4
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.39
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.38
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.38
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.36
2og2_A359 Putative signal recognition particle receptor; nuc 99.35
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.34
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.26
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.25
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.23
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.22
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.21
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.21
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.21
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.2
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.19
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.17
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.16
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.15
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.09
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.07
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.04
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.03
3kta_B173 Chromosome segregation protein SMC; structural mai 99.01
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.99
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.98
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 98.98
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.97
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.96
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.83
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.82
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.82
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.8
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 98.78
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 98.76
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.75
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.74
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.68
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.67
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.66
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.56
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.52
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.52
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.49
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.41
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.39
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.39
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.38
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.37
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.32
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.3
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 98.26
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.19
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.13
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.11
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.11
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.1
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.03
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.03
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.01
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 97.95
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.92
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.91
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 97.81
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.79
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.77
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.73
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.72
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.71
1p9r_A418 General secretion pathway protein E; bacterial typ 97.7
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.69
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.69
3kta_A182 Chromosome segregation protein SMC; structural mai 97.69
2z43_A324 DNA repair and recombination protein RADA; archaea 97.68
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.66
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.64
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.63
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.62
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.61
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.6
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.59
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.54
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.54
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.54
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.53
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.53
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 97.49
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.48
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.41
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.4
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.39
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.35
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.33
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.33
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.32
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.3
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.28
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 97.28
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.26
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.26
3bos_A242 Putative DNA replication factor; P-loop containing 97.25
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.24
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.24
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.2
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.18
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.15
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.13
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.13
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.1
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.1
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.09
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.09
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.08
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.07
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.07
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.07
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.05
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.03
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.03
2qgz_A308 Helicase loader, putative primosome component; str 97.02
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.97
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.97
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.95
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.95
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.95
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.92
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.9
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.88
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.87
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.84
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.84
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.74
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.71
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.7
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.68
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.68
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.67
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.66
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.64
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.62
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.58
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.57
3io5_A333 Recombination and repair protein; storage dimer, i 96.57
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.56
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.56
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.52
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.51
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.48
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 96.44
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.42
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.41
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.41
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.39
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.38
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.38
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.37
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 96.31
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.31
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.22
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.19
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.18
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.18
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.18
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.17
3ice_A422 Transcription termination factor RHO; transcriptio 96.08
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.08
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.06
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.9
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.9
3co5_A143 Putative two-component system transcriptional RES 95.84
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.83
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.83
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.79
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 95.75
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.73
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.73
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.71
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.7
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.68
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.61
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.61
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.59
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.59
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 95.58
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.56
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.55
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.54
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.36
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 95.35
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.33
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.31
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.31
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.28
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.27
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.26
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.26
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.22
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.21
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.17
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.15
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.12
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.1
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 95.08
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 95.03
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.02
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.98
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.96
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.92
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.91
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.89
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.89
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.86
1via_A175 Shikimate kinase; structural genomics, transferase 94.85
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.79
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.76
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.74
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.67
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.65
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.6
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.59
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.58
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.48
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 94.47
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 94.46
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.46
3pvs_A 447 Replication-associated recombination protein A; ma 94.45
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.44
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.41
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.39
3r20_A233 Cytidylate kinase; structural genomics, seattle st 94.37
1ojl_A304 Transcriptional regulatory protein ZRAR; response 94.36
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.36
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.33
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 94.33
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.31
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.31
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 94.28
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.19
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.18
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 94.17
2vli_A183 Antibiotic resistance protein; transferase, tunica 94.05
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.02
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.96
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 93.93
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.92
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.76
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.59
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.58
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.57
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.55
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 93.52
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 93.49
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 93.47
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.46
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 93.42
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.4
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.4
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.37
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.29
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.25
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 93.1
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.06
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 93.04
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 93.03
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 93.03
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 92.92
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 92.92
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 92.88
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.85
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.78
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 92.71
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.7
2ged_A193 SR-beta, signal recognition particle receptor beta 92.69
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.59
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.56
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.54
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.54
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.49
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 92.47
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 92.45
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.42
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 92.39
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 92.38
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.34
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.29
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.25
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 92.23
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 92.18
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.17
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.17
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.13
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 92.1
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.07
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.07
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 92.03
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 91.98
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 91.98
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.97
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 91.91
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.91
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 91.9
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 91.86
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 91.85
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 91.8
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 91.79
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.74
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 91.73
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 91.73
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 91.63
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 91.6
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 91.58
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 91.52
3t1o_A198 Gliding protein MGLA; G domain containing protein, 91.48
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.47
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.38
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 91.3
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 91.28
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 91.26
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.19
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 91.19
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.15
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 91.14
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.07
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 91.03
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 90.99
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.98
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 90.97
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.95
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 90.94
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 90.94
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 90.92
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 90.88
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.88
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 90.85
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 90.83
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 90.76
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 90.62
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 90.59
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 90.58
1nrj_B218 SR-beta, signal recognition particle receptor beta 90.58
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.56
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.55
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 90.54
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 90.54
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 90.48
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 90.48
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.47
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 90.42
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 90.41
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.4
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 90.34
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 90.33
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 90.31
3llu_A196 RAS-related GTP-binding protein C; structural geno 90.31
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.26
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 90.22
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 90.21
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 90.19
2gno_A305 DNA polymerase III, gamma subunit-related protein; 90.17
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.13
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 90.09
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 89.95
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 89.93
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.92
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 89.91
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 89.88
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 89.86
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 89.8
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.7
3lxw_A247 GTPase IMAP family member 1; immunity, structural 89.68
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 89.68
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 89.62
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 89.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 89.58
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 89.48
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 89.39
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 89.38
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 89.36
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 89.32
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.32
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 89.31
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 89.29
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 89.26
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 89.24
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.19
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.16
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 89.15
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 89.13
2hf9_A226 Probable hydrogenase nickel incorporation protein 89.11
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.1
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 89.06
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 89.05
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.0
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 88.96
2xxa_A433 Signal recognition particle protein; protein trans 88.96
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 88.94
3iby_A256 Ferrous iron transport protein B; G protein, G dom 88.91
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 88.89
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.89
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 88.82
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 88.82
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.79
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 88.75
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 88.68
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 88.66
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 88.61
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 88.6
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 88.55
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 88.53
2fh5_B214 SR-beta, signal recognition particle receptor beta 88.52
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 88.5
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-69  Score=629.94  Aligned_cols=482  Identities=21%  Similarity=0.291  Sum_probs=415.0

Q ss_pred             CchHhHhccCCCCCCCHHHHHHHHHHHHHHHHHHhcCCCCCCCCcCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHH
Q 007057            1 MGHAVVQKAQIPFGKSLEESQKLLNQTSAALAMMQSQPLDLSTIEDIAGILNSAVSGQLLSPSEICAVRRTLRAVNNVWK   80 (620)
Q Consensus         1 ~G~~~~~~~~l~~~~~~~~i~~~l~~t~e~~~~l~~~~~~l~~i~Di~~~l~r~~~g~~l~~~el~~i~~~l~~~~~l~~   80 (620)
                      ||+|++++|++.|+.|.++|++|++.|+++..+......+|++++|++|++.|+..|. ++|+||..++++|..++.+++
T Consensus       302 ~G~RlL~~wl~~Pl~d~~~I~~R~~~v~~~~~~~~~l~~~L~~~~Dler~l~r~~~~~-~~~~dl~~l~~~l~~~~~l~~  380 (800)
T 1wb9_A          302 MGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAGLQPVLRQVGDLERILARLALRT-ARPRDLARMRHAFQQLPELRA  380 (800)
T ss_dssp             HHHHHHHHHHHSCBCCHHHHHHHHHHHHHTGGGHHHHHHHHHTTCSHHHHHHHHHHTC-CCHHHHHHHHHHHTTHHHHHH
T ss_pred             HHHHHHHHHhhCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCccHHHHHHHHHcCC-CCHHHHHHHHHHHHHHHHHHH
Confidence            7999999999999999999999999999987722345668999999999999999985 699999999999999999999


Q ss_pred             HHHHhhhccCCcccccchHHHHHhcCCChHHHHHHHhhhhccC-------CCcccCCcCHHHHHHHHHHHHhHHHHHHHH
Q 007057           81 KLTEAAELDGDSLQRYSPLLELLKNCNFLTELEEKIGFCIDCK-------LLIILDRASEDLELIRAERKRNMENLDSLL  153 (620)
Q Consensus        81 ~l~~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~I~~~id~~-------~~~I~d~as~~L~~iR~~~~~~~~~l~~~l  153 (620)
                      ++...         ..+.|..+...+..++++.+.|.++|+++       ++.|+|++|++|+.+|+.+++.++++.+++
T Consensus       381 ~l~~~---------~~~~L~~l~~~l~~~~~l~~~i~~~i~~~~~~~~~~~~~I~~g~~~eLd~lr~~~~~~~~~l~~~~  451 (800)
T 1wb9_A          381 QLETV---------DSAPVQALREKMGEFAELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLE  451 (800)
T ss_dssp             HHHSC---------CCHHHHHHHHHHCCCHHHHHHHHHHBCSSCCSCSTTCCCBCTTSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhc---------CcHHHHHHHHhcccHHHHHHHHHHHhCcCchhhhhcCCeeCCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            88642         13456677777888999999999999976       368999999999999999998888888876


Q ss_pred             HHHHHHHHHhcCCCCccccccc-CceEEEEecccccCCCCcEEEEEecCCcEEEeccchhhhhhhHHHHHhHHHHHHHHH
Q 007057          154 KKVAAQIFQAGGIDKPLITKRR-SRMCVGIKASHKYLLPDGIALNVSSSGATYFMEPKGAVEFNNMEVRLSNSEIAEETA  232 (620)
Q Consensus       154 ~~~~~~~~~~~~~~~~~i~~r~-~r~~i~vk~~~~~~~~~g~~~~~s~~g~~~~~ep~~~~~l~n~~~~l~~~e~~ee~~  232 (620)
                      ++.    ....++....+.+.+ .+|||+|+.+++..+|++|++.+|.+|+++|++|. +.++++++.++..++..+|.+
T Consensus       452 ~~~----~~~~~~~~l~i~~~~~~gy~i~V~~~~~~~vp~~~i~~~s~~~~~~f~tp~-l~~l~~~i~~~~~~~~~~e~~  526 (800)
T 1wb9_A          452 VRE----RERTGLDTLKVGFNAVHGYYIQISRGQSHLAPINYMRRQTLKNAERYIIPE-LKEYEDKVLTSKGKALALEKQ  526 (800)
T ss_dssp             HHH----HHHHTCTTCEEEEETTTEEEEEEEHHHHTTSCTTCEEEEECSSEEEEECHH-HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHH----HHHhCCCceEEEecCcceEEEEEeccccccCCcceEEeeeccCCCEEeCHH-HHHHHHHHHHHHHHHHHHHHH
Confidence            553    233455544444433 36999999999999999999999999999999998 899999999999999999999


Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccceecCCCCCCCcceEEEcccccCccccchhhhccccc
Q 007057          233 ILSLLTAEIAKSEREIKYLMDRVLEIDLAFARAGFAQWMDGVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAAS  312 (620)
Q Consensus       233 il~~L~~~i~~~~~~l~~~~~~~~~lD~~~a~a~~a~~~~~~~P~~~~~~~~~~~~~i~i~~~rHPll~~~~~~~~~~~~  312 (620)
                      |+.+|+..+..+...+..+.+.+++||+++|+|.+|.+++||+|.+++++      .|.|++||||+++. ...      
T Consensus       527 i~~~l~~~~~~~~~~l~~~~~~la~lD~l~s~A~~a~~~~~~~P~~~~~~------~i~i~~~rHP~le~-~~~------  593 (800)
T 1wb9_A          527 LYEELFDLLLPHLEALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKP------GIRITEGRHPVVEQ-VLN------  593 (800)
T ss_dssp             HHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHHTTCBCCEECSSS------CEEEEEECCTTHHH-HCS------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccEECCCC------CEEEEeccccEEEc-cCC------
Confidence            99999999999999999999999999999999999999999999998753      69999999999832 110      


Q ss_pred             CCCCCCcCCCCCCeEEEeeeeeecCCccc--cccceecCCceEEEEEcCCCCcHhHHHHHHhhhHHHHhhCccccCCCCC
Q 007057          313 SNSNPLKSDVENSEMTVGSLSKGISDFPV--PIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHP  390 (620)
Q Consensus       313 ~~~~~~~~~~g~~~l~~~~l~~~y~~~~v--~vsl~i~~g~~~~~I~GpNGsGKSTlLk~iGli~~~a~~G~~vp~~~~~  390 (620)
                                               +.++  ++++. ++| ++++|+||||||||||||+++.+.++++.|.++|+.. .
T Consensus       594 -------------------------~~~vlndisl~-~~g-~i~~ItGpNGsGKSTlLr~iagl~~~~q~G~~vpa~~-~  645 (800)
T 1wb9_A          594 -------------------------EPFIANPLNLS-PQR-RMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQK-V  645 (800)
T ss_dssp             -------------------------SCCCCEEEEEC-SSS-CEEEEECCTTSSHHHHHHHHHHHHHHHTTTCCBSSSE-E
T ss_pred             -------------------------Cceeeeccccc-CCC-cEEEEECCCCCChHHHHHHHHHHHHHHhcCcccchhc-c
Confidence                                     1245  55555 567 9999999999999999999988889999999999875 6


Q ss_pred             CccHHHHHHHHcCCchhhccccccchHHHHHHHHHHHhcCCCcEEEEcCCCCCCCHHHHHHHHHHHHHHHhc-CCcEEEE
Q 007057          391 RLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALATSILQYLRD-RVGLAVV  469 (620)
Q Consensus       391 ~l~~~d~i~~~ig~~~~~~~~~s~lSgg~krl~~i~~l~~~~~LlLLDEpt~glD~~~~~~l~~all~~l~~-~~~~vli  469 (620)
                      .++++++++.+++..+++..+.|+||+||+++..++..+++|+|+||||||+|||+.++.+++.++++++.+ .|+++|+
T Consensus       646 ~i~~~~~i~~~~~~~d~l~~~~stf~~e~~~~~~il~~a~~psLlLLDEp~~Gtd~~d~~~i~~~ll~~l~~~~g~~vl~  725 (800)
T 1wb9_A          646 EIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLF  725 (800)
T ss_dssp             EECCCCEEEEEEC-----------CHHHHHHHHHHHHHCCTTEEEEEESCCCCSSSSHHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             cceeHHHHHhhCCHHHHHHhhhhhhhHHHHHHHHHHHhccCCCEEEEECCCCCCChhHHHHHHHHHHHHHHhccCCeEEE
Confidence            778888899999999999999999999999999998899999999999999999999999998889999987 4899999


Q ss_pred             EccChhHHhhccccceeeCceEEEecC--ccccchhhccCCCCCchHHHHHHHcCCCHHHHHHHHHHHHHh
Q 007057          470 TTHYADLSCLKDKDTRFENAATEFSLE--TLRPTYRILWGSTGDSNALNIAKSIGFDRKIIQRAQKLVERL  538 (620)
Q Consensus       470 ~TH~~~l~~~~~~~~~~~~g~~~~~~~--~l~~~y~l~~g~~~~s~a~~ia~~~g~~~~v~~~a~~~~~~~  538 (620)
                      +|||+++..+|++...+.|++|.++..  .+.++|++..|.++.|||+.+|+.+|+|++++++|++.+..+
T Consensus       726 ~TH~~el~~l~d~~~~v~n~~~~~~~~~~~l~~~ykl~~G~~~~S~gi~vA~~~GlP~~vi~rA~~~l~~l  796 (800)
T 1wb9_A          726 ATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLREL  796 (800)
T ss_dssp             ECSCGGGGGHHHHSTTEEEEEEEEEEETTEEEEEEEEEESCCSSCCHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred             EeCCHHHHHHhhhhhceEEEEEEEEEcCCcEEEEEEEEECCCCCcHHHHHHHHcCCCHHHHHHHHHHHHHH
Confidence            999999888999999999999988754  589999999999999999999999999999999999988654
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 620
d1wb9a2234 c.37.1.12 (A:567-800) DNA repair protein MutS, the 3e-37
d1ewqa2224 c.37.1.12 (A:542-765) DNA repair protein MutS, the 5e-35
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Length = 234 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

 Score =  136 bits (343), Expect = 3e-37
 Identities = 64/268 (23%), Positives = 116/268 (43%), Gaps = 42/268 (15%)

Query: 274 VCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLKSDVENSEMTVGSLS 333
            CP             I I   +HP++                                 
Sbjct: 2   TCPTFID------KPGIRITEGRHPVV--------------------------------E 23

Query: 334 KGISDFPVPIDIKVECETRVVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLP 393
           + +++  +   + +  + R+++ITGPN GGK+  M+   L +LM+  G Y+PA+     P
Sbjct: 24  QVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGP 83

Query: 394 WFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRESLVLIDEIGSGTDPSEGVALA 453
               I   +G    L    STF   ++   +IL   +  SLVL+DEIG GT   +G++LA
Sbjct: 84  IDR-IFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLA 142

Query: 454 TSILQYLRDRVG-LAVVTTHYADLSCLKDKDTRFENAATEFS--LETLRPTYRILWGSTG 510
            +  + L +++  L +  THY +L+ L +K     N   +     +T+   + +  G+  
Sbjct: 143 WACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAAS 202

Query: 511 DSNALNIAKSIGFDRKIIQRAQKLVERL 538
            S  L +A   G  +++I+RA++ +  L
Sbjct: 203 KSYGLAVAALAGVPKEVIKRARQKLREL 230
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query620
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 100.0
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.98
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.98
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.98
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.98
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.98
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.98
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.97
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.96
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.96
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.96
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.95
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.95
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.95
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.95
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.94
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.92
d1ewqa1275 DNA repair protein MutS, domain III {Thermus aquat 99.89
d1wb9a1297 DNA repair protein MutS, domain III {Escherichia c 99.86
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.67
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.42
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.39
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.8
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.73
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.27
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.39
d2qy9a2211 GTPase domain of the signal recognition particle r 97.07
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.95
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.91
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.86
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.82
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.79
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.7
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.7
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.62
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.61
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.57
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.56
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.56
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.52
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.49
d1vmaa2213 GTPase domain of the signal recognition particle r 96.45
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.37
d1okkd2207 GTPase domain of the signal recognition particle r 96.28
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.27
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.22
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.17
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.15
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.02
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.98
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.93
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.9
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.85
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.81
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.79
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.79
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.66
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.66
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.66
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.6
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.38
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.35
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.28
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.2
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.18
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.07
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.01
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.01
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.94
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.87
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.81
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.77
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.76
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.75
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.7
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.44
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.44
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.27
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.23
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.17
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.08
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.04
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.03
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.02
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.95
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.95
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.88
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.64
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.56
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.5
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.45
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.39
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.38
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.37
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.37
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.32
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.25
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.19
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.16
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 93.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.05
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.02
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.9
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.85
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.82
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.77
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 92.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 92.69
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.53
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 92.51
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.49
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.48
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.43
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.29
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.26
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.24
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.23
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.22
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.09
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.09
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 92.09
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.08
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.07
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.06
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.0
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 91.94
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.88
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.83
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.82
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.7
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 91.63
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.56
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.5
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 91.47
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 91.43
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 91.42
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.34
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.31
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.3
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.26
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.19
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 91.08
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.89
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.82
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.81
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.66
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.61
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.56
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.42
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.28
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.17
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.07
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.04
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.82
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.82
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.79
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.76
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 89.58
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.19
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.17
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 89.16
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.12
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.01
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.97
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.9
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 88.87
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 88.84
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.77
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.53
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.52
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.51
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.42
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.4
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.38
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 88.35
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.16
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.1
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 88.02
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 87.99
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.84
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.76
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.73
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.69
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 87.69
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.47
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 87.28
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.21
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.21
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 87.1
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.08
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.0
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.98
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.9
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 86.89
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.68
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.58
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 86.17
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.05
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.99
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.6
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.56
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.42
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 85.21
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.66
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.23
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.95
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.42
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 82.25
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 81.96
d1svma_362 Papillomavirus large T antigen helicase domain {Si 81.17
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 80.55
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Thermus aquaticus [TaxId: 271]

Probab=100.00  E-value=3.5e-42  Score=341.11  Aligned_cols=220  Identities=30%  Similarity=0.491  Sum_probs=191.1

Q ss_pred             CccceecCCCCCCCcceEEEcccccCccccchhhhcccccCCCCCCcCCCCCCeEEEeeeeeecCCccccccceecCCce
Q 007057          273 GVCPILSSQSHVSFDSSINIEGIKHPLLLGSSLRSLSAASSNSNPLKSDVENSEMTVGSLSKGISDFPVPIDIKVECETR  352 (620)
Q Consensus       273 ~~~P~~~~~~~~~~~~~i~i~~~rHPll~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~~l~~~y~~~~v~vsl~i~~g~~  352 (620)
                      ||||+|++        .++++++|||+++..     .                             .+||+|+.+..  +
T Consensus         1 y~~P~~~~--------~~~i~~~rHPlle~~-----~-----------------------------~~VpNdi~~~~--~   36 (224)
T d1ewqa2           1 YVRPRFGD--------RLQIRAGRHPVVERR-----T-----------------------------EFVPNDLEMAH--E   36 (224)
T ss_dssp             CBCCEESS--------SEEEEEECCTTGGGT-----S-----------------------------CCCCEEEEESS--C
T ss_pred             CCCCccCC--------cEEEEeCcCCEEcCC-----C-----------------------------CeecceEEeCC--c
Confidence            79999986        389999999998321     1                             25789998864  5


Q ss_pred             EEEEEcCCCCcHhHHHHHHhhhHHHHhhCccccCCCCCCccHHHHHHHHcCCchhhccccccchHHHHHHHHHHHhcCCC
Q 007057          353 VVVITGPNTGGKTASMKTLGLASLMSKAGLYLPAKNHPRLPWFDLILADIGDHQSLEQNLSTFSGHISRIVDILELVSRE  432 (620)
Q Consensus       353 ~~~I~GpNGsGKSTlLk~iGli~~~a~~G~~vp~~~~~~l~~~d~i~~~ig~~~~~~~~~s~lSgg~krl~~i~~l~~~~  432 (620)
                      +++|||||+|||||+||++|++.+|||+|+|||++. +.+++||.|+++++..|++..+.|+|+.+++++..++..+++.
T Consensus        37 ~~iiTGpN~~GKSt~lk~i~l~~ilAq~G~~vpA~~-~~i~~~d~I~~~~~~~d~~~~~~StF~~el~~~~~il~~~~~~  115 (224)
T d1ewqa2          37 LVLITGPNMAGKSTFLRQTALIALLAQVGSFVPAEE-AHLPLFDGIYTRIGASDDLAGGKSTFMVEMEEVALILKEATEN  115 (224)
T ss_dssp             EEEEESCSSSSHHHHHHHHHHHHHHHTTTCCBSSSE-EEECCCSEEEEECCC------CCSHHHHHHHHHHHHHHHCCTT
T ss_pred             EEEEECCCccccchhhhhhHHHHHHHhccceeecCc-eEEeecceEEEEECCCccccCCccHHHHhHHHHHHHhccCCCC
Confidence            899999999999999999999999999999999986 7899999999999999999999999999999999999999999


Q ss_pred             cEEEEcCCCCCCCHHHHHHHHHHHHHHHhcCCcEEEEEccChhHHhhccccceeeCceEEE--ecCccccchhhccCCCC
Q 007057          433 SLVLIDEIGSGTDPSEGVALATSILQYLRDRVGLAVVTTHYADLSCLKDKDTRFENAATEF--SLETLRPTYRILWGSTG  510 (620)
Q Consensus       433 ~LlLLDEpt~glD~~~~~~l~~all~~l~~~~~~vli~TH~~~l~~~~~~~~~~~~g~~~~--~~~~l~~~y~l~~g~~~  510 (620)
                      +|+|+||+++||||.+|.+++.+++++|.+.+.+++++||+.++..+....  +.+.++..  +.+.+.++|++..|.++
T Consensus       116 sLvliDE~~~gT~~~eg~ala~aile~L~~~~~~~i~tTH~~eL~~l~~~~--~~~~~~~~~~~~~~~~f~Ykl~~G~~~  193 (224)
T d1ewqa2         116 SLVLLDEVGRGTSSLDGVAIATAVAEALHERRAYTLFATHYFELTALGLPR--LKNLHVAAREEAGGLVFYHQVLPGPAS  193 (224)
T ss_dssp             EEEEEESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEECCCHHHHTCCCTT--EEEEEEEEECCSSSCEEEEEEEESCCS
T ss_pred             cEEeecccccCcchhhhcchHHHHHHHHhhcCcceEEeeechhhhhhhhcc--cceEEEEEEEeCCCeEEEEEEeeCCCC
Confidence            999999999999999999999999999999899999999999988776543  44444543  45678899999999999


Q ss_pred             CchHHHHHHHcCCCHHHHHHHHHHHHHhc
Q 007057          511 DSNALNIAKSIGFDRKIIQRAQKLVERLR  539 (620)
Q Consensus       511 ~s~a~~ia~~~g~~~~v~~~a~~~~~~~~  539 (620)
                      .|+|+++|+..|+|++++++|+++++.+.
T Consensus       194 ~s~ai~iA~~~Glp~~II~rA~~i~~~l~  222 (224)
T d1ewqa2         194 KSYGVEVAAMAGLPKEVVARARALLQAMA  222 (224)
T ss_dssp             SCCHHHHHHHTTCCHHHHHHHHHHHHHHT
T ss_pred             ccHHHHHHHHhCcCHHHHHHHHHHHHHHh
Confidence            99999999999999999999999887653
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure