Citrus Sinensis ID: 007143


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610------
MGAQKKRAAAAAAAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQPTVHDSDEELEYADNSSGTVEFSCTADQSNGEMTSESSEAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISDSNASEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
ccHHHHHHHHHHHHcccccccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccEEEEEccccccEEEEEcccccccccccccHHHHHccccEEEEcccEEEEEEEEcHHHHHHHHccccccHHHHHHHHHHHHccccccccEEEEEcccEEEccccHHHHHHHHHHHHHccccccccccccccccccEEccccEEEcccEEEccccEEcccEEEccccEEccccEEcccEEccccEEccccEEEccEEccccEEccccEEEcEEEEcccEEccccEEccccEEccccEEccccEEccccEEcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccEEEEccccccccHHcccccccccccHHHHHHHcccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccHHHHHHHHHHHcccc
ccccccccccccccccccccHHHHcccccEEEEEEcccccEEEccccccccccccHccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccccccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEccEEEcccHHHHHHHHHHHHHHccccEEEEEEEEccccccccccccccccEEEEEEccccEEEEEEEcccccccEEcccHHHHcccccEEEEcccccccEEEcccHHHHHcccccccHccHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcccEEEcccEEEcccEEEcccEEEccccEEcccEEEEcEEEcccEEEcccEEEEcEEEEccEEEcccEEEEEEEEEccEEEcccEEEcccEEEEccEEEcccEEEccccEEEEcccccccccccccccccccccccccccccccccccHHHcccccccccccccccEEEEEccccccHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHcHEEEEEHHHHHHHcccHHHHHHHHHHHcccc
MGAQKKRAAAAAAAARvsedpddlarQPLQAILLAdsfttkfrpitlerpkvllplvnvpmINYTLAWLEAAGVAEVFVFCCAHSKQVIDYlensewfsqpnftvktieshniISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKkskpspithqsrlgtdelfmaidpntkqllyyedkadhskgticldkmllaenpsislhndkqdcyidicspevlslftdnfdyqHLRRHFVKGLllddimgykiFTHEIHSSYAaridnyrsydivskdiiqrwtypyvpdvkfcgnraTKLERRGMYRALEIEqsrsaqvgsFTVIGygtkigsnskisdsvigegctigsnvliegsyiwdnviiedgcelrhVIVCDGVIMKAGAVLKPGVVLSFKVVIgerfvvpahskvsllqqptvhdsdeeleyadnssgtvefsctadqsngemtsesseahkpklgtggvGYIWSICeggqeeewrhsvapipedkltelseamdddqelVTQDRtalstsgelisdsnasegddnedskddsvYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRlegfflpnc
MGAQKKRAAAAAAaarvsedpddlARQPLQAILLadsfttkfrpitlerpkvllplvNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQehkerkkkdnnAVMTMiikkskpspithqSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQrwtypyvpdvkfcGNRATKLERRGMYRALeieqsrsaqvgsFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVpahskvsllqqptvhdsdEELEYADNSSGTVEFSCTADQSNGEMtsesseahkpklgtgGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDrtalstsgelisdsnasegddnedskDDSVYFEKEVEATFLraveenvkvdHVILEVNSLRGSLDFTCSLLMRLegfflpnc
MGAQKKRaaaaaaaaRVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQPTVHDSDEELEYADNSSGTVEFSCTADQSNGEMTSESSEAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISDSNASEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
****************************LQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQ************************************TDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKV**************************************************GTGGVGYIWSICEGGQE**W**********************************************************VYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFL***
*****************************QAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSK*********LGTDELFMAIDPNTKQLLYYEDKADH*KGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQP**************************************AHKPKLGTGGVGYIWSIC*******************************************************************YFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
***********************LARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQAL*********DNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQPTVHDSD************VEFSCTA***************KPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISD***************SVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
*************************RQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKP*******RLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQ*********************************TSESSEAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMD**********************************KDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAQKKRAAAAAAAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQPTVHDSDEELEYADNSSGTVEFSCTADQSNGEMTSESSEAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISDSNASEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGFFLPNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query616 2.2.26 [Sep-21-2011]
Q54RF3707 Translation initiation fa yes no 0.659 0.574 0.430 3e-97
P56287 678 Probable translation init yes no 0.850 0.772 0.334 1e-95
P87163 732 Translation initiation fa N/A no 0.926 0.780 0.336 9e-94
P47823 721 Translation initiation fa yes no 0.889 0.760 0.339 2e-91
Q8CHW4 717 Translation initiation fa yes no 0.883 0.758 0.340 1e-88
Q64350 716 Translation initiation fa yes no 0.889 0.765 0.335 2e-87
Q13144 721 Translation initiation fa yes no 0.730 0.624 0.369 1e-82
P32501 712 Translation initiation fa yes no 0.884 0.765 0.336 4e-80
P56288458 Probable translation init no no 0.620 0.834 0.266 4e-24
Q54FQ8440 Translation initiation fa no no 0.592 0.829 0.223 3e-14
>sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 Back     alignment and function desciption
 Score =  356 bits (914), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 267/411 (64%), Gaps = 5/411 (1%)

Query: 29  LQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQV 88
           LQA++L DSF  KF PITLE+P+ LLPLVN+P+++YTL +L A+GV ++FVFCCAH+ Q+
Sbjct: 25  LQAVVLGDSFDRKFAPITLEKPRTLLPLVNIPLLDYTLEFLAASGVQQIFVFCCAHASQI 84

Query: 89  IDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQ 148
            +Y+++S W   P   V  +   N  + GDALR +Y+  VI  DF+LISGD VSNM L +
Sbjct: 85  KEYIQSSRWHDLPGVQVICMTGSNCRTTGDALRGVYDAQVIQSDFILISGDVVSNMNLQK 144

Query: 149 ALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADH 208
           ALQ HK+R++ D N +MTM+ K++     TH++R   D+  +  + +T Q++ Y++    
Sbjct: 145 ALQIHKDRRELDKNNIMTMVYKQASS---THRTRSKQDDTVIWCNRDTMQVVCYDNSPSK 201

Query: 209 SKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLD 268
            K +I ++  L  ++PSI +  D  DC+IDICSPEVL+LF DNFD+  +R+ F+  +L  
Sbjct: 202 KKSSISVE--LFQKHPSIQMRYDLIDCHIDICSPEVLALFNDNFDFADIRKDFIHDILTS 259

Query: 269 DIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERRGM 328
           D++ YK+  + +   YAAR+ + R+Y  VSKDII RWT+P VPD  F  N +  L R+ +
Sbjct: 260 DLLDYKLSAYVLQGEYAARVKDLRTYHSVSKDIIHRWTFPMVPDNNFMCNSSYSLSRQMI 319

Query: 329 YRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVII 388
           Y+   ++      +   TVIG  T+IG+ S +S S IG  C IG NV I GSYIWD+V I
Sbjct: 320 YKEKNVKLLGDCLISDETVIGTQTEIGAGSIVSHSTIGRNCIIGKNVKINGSYIWDDVTI 379

Query: 389 EDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQ 439
           +D   + H I+C+G I+K+ +++  G ++ F V IG+   +   SK+++ Q
Sbjct: 380 QDNAIIDHSIICNGSIIKSSSIIGRGSIIGFNVYIGQSKTLEPFSKITMAQ 430




Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Dictyostelium discoideum (taxid: 44689)
>sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 Back     alignment and function description
>sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 Back     alignment and function description
>sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 Back     alignment and function description
>sp|Q8CHW4|EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus GN=Eif2b5 PE=1 SV=1 Back     alignment and function description
>sp|Q64350|EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus GN=Eif2b5 PE=1 SV=2 Back     alignment and function description
>sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 Back     alignment and function description
>sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 Back     alignment and function description
>sp|P56288|EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif223 PE=1 SV=2 Back     alignment and function description
>sp|Q54FQ8|EI2BG_DICDI Translation initiation factor eIF-2B subunit gamma OS=Dictyostelium discoideum GN=eif2b3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query616
297744835 730 unnamed protein product [Vitis vinifera] 0.959 0.809 0.772 0.0
224131394 718 predicted protein [Populus trichocarpa] 0.957 0.821 0.748 0.0
356505908 724 PREDICTED: probable translation initiati 0.952 0.810 0.737 0.0
356505910711 PREDICTED: probable translation initiati 0.936 0.811 0.736 0.0
356573048 725 PREDICTED: probable translation initiati 0.952 0.809 0.728 0.0
356573050716 PREDICTED: probable translation initiati 0.930 0.800 0.722 0.0
15226869 730 translation initiation factor eIF-2B eps 0.943 0.795 0.680 0.0
297823289 726 eIF4-gamma/eIF5/eIF2-epsilon domain-cont 0.941 0.798 0.682 0.0
307136048636 eIF4-gamma/eIF5/eIF2-epsilon domain-cont 0.879 0.852 0.665 0.0
449442881635 PREDICTED: translation initiation factor 0.878 0.851 0.658 0.0
>gi|297744835|emb|CBI38103.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/599 (77%), Positives = 520/599 (86%), Gaps = 8/599 (1%)

Query: 13  AAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAA 72
            + RVSED ++L R PLQAILLADSF  KFRPITLERPKVLLPLVNVPMI+YTLAWLE+A
Sbjct: 6   GSTRVSEDAEELVRVPLQAILLADSFAQKFRPITLERPKVLLPLVNVPMIDYTLAWLESA 65

Query: 73  GVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGD 132
           G+ EVFVFCCAHSKQVI+YLENS W S P+F V TIESHN +SAGDALRLIYE++VIHGD
Sbjct: 66  GIEEVFVFCCAHSKQVINYLENSHWVSLPHFEVTTIESHNSVSAGDALRLIYERHVIHGD 125

Query: 133 FVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAI 192
           FVLI+GDTVSNM LTQALQEHK+R+KKDNNAVMTM+IK+SKPSPITHQSRLGTDELFMAI
Sbjct: 126 FVLITGDTVSNMSLTQALQEHKDRRKKDNNAVMTMVIKRSKPSPITHQSRLGTDELFMAI 185

Query: 193 DPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNF 252
           DP+TKQLLYYEDKADH KGT+ L+KMLLA+NPSISLHNDKQDCYIDICSPEVLS+FTDNF
Sbjct: 186 DPHTKQLLYYEDKADHLKGTLSLEKMLLADNPSISLHNDKQDCYIDICSPEVLSIFTDNF 245

Query: 253 DYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPD 312
           DYQHLRRHF+KGLL+DDIMGYKIFTHEIHS+YAARIDN+RSYD +SKDIIQRWTYP VPD
Sbjct: 246 DYQHLRRHFIKGLLVDDIMGYKIFTHEIHSNYAARIDNFRSYDTISKDIIQRWTYPLVPD 305

Query: 313 VKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIG 372
           V+F GN A KLER+GMYRAL+I QSRSAQ+G F++IG GT IG N+KIS+SVIGE CTIG
Sbjct: 306 VQFLGNCAAKLERQGMYRALDIGQSRSAQIGPFSIIGNGTNIGDNTKISNSVIGERCTIG 365

Query: 373 SNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAH 432
           SNV IEGSYIWDNV IEDGC L+H IVC+ VIMK+GAVL+PGV+LSFKVVIG+ FVVPA+
Sbjct: 366 SNVSIEGSYIWDNVTIEDGCVLKHAIVCNDVIMKSGAVLEPGVILSFKVVIGQEFVVPAY 425

Query: 433 SKVSLLQQPTVHDSDEELEYADNSSGTVE---FSCTADQSNGEMTSESSEAH---KPKLG 486
           SKVSLLQQPT  DSDEELEYAD++SG  E    + T D+ NG +T +  E       ++G
Sbjct: 426 SKVSLLQQPTKQDSDEELEYADHNSGVEEIPSITSTVDKLNGVLTCKLPETEAWSTSEVG 485

Query: 487 TGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELIS 546
           +GGVGYIWSICEGG EEEWRHSVAP P DKLTE+ +A DDD EL TQ    L  SGEL+ 
Sbjct: 486 SGGVGYIWSICEGGHEEEWRHSVAPTPADKLTEVMQATDDDLELTTQGSNVLLPSGELVP 545

Query: 547 DSNA--SEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCS 603
           DSN+  SE DDNEDS+DDSVYFEKEVEATFLRAV ENVK DHVILEVNSLR S + T +
Sbjct: 546 DSNSNISEDDDNEDSRDDSVYFEKEVEATFLRAVHENVKEDHVILEVNSLRLSYNMTSA 604




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224131394|ref|XP_002328528.1| predicted protein [Populus trichocarpa] gi|222838243|gb|EEE76608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356505908|ref|XP_003521731.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356505910|ref|XP_003521732.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356573048|ref|XP_003554677.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356573050|ref|XP_003554678.1| PREDICTED: probable translation initiation factor eIF-2B subunit epsilon-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|15226869|ref|NP_181042.1| translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|3033392|gb|AAC12836.1| putative translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|22655208|gb|AAM98194.1| putative translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] gi|34098787|gb|AAQ56776.1| At2g34970 [Arabidopsis thaliana] gi|330253950|gb|AEC09044.1| translation initiation factor eIF-2B epsilon subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297823289|ref|XP_002879527.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325366|gb|EFH55786.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|307136048|gb|ADN33899.1| eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449442881|ref|XP_004139209.1| PREDICTED: translation initiation factor eIF-2B subunit epsilon-like [Cucumis sativus] gi|449482909|ref|XP_004156440.1| PREDICTED: translation initiation factor eIF-2B subunit epsilon-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query616
TAIR|locus:2044712 730 AT2G34970 "AT2G34970" [Arabido 0.946 0.798 0.682 9.1e-219
TAIR|locus:2141921 709 AT4G18300 "AT4G18300" [Arabido 0.915 0.795 0.630 9.8e-190
TAIR|locus:2076477676 AT3G02270 "AT3G02270" [Arabido 0.673 0.613 0.644 1.5e-162
DICTYBASE|DDB_G0283163707 eif2b5 "bacterial transferase 0.696 0.606 0.422 4.7e-99
UNIPROTKB|C0H8R1702 EI2BE "Translation initiation 0.805 0.706 0.380 9.8e-97
ZFIN|ZDB-GENE-030131-5364703 eif2b5 "eukaryotic translation 0.793 0.695 0.375 1.4e-95
CGD|CAL0005543 732 GCD6 [Candida albicans (taxid: 0.925 0.778 0.351 2.1e-91
UNIPROTKB|P87163 732 GCD6 "Translation initiation f 0.925 0.778 0.351 2.1e-91
POMBASE|SPAC8C9.15c678 tif225 "translation initiation 0.672 0.610 0.388 4.1e-88
UNIPROTKB|E1BPB3728 EIF2B5 "Uncharacterized protei 0.913 0.773 0.336 8e-85
TAIR|locus:2044712 AT2G34970 "AT2G34970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2113 (748.9 bits), Expect = 9.1e-219, P = 9.1e-219
 Identities = 412/604 (68%), Positives = 483/604 (79%)

Query:     1 MGAQKKRXXXXXXXXRVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVP 60
             MGAQKK         RVSED +  +R  LQAILLADSF TKFRP+TLERPKVLLP+VNVP
Sbjct:     1 MGAQKK----GGAAARVSEDAEVQSRHRLQAILLADSFATKFRPVTLERPKVLLPIVNVP 56

Query:    61 MINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDAL 120
             MI+YTLAWLE+AG+ EVFVFCCAHS QVI+YLE SEW+S PN  V+TIESH  ISAGDAL
Sbjct:    57 MIDYTLAWLESAGIEEVFVFCCAHSMQVIEYLEKSEWYSHPNLLVRTIESHKSISAGDAL 116

Query:   121 RLIYEQNV----IHGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSP 176
             R +YEQ      I GDFVL+SGDTVSNM L   +QEH+ERKKKD  A+MTM+IK+SK SP
Sbjct:   117 RYMYEQQTETSQIQGDFVLVSGDTVSNMPLADLIQEHRERKKKDEKAIMTMVIKQSKSSP 176

Query:   177 ITHQSRLGTDELFMAIDPNTKQLLYYE-DKADHSKGTICLDKMLLAENPSISLHNDKQDC 235
             +THQSRLGTD+LF+A+DP TKQLL+YE DK DH  G++CL+K LL  NPS+ + ND QDC
Sbjct:   177 LTHQSRLGTDQLFIAVDPLTKQLLHYEEDKIDHPSGSVCLEKSLLDTNPSVLVCNDMQDC 236

Query:   236 YIDICSPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYD 295
             YIDICSPEVLSLF DNFDYQHLRRHFVKG+L+DDIMGYKIFTHEIHSSYA RIDN+RSYD
Sbjct:   237 YIDICSPEVLSLFEDNFDYQHLRRHFVKGVLVDDIMGYKIFTHEIHSSYAGRIDNFRSYD 296

Query:   296 IVSKDIIQRWTYPYVPDVKFCGNRATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIG 355
              VSKDIIQRWTYPYVPD+ F GNR  KL R+G+Y+A ++ QSRSA VG+ TVIGYGTKIG
Sbjct:   297 TVSKDIIQRWTYPYVPDINFSGNRPLKLGRQGIYKASDVVQSRSADVGASTVIGYGTKIG 356

Query:   356 SNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIVCDGVIMKAGAVLKPGV 415
                KI +SVIG GC+IGSNV+IEGSYIW+NV IEDGCE+R+ IVCDGV ++AGAVL+PGV
Sbjct:   357 HGDKIMNSVIGNGCSIGSNVVIEGSYIWNNVTIEDGCEIRNAIVCDGVKIRAGAVLQPGV 416

Query:   416 VLSFKVVIGERFVVPAHSKVSLLQQPTVHDSDEELEYADNSSGTVEFSCTADQSNGEMTS 475
             VLSF VV+G  FVVPA+SKVSLLQQPT  DSDEELEYAD+SSGT +        N +M S
Sbjct:   417 VLSFNVVVGRDFVVPAYSKVSLLQQPTTEDSDEELEYADSSSGTADH---LSGLNLQMES 473

Query:   476 ESSEAHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDR 535
             ++SE     LG  G GYIW +CEG  +EEW+HSVAPIP+DKL+E+++A+DDD    T D 
Sbjct:   474 KASE-----LGPDGAGYIWEVCEGAHDEEWKHSVAPIPKDKLSEITQAIDDDD---TDDE 525

Query:   536 TALSTSGELISDSNASEGDDNEDSKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLR 595
             + + TSGEL SD+++   D N D  DD  YFEKEVE T LRAVEEN+KVD V +E+N LR
Sbjct:   526 SVVPTSGELKSDADSINTDVN-DPNDDYYYFEKEVEGTVLRAVEENIKVDLVTMEINGLR 584

Query:   596 GSLD 599
              S +
Sbjct:   585 LSFN 588




GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006446 "regulation of translational initiation" evidence=ISS
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016779 "nucleotidyltransferase activity" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
TAIR|locus:2141921 AT4G18300 "AT4G18300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076477 AT3G02270 "AT3G02270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283163 eif2b5 "bacterial transferase hexapeptide repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|C0H8R1 EI2BE "Translation initiation factor eIF-2B subunit epsilon" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5364 eif2b5 "eukaryotic translation initiation factor 2B, subunit 5 epsilon" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
CGD|CAL0005543 GCD6 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P87163 GCD6 "Translation initiation factor eIF-2B subunit epsilon" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPAC8C9.15c tif225 "translation initiation factor eIF2B epsilon subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPB3 EIF2B5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691
3rd Layer2.7.70.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query616
cd04197217 cd04197, eIF-2B_epsilon_N, The N-terminal domain o 5e-95
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 6e-74
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 5e-46
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 4e-37
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 8e-26
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 1e-19
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 8e-18
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 8e-16
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 3e-13
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p 1e-12
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 1e-11
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 5e-11
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 2e-10
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 3e-10
TIGR02092369 TIGR02092, glgD, glucose-1-phosphate adenylyltrans 5e-10
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 5e-10
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 4e-09
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 1e-08
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 1e-08
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 1e-08
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 2e-08
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 2e-08
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 4e-08
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 5e-08
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 6e-08
cd03350139 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyri 8e-08
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 8e-08
cd11558 169 cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of 1e-07
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 1e-07
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 2e-07
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 2e-07
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 2e-07
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase ( 2e-07
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-07
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): 5e-07
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 6e-07
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch 8e-07
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 9e-07
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-06
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 1e-06
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 1e-06
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 1e-06
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 2e-06
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 2e-06
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 2e-06
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 4e-06
COG1213239 COG1213, COG1213, Predicted sugar nucleotidyltrans 4e-06
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 5e-06
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 7e-06
PRK11830272 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-car 7e-06
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 1e-05
cd03359161 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 1e-05
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 1e-05
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransfera 1e-05
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 2e-05
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 2e-05
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransfe 2e-05
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 3e-05
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 3e-05
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 6e-05
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 6e-05
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 7e-05
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 1e-04
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 2e-04
TIGR02353695 TIGR02353, NRPS_term_dom, non-ribosomal peptide sy 3e-04
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 3e-04
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 4e-04
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 6e-04
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 6e-04
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 8e-04
cd02508200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory 9e-04
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 0.001
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1 0.001
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 0.001
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 0.001
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 0.002
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 0.002
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 0.002
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltra 0.002
cd04650154 cd04650, LbH_FBP, Ferripyochelin Binding Protein ( 0.002
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 0.003
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 0.003
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1 0.003
PLN02241436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 0.003
COG1045194 COG1045, CysE, Serine acetyltransferase [Amino aci 0.003
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 0.004
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
 Score =  290 bits (744), Expect = 5e-95
 Identities = 105/220 (47%), Positives = 149/220 (67%), Gaps = 6/220 (2%)

Query: 29  LQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQV 88
           LQA++LADSF  +FRP+T E+P+ LLPL NVP+I+YTL +L   GV EVFVFCC+HS Q+
Sbjct: 1   LQAVVLADSFNRRFRPLTKEKPRCLLPLANVPLIDYTLEFLALNGVEEVFVFCCSHSDQI 60

Query: 89  IDYLENSEWFSQPN--FTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLL 146
            +Y+E S+W    +    V  I S +  S GDALR +  + +I GDF+L+SGD VSN+ L
Sbjct: 61  KEYIEKSKWSKPKSSLMIVIIIMSEDCRSLGDALRDLDAKGLIRGDFILVSGDVVSNIDL 120

Query: 147 TQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDK- 205
            + L+EHKER+KKD NA+MTM++K++ P    H++R   +E  +A+DP T +LL+YE+  
Sbjct: 121 KEILEEHKERRKKDKNAIMTMVLKEASPP---HRTRRTGEEFVIAVDPKTSRLLHYEELP 177

Query: 206 ADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVL 245
               +    L   LL  N  + + +D  DC+IDICSP+VL
Sbjct: 178 GSKYRSITDLPSELLGSNSEVEIRHDLLDCHIDICSPDVL 217


N-terminal domain of epsilon subunit of the eukaryotic translation initiation factor 2B (eIF-2B): eIF-2B is a guanine nucleotide-exchange factor which mediates the exchange of GDP (bound to initiation factor eIF2) for GTP, generating active eIF2.GTP complex. EIF2B is a complex multimeric protein consisting of five subunits named alpha, beta, gamma, delta and epsilon. Subunit epsilon shares sequence similarity with gamma subunit, and with a family of bifunctional nucleotide-binding enzymes such as ADP-glucose pyrophosphorylase, suggesting that epsilon subunit may play roles in nucleotide binding activity. In yeast, eIF2B gamma enhances the activity of eIF2B-epsilon leading to the idea that these subunits form the catalytic subcomplex. Length = 217

>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|211396 cd11558, W2_eIF2B_epsilon, C-terminal W2 domain of eukaryotic translation initiation factor 2B epsilon Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|236996 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|223975 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 616
KOG1461 673 consensus Translation initiation factor 2B, epsilo 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
KOG1462433 consensus Translation initiation factor 2B, gamma 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 100.0
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 100.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 99.97
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 99.97
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 99.97
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 99.97
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 99.97
PRK10122297 GalU regulator GalF; Provisional 99.97
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 99.96
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 99.96
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.96
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.96
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.96
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 99.96
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 99.96
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.95
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 99.95
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.95
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.95
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.95
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.94
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.92
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.9
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.9
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.87
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.86
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.82
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.81
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.8
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.78
PRK11132273 cysE serine acetyltransferase; Provisional 99.77
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.76
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.71
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.71
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.65
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.64
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.61
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.6
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.6
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.6
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.59
PRK13627196 carnitine operon protein CaiE; Provisional 99.57
PLN02472246 uncharacterized protein 99.55
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.55
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.55
PLN02296269 carbonate dehydratase 99.54
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.53
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.53
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.52
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.52
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.51
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.51
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 99.5
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.49
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.48
TIGR00454183 conserved hypothetical protein TIGR00454. At this 99.47
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.47
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.46
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.46
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.46
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.45
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.45
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.44
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.44
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.43
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.42
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.42
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.41
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.41
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.41
PLN02917293 CMP-KDO synthetase 99.4
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.4
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.39
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.38
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.38
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.38
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.37
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.37
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.36
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.35
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.35
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.35
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.33
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.33
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.32
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.32
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.31
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.31
PLN02296269 carbonate dehydratase 99.3
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.3
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.3
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.3
KOG1461673 consensus Translation initiation factor 2B, epsilo 99.29
PLN02472246 uncharacterized protein 99.29
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.29
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.29
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.28
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.28
COG1043260 LpxA Acyl-[acyl carrier protein] 99.27
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.27
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.26
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 99.26
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.25
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.25
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 99.25
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.24
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.24
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.24
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.24
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.23
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.23
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.23
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.22
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.22
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.2
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.19
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.19
PRK10502182 putative acyl transferase; Provisional 99.18
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.18
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.17
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.17
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.17
PRK13627196 carnitine operon protein CaiE; Provisional 99.17
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.16
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.16
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.15
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.14
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.14
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 99.13
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.13
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.12
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.12
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.12
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.12
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.1
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 99.09
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.09
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.08
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.07
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.05
PLN02694294 serine O-acetyltransferase 99.04
cd02503181 MobA MobA catalyzes the formation of molybdopterin 99.04
COG2068199 Uncharacterized MobA-related protein [General func 99.03
PRK10092183 maltose O-acetyltransferase; Provisional 99.01
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.01
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.01
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 98.98
COG1043260 LpxA Acyl-[acyl carrier protein] 98.96
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 98.96
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 98.95
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 98.95
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.93
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.92
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.92
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 98.92
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.91
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 98.91
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.9
KOG1462433 consensus Translation initiation factor 2B, gamma 98.9
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 98.9
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 98.88
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 98.88
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 98.86
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.86
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.86
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 98.85
PLN02739355 serine acetyltransferase 98.84
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.84
PRK10502182 putative acyl transferase; Provisional 98.84
PRK11132273 cysE serine acetyltransferase; Provisional 98.83
PLN02357360 serine acetyltransferase 98.83
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 98.82
PRK10191146 putative acyl transferase; Provisional 98.82
PRK10092183 maltose O-acetyltransferase; Provisional 98.81
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 98.81
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 98.8
PLN02241436 glucose-1-phosphate adenylyltransferase 98.8
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 98.78
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.77
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.76
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.75
PLN02694294 serine O-acetyltransferase 98.75
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.75
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 98.74
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 98.74
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.74
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.73
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 98.73
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 98.72
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.69
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 98.68
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.68
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.67
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.67
PRK10191146 putative acyl transferase; Provisional 98.64
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 98.64
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 98.63
PLN02357360 serine acetyltransferase 98.62
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.61
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 98.59
PLN02739355 serine acetyltransferase 98.58
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.57
PF01128221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 98.57
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.57
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 98.56
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 98.48
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 98.41
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 98.35
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 98.33
PTZ00339482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.29
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.27
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 98.21
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.21
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.19
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.18
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 97.98
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 97.83
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 97.78
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 97.58
COG4801277 Predicted acyltransferase [General function predic 97.41
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 97.39
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.25
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.23
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthes 97.12
PLN02474469 UTP--glucose-1-phosphate uridylyltransferase 97.06
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.01
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.0
COG4801277 Predicted acyltransferase [General function predic 96.99
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 96.98
PLN02435493 probable UDP-N-acetylglucosamine pyrophosphorylase 96.84
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 96.75
COG1861241 SpsF Spore coat polysaccharide biosynthesis protei 96.68
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 96.65
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 96.34
PLN02830615 UDP-sugar pyrophosphorylase 96.13
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transp 95.94
PF01704420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 95.52
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 95.52
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 94.7
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 90.92
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=2.1e-113  Score=910.45  Aligned_cols=551  Identities=52%  Similarity=0.848  Sum_probs=475.6

Q ss_pred             CcccchHHHHHHHHhcccCCCCcccCCCeEEEEEeCCCCCCCCCCCCCCCcccceeCCeehHHHHHHHHHHCCCcEEEEE
Q 007143            1 MGAQKKRAAAAAAAARVSEDPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVF   80 (616)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~aVILA~g~~~R~~PlT~~~PK~Llpi~g~PlI~y~Le~L~~~Gv~eI~vv   80 (616)
                      |++++++  ++|+..-++...+.  ++.+|||+||++|.+||+|+|..+|++||||+|.|||+|+|++|.++||++|||+
T Consensus         1 M~~~k~~--~~~~~~~~~~~~~~--~~rLqAIllaDsf~trF~Plt~~~p~~LLPlaNVpmIdYtL~~L~~agV~eVfvf   76 (673)
T KOG1461|consen    1 MAKKKKR--PAALGETGKEENFR--EHRLQAILLADSFETRFRPLTLEKPRVLLPLANVPMIDYTLEWLERAGVEEVFVF   76 (673)
T ss_pred             CCcccCc--ccccccCccccccc--ccceEEEEEeccchhcccccccCCCceEeeecCchHHHHHHHHHHhcCceEEEEE
Confidence            7777766  33333333333333  8999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHhcCCCCCCCcEEEEEeCCCccCHHHHHHHHHhcccccCCEEEEeCceecchhHHHHHHHHHHhhccC
Q 007143           81 CCAHSKQVIDYLENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVIHGDFVLISGDTVSNMLLTQALQEHKERKKKD  160 (616)
Q Consensus        81 ~~~~~~~i~~~l~~~~~~~~~~~~i~~i~~~~~~~~gdalr~~~~~~~i~~dfLlv~gD~i~~~~l~~~l~~h~~~~~~d  160 (616)
                      |+.|+.||.+|+++++|.....+.+..|...+++++|||||+++++.++.+||+|++||+++|++|.++|++||+||+.|
T Consensus        77 c~~~~~qi~e~i~~sew~~~~~~~v~ti~s~~~~S~GDamR~id~k~litgDFiLVsgd~vsN~pl~~~l~eHr~r~k~D  156 (673)
T KOG1461|consen   77 CSAHAAQIIEYIEKSEWYLPMSFIVVTICSGESRSVGDAMRDIDEKQLITGDFILVSGDTVSNMPLRNVLEEHRKRRKED  156 (673)
T ss_pred             ecccHHHHHHHHhhccccccccceEEEEcCCCcCcHHHHHHHHHhcceeecceEEEeCCeeecCchHHHHHHHHHHhhhC
Confidence            99999999999999999887667788888888999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEEEEecCCCCCCCcccccCCCceEEEEeCCCCeEEEeeecCCCCCcceEeehHhhhcCCceEEEeccccceeEee
Q 007143          161 NNAVMTMIIKKSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDIC  240 (616)
Q Consensus       161 ~~a~mT~v~~~~~~~~~~~~~r~~~~~~vv~id~~~~rvl~~~e~p~~~~~~~~l~~~l~~~~~~~~ir~dl~d~gIyIc  240 (616)
                      |+++|||++++.+       +|.+++++++++|+.|+||+||++.. ...+.+.+++++|..++++.+|+||.||+|+||
T Consensus       157 k~~iMTmv~k~~s-------t~~~~~~~~~avd~~T~~ll~yq~~~-~~~~~~~l~~sl~d~~~~v~vr~DL~dc~IdIc  228 (673)
T KOG1461|consen  157 KDAIMTMVFKESS-------TRETTEQVVIAVDSRTSRLLHYQKCV-REKHDIQLDLSLFDSNDEVEVRNDLLDCQIDIC  228 (673)
T ss_pred             ccceEEEEEeccc-------cccCCcceEEEEcCCcceEEeehhhc-ccccccccCHHHhcCCCcEEEEccCCCceeeEe
Confidence            9999999999864       46667888999999999999999732 235679999999999999999999999999999


Q ss_pred             CHhHHhhhhcCCChhhHHHHhhhhhhhccccCceEEEEEcccc-chhhccChhhHHHHhhhhhccccccccCCCcccCCC
Q 007143          241 SPEVLSLFTDNFDYQHLRRHFVKGLLLDDIMGYKIFTHEIHSS-YAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNR  319 (616)
Q Consensus       241 sp~vl~lf~dnfd~q~lr~dfv~~~l~~~i~g~~I~~~~~~~~-y~~~V~s~~sY~~a~~dil~r~~~p~~p~~~~~~~~  319 (616)
                      ||+|++||+|||||| +|.||++|+|..+++|++||+|.+++. |++||.+|++|+.+++|+|+||+||++|+.++.+++
T Consensus       229 S~~V~sLF~dNFDyq-~r~DfV~GvL~~dilg~kI~~~~~~~~~yA~rv~n~~syd~vSkDiI~RW~YP~Vpd~~~~~~q  307 (673)
T KOG1461|consen  229 SPEVLSLFTDNFDYQ-TRDDFVRGVLVDDILGYKIHVHVLSSIDYAARVENLRSYDLVSKDIIQRWTYPLVPDINFSGNQ  307 (673)
T ss_pred             cHhHHHHhhhcccce-ehhhhhhhhhhhhhcCCeEEEEEcChhhhhhhhcccHHHHHHHHHHHHhhcccccccccCCCCc
Confidence            999999999999999 799999999999999999999999865 999999999999999999999999999999999999


Q ss_pred             cceeeecceEEcCCcEECCCCEECCCcEECCCCEECCCCEEeceEECCCCEECCCCEEeceEECCCCEECCCcEEeceEE
Q 007143          320 ATKLERRGMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDNVIIEDGCELRHVIV  399 (616)
Q Consensus       320 ~~~~~~~~i~~~~~v~i~~~~~I~~~~~Ig~~~~Ig~~~~I~~s~IG~~~~Ig~~~~I~~s~I~~~v~Ig~~~~I~~siI  399 (616)
                      .+.+.|.++|.++.+.++++|.++.+++||.+|.||.+++|.||+||.||.||.||+|.+|+||.+|+||+||+|.+|+|
T Consensus       308 ~~~~~r~~IYk~~dv~~~~~~~v~~~~~ig~gT~Ig~g~~I~NSVIG~~c~IgsN~~I~~S~iw~~v~Igdnc~I~~aii  387 (673)
T KOG1461|consen  308 TFSLERRNIYKSPDVVLSHSVIVGANVVIGAGTKIGSGSKISNSVIGANCRIGSNVRIKNSFIWNNVTIGDNCRIDHAII  387 (673)
T ss_pred             eeeecccccccCccceehhhccccceEEecccccccCCCeeecceecCCCEecCceEEeeeeeecCcEECCCceEeeeEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEECCCCEECCCCEECCCcEECCCCEECCCCEEccccCCCCCCChhhhhhhcCCCCcccccccccCCCCCccccccc
Q 007143          400 CDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKVSLLQQPTVHDSDEELEYADNSSGTVEFSCTADQSNGEMTSESSE  479 (616)
Q Consensus       400 g~~v~Ig~~~~I~~g~vIg~~v~Ig~~~~v~~~~~v~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~  479 (616)
                      |++|.|+++|++.+||+||.+|+||++.+++.+++|.+   +..+++|||.        ..+                  
T Consensus       388 ~d~v~i~~~~~l~~g~vl~~~VVv~~~~~l~~ns~~~~---p~~eesdee~--------~~~------------------  438 (673)
T KOG1461|consen  388 CDDVKIGEGAILKPGSVLGFGVVVGRNFVLPKNSKVRQ---PTTEESDEEG--------LDD------------------  438 (673)
T ss_pred             ecCcEeCCCcccCCCcEEeeeeEeCCCccccccccccC---Ccccccchhh--------ccc------------------
Confidence            99999999999999999999999999999999999933   4455554430        000                  


Q ss_pred             CCCCCcCCCCCeeEeeccCCCchhhhccCCCCCCCCcccccccccchhhhhhhcccccccCCCccccCCCCCCCCCCC-C
Q 007143          480 AHKPKLGTGGVGYIWSICEGGQEEEWRHSVAPIPEDKLTELSEAMDDDQELVTQDRTALSTSGELISDSNASEGDDNE-D  558 (616)
Q Consensus       480 ~~~~~vg~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~s~~~~~~-~  558 (616)
                      ....-+|+.|.||+|..+ +.++|+|.....+..+.++...+...++       .++          .|.++++++.+ +
T Consensus       439 ~~l~siG~~G~gyi~~~~-~~~dee~~~~~~~~~~~k~n~~~~~Dd~-------~se----------~s~~~~edd~~~~  500 (673)
T KOG1461|consen  439 VKLKSIGPDGAGYIWETE-DADDEEWKPLVPPSPNDKTNEAIEDDDS-------ESE----------SSVSEEEDDASTD  500 (673)
T ss_pred             hheeeccCCcceeeeccc-CcccccccccccCCcccccccccccccc-------hhh----------ccccccccccccc
Confidence            001228999999999763 3345555555444444333321111111       100          11112222212 2


Q ss_pred             CCCchhhHHHHHHHHHHHHHHcCCCCCcEEEeecccccccCCChHHhhcccCc
Q 007143          559 SKDDSVYFEKEVEATFLRAVEENVKVDHVILEVNSLRGSLDFTCSLLMRLEGF  611 (616)
Q Consensus       559 ~~~d~~~F~~e~~~~l~r~~~~~~~~d~~~lEin~lr~a~n~~~~~v~~~~~~  611 (616)
                      ..+|+..|++||.+||+||+|||+++|+++|||||||||||++++||+++.-+
T Consensus       501 in~d~~~F~~Ev~~s~~ra~Een~~~D~~vlEINslRla~N~s~~ev~~av~~  553 (673)
T KOG1461|consen  501 INDDTKDFEKEVLGSLQRAFEENSDMDNLVLEINSLRLAYNVSLKEVAGAVFM  553 (673)
T ss_pred             cCchhHHHHHHHHHHHHHHHHhccchHHHHHHHhhhHHhhcCCHHHHHHHHHH
Confidence            33578899999999999999999999999999999999999999999987643



>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query616
2ggo_A401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 1e-04
1jyk_A254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 2e-04
1jyl_A254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 2e-04
3pkp_A292 Q83s Variant Of S. Enterica Rmla With Datp Length = 2e-04
3pkq_A292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 2e-04
1mp4_A292 W224h Variant Of S. Enterica Rmla Length = 292 4e-04
1iim_A292 Thymidylyltransferase Complexed With Ttp Length = 2 5e-04
1mp5_A292 Y177f Variant Of S. Enterica Rmla Length = 292 6e-04
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 7e-04
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 7e-04
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 7e-04
1mp3_A292 L89t Variant Of S. Enterica Rmla Length = 292 8e-04
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 29 LQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCCAHSKQ 87 ++A +LA + PIT RPK +P+++ P+I Y + +L G+ ++ V + +K+ Sbjct: 1 MKAFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKE 59
>pdb|1JYK|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure
>pdb|1JYL|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure
>pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
>pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure
>pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure
>pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query616
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 2e-15
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 2e-13
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 7e-11
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 1e-11
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 5e-11
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 3e-10
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 5e-09
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 1e-09
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 5e-08
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 2e-09
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 2e-09
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 2e-09
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 1e-04
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 2e-04
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 3e-09
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 6e-05
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 2e-04
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 5e-09
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 9e-09
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 1e-06
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 1e-06
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 1e-05
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 1e-08
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 2e-04
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 5e-04
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 6e-08
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 3e-07
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 5e-07
3jui_A 182 Translation initiation factor EIF-2B subunit EPSI; 7e-07
1paq_A 189 Translation initiation factor EIF-2B epsilon subun 8e-07
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 1e-06
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 2e-04
3r3r_A187 Ferripyochelin binding protein; structural genomic 2e-06
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 4e-06
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 5e-06
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 9e-06
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 1e-05
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 1e-05
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 1e-05
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 2e-05
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 2e-05
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 3e-05
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 3e-04
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 7e-04
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 7e-04
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 8e-04
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 8e-04
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
 Score = 75.5 bits (186), Expect = 2e-15
 Identities = 23/102 (22%), Positives = 41/102 (40%), Gaps = 5/102 (4%)

Query: 339 SAQVGSFTVIGYGTKIGSNSKI-SDSVIGEGCTIGSNVLI-EGSYIWDNVIIEDGCELRH 396
              +    +I  G  IG N  I  +  I  GC I  NV I +GS+I    I+ +     +
Sbjct: 2   PNNISKSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSILGEYLVDFY 61

Query: 397 ---VIVCDGVIMKAGAVLKPGVVLSFKVVIGERFVVPAHSKV 435
              +     +I+   A+++   V+    +IG+ F       +
Sbjct: 62  NDRINKKHPLIIGENALIRTENVIYGDTIIGDNFQTGHKVTI 103


>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} Length = 182 Back     alignment and structure
>1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14 Length = 189 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query616
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 99.96
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.95
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.94
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.94
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.93
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.93
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.92
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.92
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.92
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.91
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.89
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.89
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.86
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.85
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.85
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.84
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.78
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.78
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.74
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.73
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.71
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.71
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.69
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.69
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.69
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.68
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.67
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.66
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.66
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.66
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.65
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.65
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.64
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.64
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 99.6
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.6
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.56
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.56
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.55
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.55
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.54
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.54
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.54
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.54
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.54
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.53
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.53
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.53
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.53
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.52
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.52
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.52
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.52
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.51
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.51
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.5
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.5
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.49
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.49
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.48
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.48
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.47
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.47
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.47
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 99.46
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.46
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.46
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.46
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.45
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.45
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.45
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.45
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.45
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 99.45
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.45
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.45
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.45
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.44
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.44
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.44
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.43
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.43
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.42
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.42
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.41
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.41
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.41
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.41
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.41
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.4
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.38
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.38
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.38
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.37
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.37
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.37
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.37
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 99.36
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.36
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.35
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.35
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 99.34
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.33
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.31
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.3
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.3
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.25
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.25
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.22
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.22
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.2
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.2
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.19
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 99.19
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.18
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.18
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.17
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.17
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.17
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.15
3jui_A 182 Translation initiation factor EIF-2B subunit EPSI; 99.15
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.14
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.14
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.14
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.14
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.13
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.13
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.12
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.11
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.1
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.1
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 99.09
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.09
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.08
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.05
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.05
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.04
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.04
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.03
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.01
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 99.01
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.01
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.01
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.0
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 98.99
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 98.98
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.96
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 98.95
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 98.94
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 98.92
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.92
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 98.92
4hur_A220 Virginiamycin A acetyltransferase; structural geno 98.91
1paq_A 189 Translation initiation factor EIF-2B epsilon subun 98.91
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.87
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.81
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 98.79
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 98.74
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 98.65
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 98.65
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.49
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.47
3r3i_A528 UTP--glucose-1-phosphate uridylyltransferase; ross 97.63
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 96.66
3gue_A484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 95.96
3ogz_A630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 95.26
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
Probab=100.00  E-value=1e-44  Score=397.30  Aligned_cols=381  Identities=18%  Similarity=0.242  Sum_probs=270.8

Q ss_pred             CeEEEEEeCCCCCCCCCCCCCCCcccceeCCe-ehHHHHHHHHHHCCCcEEEEEcCCcHHHHHHHHHhcCCCCC-----C
Q 007143           28 PLQAILLADSFTTKFRPITLERPKVLLPLVNV-PMINYTLAWLEAAGVAEVFVFCCAHSKQVIDYLENSEWFSQ-----P  101 (616)
Q Consensus        28 ~l~aVILA~g~~~R~~PlT~~~PK~Llpi~g~-PlI~y~Le~L~~~Gv~eI~vv~~~~~~~i~~~l~~~~~~~~-----~  101 (616)
                      .|+|||||+|+|+||+|||..+||+|+||+|+ |||+|+|+.|..+|+++|+|+++++.+++.+|+.+ .|...     .
T Consensus        20 ~~~avILAaG~gtRl~plT~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~~~i~~~~~~-~~~~~~~~~~~   98 (451)
T 1yp2_A           20 SVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSR-AYASNMGGYKN   98 (451)
T ss_dssp             HEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHHHHHH-HCC--------
T ss_pred             ceEEEEECCCCCCcccchhcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCHHHHHHHHhh-hhhcccccccc
Confidence            58999999999999999999999999999998 99999999999999999999999988899999875 23100     0


Q ss_pred             CcEEEEEe--CC-----CccCHHHHHHHHHhccccc----CCEEEEeCceecchhHHHHHHHHHHhhccCCCceEEEEEe
Q 007143          102 NFTVKTIE--SH-----NIISAGDALRLIYEQNVIH----GDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIK  170 (616)
Q Consensus       102 ~~~i~~i~--~~-----~~~~~gdalr~~~~~~~i~----~dfLlv~gD~i~~~~l~~~l~~h~~~~~~d~~a~mT~v~~  170 (616)
                      .-.+.++.  +.     ...|++++++...  ..+.    ++||+++||++++.+|.++++.|+++     ++.+|+++.
T Consensus        99 ~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~--~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~~-----~~~~tl~~~  171 (451)
T 1yp2_A           99 EGFVEVLAAQQSPENPDWFQGTADAVRQYL--WLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRET-----DADITVAAL  171 (451)
T ss_dssp             CCEEEEEESCSSTTSCCCCCSHHHHHHHTH--HHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHT-----TCSEEEEEE
T ss_pred             cCcEEEecccccccccccccCcHHHHHHHH--HHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHHc-----CCcEEEEEE
Confidence            01133332  11     1479999998643  3333    44999999999999999999999875     467888877


Q ss_pred             cCCCCCCCcccccCCCceEEEEeCCCCeEEEeeecCCCC-CcceEeehHhhhcCCceEE-EeccccceeEeeCHhHH-hh
Q 007143          171 KSKPSPITHQSRLGTDELFMAIDPNTKQLLYYEDKADHS-KGTICLDKMLLAENPSISL-HNDKQDCYIDICSPEVL-SL  247 (616)
Q Consensus       171 ~~~~~~~~~~~r~~~~~~vv~id~~~~rvl~~~e~p~~~-~~~~~l~~~l~~~~~~~~i-r~dl~d~gIyIcsp~vl-~l  247 (616)
                      +....   ...+++    ++.+|. +++|+.|.|||... ...+.++..+|..++.... .+++.++|||+|++++| .+
T Consensus       172 ~~~~~---~~~~~g----~v~~d~-~~~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~  243 (451)
T 1yp2_A          172 PMDEK---RATAFG----LMKIDE-EGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNL  243 (451)
T ss_dssp             EECHH---HHTTSE----EEEECT-TSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHH
T ss_pred             EcChh---hcccCC----EEEECC-CCCEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHH
Confidence            65311   234666    778874 78999999998521 1224455666654332111 24688999999999998 46


Q ss_pred             hhcCCCh-hhHHHHhhhhhhhccccCceEEEEEccccchhhccChhhHHHHhhhhhccccccccCCCcccCCCcceeeec
Q 007143          248 FTDNFDY-QHLRRHFVKGLLLDDIMGYKIFTHEIHSSYAARIDNYRSYDIVSKDIIQRWTYPYVPDVKFCGNRATKLERR  326 (616)
Q Consensus       248 f~dnfd~-q~lr~dfv~~~l~~~i~g~~I~~~~~~~~y~~~V~s~~sY~~a~~dil~r~~~p~~p~~~~~~~~~~~~~~~  326 (616)
                      +.+.+.. .....++++.++.   .|.+++++.++ +||.+++++++|..++++++.++.    |...+....  .....
T Consensus       244 l~~~~~~~~~~~~~~l~~~i~---~g~~v~~~~~~-~~w~digt~~~l~~a~~~l~~~~~----~~~~~~~~~--~~i~~  313 (451)
T 1yp2_A          244 LRDKFPGANDFGSEVIPGATS---LGMRVQAYLYD-GYWEDIGTIEAFYNANLGITKKPV----PDFSFYDRS--APIYT  313 (451)
T ss_dssp             HHTTCTTCCCTTTTHHHHHHH---TTCCEEEEECC-SCCEECSSHHHHHHHHHGGGCSSS----CSSCSCCSS--SCCCC
T ss_pred             HHhhcccccchHhhHHHHHHh---cCCceEEEEeC-CEEEECCCHHHHHHHHHHHhcccc----cchhccCCC--Ceecc
Confidence            6654321 1112244443332   35799999986 899999999999999999998873    111111110  01112


Q ss_pred             ceEEcCCcEECCCCEECCCcEECCCCEECCCCEEeceEECCCCEECCCCEEeceEECCC-------------------CE
Q 007143          327 GMYRALEIEQSRSAQVGSFTVIGYGTKIGSNSKISDSVIGEGCTIGSNVLIEGSYIWDN-------------------VI  387 (616)
Q Consensus       327 ~i~~~~~v~i~~~~~I~~~~~Ig~~~~Ig~~~~I~~s~IG~~~~Ig~~~~I~~s~I~~~-------------------v~  387 (616)
                      .+.+++++.| .++.| .++.||++|.|+. +.|.+++||++|.||++|+|.++++..+                   +.
T Consensus       314 ~~~i~~~~~i-~~~~I-~~~~Ig~~~~I~~-~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  390 (451)
T 1yp2_A          314 QPRYLPPSKM-LDADV-TDSVIGEGCVIKN-CKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIG  390 (451)
T ss_dssp             CCCCCCCEEE-EEEEE-EEEEECTTCEEEE-EEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSE
T ss_pred             CCccCCCeEE-cceEE-eCeEECCCCEEcc-eEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEE
Confidence            3345555555 45667 5688999999986 8888999999999999999999888888                   99


Q ss_pred             ECCCcEEeceEECCCcEECCCCEECCCC------EECCCcEECCCC-EECCCCEEcc
Q 007143          388 IEDGCELRHVIVCDGVIMKAGAVLKPGV------VLSFKVVIGERF-VVPAHSKVSL  437 (616)
Q Consensus       388 Ig~~~~I~~siIg~~v~Ig~~~~I~~g~------vIg~~v~Ig~~~-~v~~~~~v~~  437 (616)
                      ||++|.|.+++||++|+||++++|..++      +||++|.||+++ +|+++++|+.
T Consensus       391 Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~~~~~~~ig~~~~ig~~~v~Ig~~a~i~a  447 (451)
T 1yp2_A          391 IGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIKDALIPS  447 (451)
T ss_dssp             ECTTCEEESEEECTTCEECTTCEECCSSCCSCEEEGGGTEEEETTEEEECTTCEECT
T ss_pred             ECCCCEEeccEeCCCcEECCCCEEeCCcccccCceeCCCEEEcCCEEEECCCcEECC
Confidence            9999999999999999999999999753      456666665554 3555555554



>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3jui_A Translation initiation factor EIF-2B subunit EPSI; heat repeat, guanine nucleotide exchange factor, disease mutation, leukodystrophy; 2.00A {Homo sapiens} SCOP: a.118.1.0 Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1paq_A Translation initiation factor EIF-2B epsilon subunit; heat repeat, AA motif; 2.30A {Saccharomyces cerevisiae} SCOP: a.118.1.14 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 616
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 2e-16
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 2e-15
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 3e-14
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 2e-12
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 1e-10
d1g97a2250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 1e-09
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 1e-09
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 4e-08
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 2e-07
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 7e-07
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 3e-06
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 7e-05
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 1e-08
d2jf2a1262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 4e-08
d2jf2a1262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 3e-04
d2jf2a1262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 8e-04
d1paqa_ 161 a.118.1.14 (A:) Translation initiation factor eIF- 6e-08
d2oi6a2248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 2e-07
d1j2za_259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 4e-07
d1j2za_259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 4e-07
d1yp2a1135 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt 1e-06
d1yp2a1135 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt 1e-05
d2f9ca1320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 2e-06
d2f9ca1320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 0.001
d3tdta_274 b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra 3e-06
d1mr7a_203 b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero 1e-04
d2dpwa1231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 1e-04
d1g97a1196 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha 0.004
d1ssqa_241 b.81.1.6 (A:) Serine acetyltransferase {Haemophilu 0.004
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain
species: Potato (Solanum tuberosum) [TaxId: 4113]
 Score = 78.1 bits (191), Expect = 2e-16
 Identities = 44/307 (14%), Positives = 105/307 (34%), Gaps = 35/307 (11%)

Query: 20  DPDDLARQPLQAILLADSFTTKFRPITLERPKVLLPLV-NVPMINYTLAWLEAAGVAEVF 78
           DPD  A + +  I+L     T+  P+T +R K  +PL  N  +I+  ++    + +++++
Sbjct: 5   DPD--ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIY 62

Query: 79  VFCCAHSKQVIDYL---------ENSEWFSQPNFTVKTIESHNIISAGDALRLIYEQNVI 129
           V    +S  +  +L                      +    +     G A  +     + 
Sbjct: 63  VLTQFNSASLNRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLF 122

Query: 130 ----HGDFVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLGT 185
                 ++++++GD +  M          E+  + +      I   + P      +  G 
Sbjct: 123 EEHTVLEYLILAGDHLYRM--------DYEKFIQAHRETDADITVAALPMDEKRATAFGL 174

Query: 186 DELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENP-SISLHNDKQDCYIDICSPEV 244
               M ID   + + + E         + +D  +L  +              I + S +V
Sbjct: 175 ----MKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDV 230

Query: 245 L-SLFTDNFDYQHLRRHFVKGLLLDDI-MGYKIFTHEIHSSYAARIDNYRSYDIVSKDII 302
           + +L  D F   +    F   ++     +G ++  +  +  Y   I    ++   +  I 
Sbjct: 231 MLNLLRDKFPGAN---DFGSEVIPGATSLGMRVQAYL-YDGYWEDIGTIEAFYNANLGIT 286

Query: 303 QRWTYPY 309
           ++    +
Sbjct: 287 KKPVPDF 293


>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1paqa_ a.118.1.14 (A:) Translation initiation factor eIF-2b epsilon {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 161 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query616
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 99.98
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 99.97
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 99.96
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.94
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.93
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.9
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.89
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.79
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.72
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.54
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.47
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.46
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.45
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.44
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.41
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.41
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.4
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.38
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.38
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.36
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.34
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.33
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.27
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.24
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.23
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.23
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.22
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.22
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.2
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.19
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 99.18
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.18
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.17
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.12
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.07
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.07
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.07
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.06
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.01
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 99.0
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.0
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.95
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 98.93
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.92
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.91
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.84
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 98.79
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 98.78
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.77
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 98.6
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 98.48
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.41
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 98.4
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 98.37
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.04
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 97.95
d1jv1a_501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 96.64
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.98  E-value=1.6e-32  Score=279.73  Aligned_cols=235  Identities=15%  Similarity=0.164  Sum_probs=190.9

Q ss_pred             CeEEEEEeCCCCCCCCCCCCCCCcccceeCCeehHHHHHHHHHHCCCcEEEEEcC-CcHHHHHHHHHhcCCCCCCCcEEE
Q 007143           28 PLQAILLADSFTTKFRPITLERPKVLLPLVNVPMINYTLAWLEAAGVAEVFVFCC-AHSKQVIDYLENSEWFSQPNFTVK  106 (616)
Q Consensus        28 ~l~aVILA~g~~~R~~PlT~~~PK~Llpi~g~PlI~y~Le~L~~~Gv~eI~vv~~-~~~~~i~~~l~~~~~~~~~~~~i~  106 (616)
                      +++|||||||+||||+|+|..+||||+||+|+|||+|+|++|..+|+++|+|+|+ ++.+++++++......   +++++
T Consensus         1 k~KavILAgG~GtRl~plT~~~pKpllpi~gkPiI~~~l~~l~~~Gi~ei~ii~~~~~~~~i~~~~~~~~~~---g~~I~   77 (292)
T d1fxoa_           1 KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNW---GLDLQ   77 (292)
T ss_dssp             CEEEEEECCCCCTTTTTHHHHSCGGGSEETTEETTHHHHHHHHHTTCCEEEEEECTTTHHHHHHHHTTSGGG---TCEEE
T ss_pred             CcEEEEECCCCCCcCChhhcCCCcccCEECCEehHHHHHHHHHHCCCCEEEEEeCcCCHHHHHHHhcccccc---CeEEE
Confidence            3699999999999999999999999999999999999999999999999988876 5688999999764321   57899


Q ss_pred             EEeCCCccCHHHHHHHHHhcccccCC--EEEEeCceecchhHHHHHHHHHHhhccCCCceEEEEEecCCCCCCCcccccC
Q 007143          107 TIESHNIISAGDALRLIYEQNVIHGD--FVLISGDTVSNMLLTQALQEHKERKKKDNNAVMTMIIKKSKPSPITHQSRLG  184 (616)
Q Consensus       107 ~i~~~~~~~~gdalr~~~~~~~i~~d--fLlv~gD~i~~~~l~~~l~~h~~~~~~d~~a~mT~v~~~~~~~~~~~~~r~~  184 (616)
                      ++.+++..|+|+|+..  ++.++.++  ||++++|++++.+|.+++++|.++     ++.+|+++.++.     ++.|||
T Consensus        78 y~~q~~~~Gta~ai~~--a~~~i~~~~~~lil~dD~~~~~dl~~ll~~h~~~-----~~~~~i~~~~V~-----~p~~yG  145 (292)
T d1fxoa_          78 YAVQPSPDGLAQAFLI--GESFIGNDLSALVLGDNLYYGHDFHELLGSASQR-----QTGASVFAYHVL-----DPERYG  145 (292)
T ss_dssp             EEECSSCCCGGGHHHH--THHHHTTSEEEEEETTEEEECTTHHHHHHHHHTC-----CSSEEEEEEECS-----CGGGSE
T ss_pred             EccCCCCCcHHHHHHh--hhhhcCCCceEEEEccccccCcCHHHHHHHHHhC-----CCCcEEEEEECC-----CHHHCe
Confidence            9999999999999995  56678755  677788899999999999999886     366788888765     456899


Q ss_pred             CCceEEEEeCCCCeEEEeeecCCCCCcceEeehHhhhcCCceEEEeccccceeEeeCHhHHhhhhcCCChhhHHHHhhhh
Q 007143          185 TDELFMAIDPNTKQLLYYEDKADHSKGTICLDKMLLAENPSISLHNDKQDCYIDICSPEVLSLFTDNFDYQHLRRHFVKG  264 (616)
Q Consensus       185 ~~~~vv~id~~~~rvl~~~e~p~~~~~~~~l~~~l~~~~~~~~ir~dl~d~gIyIcsp~vl~lf~dnfd~q~lr~dfv~~  264 (616)
                          |+.+|. ++++..+.|||..+                   .+++..+|+|++.++++.++..-..-.. .+.++.+
T Consensus       146 ----V~~~d~-~~ki~~~~EKP~~p-------------------~Snla~~G~Y~f~~~~~~~~~~l~~s~r-gE~eitD  200 (292)
T d1fxoa_         146 ----VVEFDQ-GGKAISLEEKPLEP-------------------KSNYAVTGLYFYDQQVVDIARDLKPSPR-GELEITD  200 (292)
T ss_dssp             ----EEEECT-TSCEEEEEESCSSC-------------------SSSEEEEEEEEECTTHHHHHHHCCCCTT-SSCCHHH
T ss_pred             ----EEEEcC-CCCEeEEEECCCCC-------------------CCCcEEEEEEEEChHHHHHHHhCCCCCC-CchhhHH
Confidence                888884 78999999999733                   2688899999999999988764321110 1233455


Q ss_pred             hhhccccCceEEEEEcccc-chhhccChhhHHHHhhhhh
Q 007143          265 LLLDDIMGYKIFTHEIHSS-YAARIDNYRSYDIVSKDII  302 (616)
Q Consensus       265 ~l~~~i~g~~I~~~~~~~~-y~~~V~s~~sY~~a~~dil  302 (616)
                      +++..+..+++.++.+..+ +|.|++|+.+|..++..+.
T Consensus       201 ~~~~~l~~~~~~~~~~~~~~~W~D~Gt~~~l~~a~~~v~  239 (292)
T d1fxoa_         201 VNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIA  239 (292)
T ss_dssp             HHHHHHHTTCEEEEECCTTSEEEECCSHHHHHHHHHHHH
T ss_pred             HHHHHHHcCCeEEEEeCCCCEEEeCCCHHHHHHHHHHHH
Confidence            5555555677888777655 6999999999999997653



>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure