Citrus Sinensis ID: 007193


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610---
MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
ccccHHHHHHcHHHHHHHccccccccccHHHHHHHHHcccHHHHHHHHHHHHHccccccHHcHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcc
ccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHccc
mqdggknmlqfpypngkhanyahDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFfklvpnptlstFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVnagiepnvhtyGALIDGCAKAGQVAKAFGAygimrsknvkpdrVVFNALITACGQSGAVDRAFDVLAEMnaevhpvdpdhiTIGALMKACANAGQVDRAREVYKMIHKynikgtpeVYTIAINCcsqtgdwefACSVyddmtkkgvipdeVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKsiklkptvSTMNALITAlcdgdqlpkTMEVLSDmkslglcpntiTYSILLVACERKDDVEVGLMLLSqakedgvipnlVMFKCIIGMCSRRYEKARTLNEHVlsfnsgrpqienKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNlcslidgfgeydpRAFSLLEEAasfgivpcvsfkeipvvvdARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLsqakedgvipnLVMFKCIIGMCSRRYEKARTLNEHvlsfnsgrpqieNKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
******************ANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILC***
***GGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
*QDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAAAILCKKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query613 2.2.26 [Sep-21-2011]
Q0WLC6 1089 Pentatricopeptide repeat- yes no 0.982 0.552 0.697 0.0
Q76C99791 Protein Rf1, mitochondria N/A no 0.709 0.549 0.260 6e-36
Q9LSL9915 Pentatricopeptide repeat- no no 0.650 0.436 0.279 2e-35
Q9SIC9918 Pentatricopeptide repeat- no no 0.694 0.464 0.273 4e-35
Q9SR00602 Pentatricopeptide repeat- no no 0.737 0.750 0.258 9e-35
Q9SXD8634 Pentatricopeptide repeat- no no 0.681 0.659 0.248 1e-34
Q9C8T7559 Pentatricopeptide repeat- no no 0.681 0.747 0.248 1e-34
Q9SXD1630 Pentatricopeptide repeat- no no 0.647 0.630 0.259 2e-34
Q9FIX3747 Pentatricopeptide repeat- no no 0.696 0.571 0.261 2e-34
Q9ZQF1627 Pentatricopeptide repeat- no no 0.738 0.722 0.237 4e-34
>sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein At4g34830, chloroplastic OS=Arabidopsis thaliana GN=At4g34830/At4g34820 PE=2 SV=2 Back     alignment and function desciption
 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/602 (69%), Positives = 505/602 (83%)

Query: 6   KNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHA 65
           ++M QFP  N +  N      E   +YNRL+R GRI +CI LLED++++ LLDMDK+YHA
Sbjct: 381 ESMPQFPARNFELHNSNGRSPETSDAYNRLLRDGRIKDCISLLEDLDQRDLLDMDKIYHA 440

Query: 66  RFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKA 125
            FF  CK Q+A+KEAFRF KL+ NPT+STFNMLMSVCASS+D EGA  VLRLVQE+G+ A
Sbjct: 441 SFFKACKKQRAVKEAFRFTKLILNPTMSTFNMLMSVCASSQDIEGARGVLRLVQESGMTA 500

Query: 126 DCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAY 185
           DCKLYTTLI++CAKSGKVDAMFEVFH+M N+G+E N+HT+GALIDGCA+AGQVAKAFGAY
Sbjct: 501 DCKLYTTLISSCAKSGKVDAMFEVFHQMSNSGVEANLHTFGALIDGCARAGQVAKAFGAY 560

Query: 186 GIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACA 245
           GI+RSKNVKPDRVVFNALI+ACGQSGAVDRAFDVLAEM AE HP+DPDHI+IGALMKAC 
Sbjct: 561 GILRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHISIGALMKACC 620

Query: 246 NAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEV 305
           NAGQV+RA+EVY+MIHKY I+GTPEVYTIA+N CS++GDW+FACS+Y DM +K V PDEV
Sbjct: 621 NAGQVERAKEVYQMIHKYGIRGTPEVYTIAVNSCSKSGDWDFACSIYKDMKEKDVTPDEV 680

Query: 306 FLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHM 365
           F SALID AGHA  ++ AF ILQ+AK+QGI +G ISYSSLMGAC NAK+W+KALELYE +
Sbjct: 681 FFSALIDVAGHAKMLDEAFGILQDAKSQGIRLGTISYSSLMGACCNAKDWKKALELYEKI 740

Query: 366 KSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDV 425
           KSIKL+PT+STMNALITALC+G+QLPK ME L ++K+LGL PNTITYS+L++A ERKDD 
Sbjct: 741 KSIKLRPTISTMNALITALCEGNQLPKAMEYLDEIKTLGLKPNTITYSMLMLASERKDDF 800

Query: 426 EVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSL 485
           EV   LLSQAK DGV PNL+M +CI  +C RR+EKA    E V+SF SGRPQIENKWTS+
Sbjct: 801 EVSFKLLSQAKGDGVSPNLIMCRCITSLCKRRFEKACAGGEPVVSFKSGRPQIENKWTSM 860

Query: 486 ALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLID 545
           ALMVYRE I  GT+PT EVVS+VLGCLQLP++A +R+RL+  LG++  + K+ N+  L+D
Sbjct: 861 ALMVYRETISGGTVPTTEVVSQVLGCLQLPHDAALRDRLISTLGINISSQKQHNIFPLVD 920

Query: 546 GFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLA 605
           GFGEYDPRAFSLLEEA S G++P VSF +IP+  D  +L  + A+VYLLTI KGL+HRLA
Sbjct: 921 GFGEYDPRAFSLLEEATSLGVLPSVSFNKIPLFFDTTELPKNVAEVYLLTIFKGLKHRLA 980

Query: 606 AA 607
           A 
Sbjct: 981 AG 982





Arabidopsis thaliana (taxid: 3702)
>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 Back     alignment and function description
>sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
255586885 1129 pentatricopeptide repeat-containing prot 0.990 0.537 0.771 0.0
359474892 1115 PREDICTED: pentatricopeptide repeat-cont 0.982 0.539 0.764 0.0
297744686 1550 unnamed protein product [Vitis vinifera] 0.982 0.388 0.764 0.0
224080562665 predicted protein [Populus trichocarpa] 0.908 0.837 0.782 0.0
356529805 1092 PREDICTED: pentatricopeptide repeat-cont 0.926 0.520 0.737 0.0
449458656 1108 PREDICTED: pentatricopeptide repeat-cont 0.983 0.544 0.706 0.0
145353124 1089 pentatricopeptide repeat-containing prot 0.982 0.552 0.697 0.0
110740372 1089 hypothetical protein [Arabidopsis thalia 0.982 0.552 0.697 0.0
110741791 1089 hypothetical protein [Arabidopsis thalia 0.982 0.552 0.697 0.0
357473771 1173 Pentatricopeptide repeat-containing prot 0.926 0.484 0.730 0.0
>gi|255586885|ref|XP_002534048.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525928|gb|EEF28334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/607 (77%), Positives = 536/607 (88%)

Query: 1    MQDGGKNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMD 60
            +QD   N+ +FPYPNG H+      +EQ+H YNRL+R GR++EC+DLLEDMER+GLLDM 
Sbjct: 415  IQDEHTNLPEFPYPNGVHSTNKDHKAEQVHGYNRLLRDGRLAECVDLLEDMERRGLLDMS 474

Query: 61   KVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQE 120
            K+YHA+FF +CK QKA+KEAFRF KLVPNP+LSTFNMLMSVC+SS+DS+GAF+VLRL Q 
Sbjct: 475  KIYHAKFFKICKIQKAVKEAFRFCKLVPNPSLSTFNMLMSVCSSSQDSDGAFEVLRLAQG 534

Query: 121  AGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAK 180
            AGLKADCKLYTTLI+TCAKSGKVDAMFEVFHEMVNAG+EPNVHTYG+LIDGCAKAGQ+AK
Sbjct: 535  AGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEPNVHTYGSLIDGCAKAGQMAK 594

Query: 181  AFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGAL 240
            AFGAYGI+RSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEM AE HP+DPDHIT+GAL
Sbjct: 595  AFGAYGILRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMGAETHPIDPDHITVGAL 654

Query: 241  MKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGV 300
            MKACA AGQVDRA+EVY M+HKYNIKGTPEVYTIA+N CSQTGDWEFA SVYDDMT+KGV
Sbjct: 655  MKACAKAGQVDRAKEVYNMLHKYNIKGTPEVYTIAVNFCSQTGDWEFARSVYDDMTRKGV 714

Query: 301  IPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALE 360
             PDE+FLSAL+D AGHAG V+ AFE LQEA+ QG  +GI+ YSSLMGACSNAKNWQKALE
Sbjct: 715  APDEMFLSALVDVAGHAGLVDIAFETLQEARTQGTQLGIVPYSSLMGACSNAKNWQKALE 774

Query: 361  LYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACE 420
            LYE +K+IKLKPTVSTMNAL+TALCDGDQL K +E LS+MKS GLCPN +TYSILLVA E
Sbjct: 775  LYEDIKAIKLKPTVSTMNALMTALCDGDQLQKALETLSEMKSFGLCPNIVTYSILLVASE 834

Query: 421  RKDDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIEN 480
            RKDD++ G MLLSQAKED + P  +M+KCIIGMC RRY+KA +L E +LSF+SGRPQI+N
Sbjct: 835  RKDDLDAGDMLLSQAKEDCITPTFLMYKCIIGMCLRRYKKACSLGESILSFDSGRPQIKN 894

Query: 481  KWTSLALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNL 540
            +WTS AL VYRE I AG  PT+EVVS+VLGCLQLP +A ++ RLVENLGV+AD  K SNL
Sbjct: 895  EWTSRALTVYRETIAAGEKPTMEVVSQVLGCLQLPCDASLKGRLVENLGVTADPSKFSNL 954

Query: 541  CSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGL 600
            C+L+DGFGEYDPRAFSLLEEAAS G VPC SFKE P+V+DA+ L+ H A+VYLLTILKGL
Sbjct: 955  CALVDGFGEYDPRAFSLLEEAASLGTVPCASFKESPIVMDAKLLQSHIAEVYLLTILKGL 1014

Query: 601  RHRLAAA 607
            +HRLAA 
Sbjct: 1015 KHRLAAG 1021




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359474892|ref|XP_002276432.2| PREDICTED: pentatricopeptide repeat-containing protein At4g34830, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744686|emb|CBI37948.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224080562|ref|XP_002306163.1| predicted protein [Populus trichocarpa] gi|222849127|gb|EEE86674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356529805|ref|XP_003533478.1| PREDICTED: pentatricopeptide repeat-containing protein At4g34830, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449458656|ref|XP_004147063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g34830, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|145353124|ref|NP_195209.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635623|sp|Q0WLC6.2|PP349_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g34830, chloroplastic; Flags: Precursor gi|332661026|gb|AEE86426.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110740372|dbj|BAF02081.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110741791|dbj|BAE98839.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357473771|ref|XP_003607170.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508225|gb|AES89367.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query613
TAIR|locus:2116915 1089 MRL1 "MATURATION OF RBCL 1" [A 0.980 0.551 0.698 4.6e-231
TAIR|locus:2084978602 AT3G04760 [Arabidopsis thalian 0.769 0.784 0.261 1.1e-36
TAIR|locus:2155730915 AT5G65560 "AT5G65560" [Arabido 0.654 0.438 0.294 6.3e-35
TAIR|locus:2163041527 AT5G41170 [Arabidopsis thalian 0.663 0.772 0.278 7.4e-35
TAIR|locus:2174165504 AT5G16640 [Arabidopsis thalian 0.597 0.726 0.280 1.2e-34
TAIR|locus:2203916634 AT1G62590 [Arabidopsis thalian 0.680 0.657 0.252 6.9e-34
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.663 0.646 0.253 1.2e-33
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.696 0.571 0.264 5.5e-33
TAIR|locus:2053552627 AT2G15630 "AT2G15630" [Arabido 0.743 0.727 0.244 7.6e-33
TAIR|locus:2034760637 AT1G12300 [Arabidopsis thalian 0.662 0.637 0.251 1.1e-32
TAIR|locus:2116915 MRL1 "MATURATION OF RBCL 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2229 (789.7 bits), Expect = 4.6e-231, P = 4.6e-231
 Identities = 420/601 (69%), Positives = 505/601 (84%)

Query:     6 KNMLQFPYPNGKHANYAHDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHA 65
             ++M QFP  N +  N      E   +YNRL+R GRI +CI LLED++++ LLDMDK+YHA
Sbjct:   381 ESMPQFPARNFELHNSNGRSPETSDAYNRLLRDGRIKDCISLLEDLDQRDLLDMDKIYHA 440

Query:    66 RFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKA 125
              FF  CK Q+A+KEAFRF KL+ NPT+STFNMLMSVCASS+D EGA  VLRLVQE+G+ A
Sbjct:   441 SFFKACKKQRAVKEAFRFTKLILNPTMSTFNMLMSVCASSQDIEGARGVLRLVQESGMTA 500

Query:   126 DCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAY 185
             DCKLYTTLI++CAKSGKVDAMFEVFH+M N+G+E N+HT+GALIDGCA+AGQVAKAFGAY
Sbjct:   501 DCKLYTTLISSCAKSGKVDAMFEVFHQMSNSGVEANLHTFGALIDGCARAGQVAKAFGAY 560

Query:   186 GIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACA 245
             GI+RSKNVKPDRVVFNALI+ACGQSGAVDRAFDVLAEM AE HP+DPDHI+IGALMKAC 
Sbjct:   561 GILRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHISIGALMKACC 620

Query:   246 NAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEV 305
             NAGQV+RA+EVY+MIHKY I+GTPEVYTIA+N CS++GDW+FACS+Y DM +K V PDEV
Sbjct:   621 NAGQVERAKEVYQMIHKYGIRGTPEVYTIAVNSCSKSGDWDFACSIYKDMKEKDVTPDEV 680

Query:   306 FLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHM 365
             F SALID AGHA  ++ AF ILQ+AK+QGI +G ISYSSLMGAC NAK+W+KALELYE +
Sbjct:   681 FFSALIDVAGHAKMLDEAFGILQDAKSQGIRLGTISYSSLMGACCNAKDWKKALELYEKI 740

Query:   366 KSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDV 425
             KSIKL+PT+STMNALITALC+G+QLPK ME L ++K+LGL PNTITYS+L++A ERKDD 
Sbjct:   741 KSIKLRPTISTMNALITALCEGNQLPKAMEYLDEIKTLGLKPNTITYSMLMLASERKDDF 800

Query:   426 EVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSL 485
             EV   LLSQAK DGV PNL+M +CI  +C RR+EKA    E V+SF SGRPQIENKWTS+
Sbjct:   801 EVSFKLLSQAKGDGVSPNLIMCRCITSLCKRRFEKACAGGEPVVSFKSGRPQIENKWTSM 860

Query:   486 ALMVYREAIVAGTIPTVEVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLID 545
             ALMVYRE I  GT+PT EVVS+VLGCLQLP++A +R+RL+  LG++  + K+ N+  L+D
Sbjct:   861 ALMVYRETISGGTVPTTEVVSQVLGCLQLPHDAALRDRLISTLGINISSQKQHNIFPLVD 920

Query:   546 GFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLA 605
             GFGEYDPRAFSLLEEA S G++P VSF +IP+  D  +L  + A+VYLLTI KGL+HRLA
Sbjct:   921 GFGEYDPRAFSLLEEATSLGVLPSVSFNKIPLFFDTTELPKNVAEVYLLTIFKGLKHRLA 980

Query:   606 A 606
             A
Sbjct:   981 A 981




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0048255 "mRNA stabilization" evidence=IMP
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
TAIR|locus:2084978 AT3G04760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155730 AT5G65560 "AT5G65560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163041 AT5G41170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174165 AT5G16640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203916 AT1G62590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053552 AT2G15630 "AT2G15630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034760 AT1G12300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.0
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-13
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-12
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-11
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-11
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-10
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-09
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 9e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 1143 bits (2958), Expect = 0.0
 Identities = 457/583 (78%), Positives = 526/583 (90%)

Query: 24  DVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRF 83
              E + +YNRL+R GRI +CIDLLEDME++GLLDMDK+YHA+FF  CK Q+A+KEAFRF
Sbjct: 369 KSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRF 428

Query: 84  FKLVPNPTLSTFNMLMSVCASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKV 143
            KL+ NPTLSTFNMLMSVCASS+D +GA +VLRLVQEAGLKADCKLYTTLI+TCAKSGKV
Sbjct: 429 AKLIRNPTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKV 488

Query: 144 DAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNAL 203
           DAMFEVFHEMVNAG+E NVHT+GALIDGCA+AGQVAKAFGAYGIMRSKNVKPDRVVFNAL
Sbjct: 489 DAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNAL 548

Query: 204 ITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKY 263
           I+ACGQSGAVDRAFDVLAEM AE HP+DPDHIT+GALMKACANAGQVDRA+EVY+MIH+Y
Sbjct: 549 ISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEY 608

Query: 264 NIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAA 323
           NIKGTPEVYTIA+N CSQ GDW+FA S+YDDM KKGV PDEVF SAL+D AGHAG ++ A
Sbjct: 609 NIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKA 668

Query: 324 FEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITA 383
           FEILQ+A+ QGI +G +SYSSLMGACSNAKNW+KALELYE +KSIKL+PTVSTMNALITA
Sbjct: 669 FEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITA 728

Query: 384 LCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERKDDVEVGLMLLSQAKEDGVIPN 443
           LC+G+QLPK +EVLS+MK LGLCPNTITYSILLVA ERKDD +VGL LLSQAKEDG+ PN
Sbjct: 729 LCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPN 788

Query: 444 LVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTVE 503
           LVM +CI G+C RR+EKA  L E V+SF+SGRPQIENKWTS ALMVYRE I AGT+PT+E
Sbjct: 789 LVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGTLPTME 848

Query: 504 VVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAAS 563
           V+S+VLGCLQLP++A +R RL+ENLG+SAD+ K+SNL +L+DGFGEYDPRAFSLLEEAAS
Sbjct: 849 VLSQVLGCLQLPHDATLRNRLIENLGISADSQKQSNLSTLVDGFGEYDPRAFSLLEEAAS 908

Query: 564 FGIVPCVSFKEIPVVVDARKLEIHTAKVYLLTILKGLRHRLAA 606
            G+VP VSFK+ P+V+DA +L +  A+VYLLTILKGL+HRLAA
Sbjct: 909 LGVVPSVSFKKSPIVIDAEELPVFAAEVYLLTILKGLKHRLAA 951


Length = 1060

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 613
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.87
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.86
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.85
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.73
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.72
PRK14574 822 hmsH outer membrane protein; Provisional 99.71
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.67
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
KOG2003840 consensus TPR repeat-containing protein [General f 99.65
KOG2076 895 consensus RNA polymerase III transcription factor 99.6
KOG1915677 consensus Cell cycle control protein (crooked neck 99.58
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.56
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.54
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.53
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.5
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.49
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.48
KOG2003840 consensus TPR repeat-containing protein [General f 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.43
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.42
KOG1915677 consensus Cell cycle control protein (crooked neck 99.42
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.41
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.37
KOG0547606 consensus Translocase of outer mitochondrial membr 99.36
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
PF1304150 PPR_2: PPR repeat family 99.32
PF1304150 PPR_2: PPR repeat family 99.31
PRK12370553 invasion protein regulator; Provisional 99.29
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.28
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
PRK12370553 invasion protein regulator; Provisional 99.26
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.24
KOG2376652 consensus Signal recognition particle, subunit Srp 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.18
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.17
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.14
KOG1129478 consensus TPR repeat-containing protein [General f 99.13
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.13
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.12
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.1
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.08
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.08
KOG0547606 consensus Translocase of outer mitochondrial membr 99.07
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.01
PRK11189296 lipoprotein NlpI; Provisional 98.99
PRK11189296 lipoprotein NlpI; Provisional 98.96
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.96
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.92
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.91
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.9
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.89
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.87
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.85
PRK04841903 transcriptional regulator MalT; Provisional 98.81
KOG2376652 consensus Signal recognition particle, subunit Srp 98.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.71
PF1285434 PPR_1: PPR repeat 98.69
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.69
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.69
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.66
PF1285434 PPR_1: PPR repeat 98.65
PRK04841903 transcriptional regulator MalT; Provisional 98.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.64
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.61
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.57
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.54
PLN02789320 farnesyltranstransferase 98.53
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.52
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.5
KOG1128777 consensus Uncharacterized conserved protein, conta 98.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.48
KOG1125579 consensus TPR repeat-containing protein [General f 98.45
KOG1128777 consensus Uncharacterized conserved protein, conta 98.45
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.44
PLN02789320 farnesyltranstransferase 98.43
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.42
KOG1125579 consensus TPR repeat-containing protein [General f 98.41
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.39
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.37
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.35
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.35
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.34
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.34
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.3
PRK10370198 formate-dependent nitrite reductase complex subuni 98.29
PRK10370198 formate-dependent nitrite reductase complex subuni 98.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.27
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.27
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.22
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.2
PRK15359144 type III secretion system chaperone protein SscB; 98.19
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.17
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.15
PRK15359144 type III secretion system chaperone protein SscB; 98.14
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.12
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.11
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.1
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.08
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.01
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.98
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.94
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.91
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.87
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.83
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.73
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.73
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.7
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.7
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.65
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.64
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.63
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.56
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.53
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.5
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.47
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.38
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.38
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.34
KOG20411189 consensus WD40 repeat protein [General function pr 97.34
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.27
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.26
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.14
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.14
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.14
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.11
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.08
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.02
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.01
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.0
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.94
KOG20411189 consensus WD40 repeat protein [General function pr 96.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.92
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.9
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.8
PF12688120 TPR_5: Tetratrico peptide repeat 96.78
KOG0553304 consensus TPR repeat-containing protein [General f 96.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.74
PF12688120 TPR_5: Tetratrico peptide repeat 96.73
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.68
KOG0553304 consensus TPR repeat-containing protein [General f 96.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.49
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.46
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.41
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.37
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.37
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.35
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.33
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.26
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.25
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.2
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.19
PRK10803263 tol-pal system protein YbgF; Provisional 96.16
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.13
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.09
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.04
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.96
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.96
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.94
PRK15331165 chaperone protein SicA; Provisional 95.89
PRK10803263 tol-pal system protein YbgF; Provisional 95.87
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.77
PF1337173 TPR_9: Tetratricopeptide repeat 95.68
PF1337173 TPR_9: Tetratricopeptide repeat 95.64
COG4700251 Uncharacterized protein conserved in bacteria cont 95.61
COG4700251 Uncharacterized protein conserved in bacteria cont 95.57
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.43
KOG3941406 consensus Intermediate in Toll signal transduction 95.22
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.05
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.86
COG3898531 Uncharacterized membrane-bound protein [Function u 94.8
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 94.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.62
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.59
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.54
smart00299140 CLH Clathrin heavy chain repeat homology. 94.54
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.53
KOG3941406 consensus Intermediate in Toll signal transduction 94.52
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.47
PRK15331165 chaperone protein SicA; Provisional 94.11
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.07
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.0
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.98
smart00299140 CLH Clathrin heavy chain repeat homology. 93.98
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.97
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.83
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.82
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.58
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.55
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.25
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.22
PRK11906458 transcriptional regulator; Provisional 93.14
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.76
COG3898531 Uncharacterized membrane-bound protein [Function u 92.71
PF13170297 DUF4003: Protein of unknown function (DUF4003) 92.63
PF13512142 TPR_18: Tetratricopeptide repeat 92.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 92.48
COG3629280 DnrI DNA-binding transcriptional activator of the 92.39
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.37
KOG1941518 consensus Acetylcholine receptor-associated protei 91.99
KOG4555175 consensus TPR repeat-containing protein [Function 91.83
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.81
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 91.72
PF13512142 TPR_18: Tetratricopeptide repeat 91.55
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.48
PF1342844 TPR_14: Tetratricopeptide repeat 91.44
COG3629280 DnrI DNA-binding transcriptional activator of the 91.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.01
PRK11906458 transcriptional regulator; Provisional 90.9
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 90.79
KOG1941518 consensus Acetylcholine receptor-associated protei 90.69
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 90.6
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.47
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.38
PF1342844 TPR_14: Tetratricopeptide repeat 90.07
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.98
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.86
KOG4555175 consensus TPR repeat-containing protein [Function 89.81
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.59
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 89.56
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.37
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.0
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.76
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.54
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 88.17
KOG1585308 consensus Protein required for fusion of vesicles 87.6
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 87.5
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 87.49
PRK09687280 putative lyase; Provisional 86.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.53
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.36
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.97
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.71
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 85.61
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 85.56
KOG1586288 consensus Protein required for fusion of vesicles 85.2
PF1343134 TPR_17: Tetratricopeptide repeat 84.79
COG4105254 ComL DNA uptake lipoprotein [General function pred 84.78
KOG4570418 consensus Uncharacterized conserved protein [Funct 84.15
COG0457291 NrfG FOG: TPR repeat [General function prediction 84.02
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.16
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 83.14
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.76
KOG4570418 consensus Uncharacterized conserved protein [Funct 82.52
KOG1550552 consensus Extracellular protein SEL-1 and related 82.22
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.74
PF13929292 mRNA_stabil: mRNA stabilisation 81.58
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.31
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 81.1
PF1343134 TPR_17: Tetratricopeptide repeat 81.07
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 81.04
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 80.91
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.57
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.24
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.07
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-91  Score=759.00  Aligned_cols=585  Identities=78%  Similarity=1.252  Sum_probs=569.3

Q ss_pred             cchhhhHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCchHHHHHHHHHHHhhhHHHHHHHHHHHhCCCCCHHHHHHHHHHH
Q 007193           23 HDVSEQLHSYNRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVPNPTLSTFNMLMSVC  102 (613)
Q Consensus        23 ~~~~~~~~~~~~l~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~li~~~  102 (613)
                      .+...+...|+.|++.|++++|+++|++|.+.|+++++..++..++..|.+.|.+++|+++|+.|+.||..+||.++++|
T Consensus       368 ~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~pd~~Tyn~LL~a~  447 (1060)
T PLN03218        368 RKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRNPTLSTFNMLMSVC  447 (1060)
T ss_pred             CCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCCCCHHHHHHHHHHH
Confidence            45788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 007193          103 ASSKDSEGAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAF  182 (613)
Q Consensus       103 ~~~~~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~  182 (613)
                      ++.|+++.|.++|+.|.+.|+.||..+|++||.+|++.|++++|.++|++|.+.|+.||..+|++||.+|++.|++++|.
T Consensus       448 ~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~eeAl  527 (1060)
T PLN03218        448 ASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAF  527 (1060)
T ss_pred             HhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHh
Q 007193          183 GAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHK  262 (613)
Q Consensus       183 ~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~  262 (613)
                      ++|++|.+.|+.||..+|+.||.+|++.|++++|.++|++|.....++.||..+|++++.+|++.|++++|.++|+.|.+
T Consensus       528 ~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~~M~e  607 (1060)
T PLN03218        528 GAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHE  607 (1060)
T ss_pred             HHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999875567899999999999999999999999999999999


Q ss_pred             cCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCcCHHhH
Q 007193          263 YNIKGTPEVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISY  342 (613)
Q Consensus       263 ~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~  342 (613)
                      .++.|+..+|+++|.+|++.|++++|.++|++|.+.|+.||..+|+++|.+|++.|++++|.++|+.|.+.|+.||..+|
T Consensus       608 ~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd~~ty  687 (1060)
T PLN03218        608 YNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLGTVSY  687 (1060)
T ss_pred             cCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHhhc
Q 007193          343 SSLMGACSNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCPNTITYSILLVACERK  422 (613)
Q Consensus       343 ~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~  422 (613)
                      ++||.+|+++|++++|.++|++|.+.|+.||..+||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++.
T Consensus       688 nsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~  767 (1060)
T PLN03218        688 SSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERK  767 (1060)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhhHHHHHHhhhhhhcccCCCcccchhhhHHHHHHHHHHHHcCCCCcH
Q 007193          423 DDVEVGLMLLSQAKEDGVIPNLVMFKCIIGMCSRRYEKARTLNEHVLSFNSGRPQIENKWTSLALMVYREAIVAGTIPTV  502 (613)
Q Consensus       423 g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~m~~~g~~p~~  502 (613)
                      |++++|.++|++|.+.|+.||..+|++++++|.++|++|+.+.+....|+.+.+.....|+.+|+.+|++|++.|+.||.
T Consensus       768 G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi~Pd~  847 (1060)
T PLN03218        768 DDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGEPVVSFDSGRPQIENKWTSWALMVYRETISAGTLPTM  847 (1060)
T ss_pred             CCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhhhhhhhhccccccccchHHHHHHHHHHHHHCCCCCCH
Confidence            99999999999999999999999999999998888999999999999999988888889999999999999999999999


Q ss_pred             HHHHHHHhccCCCCchhHHhhHHHhhCCChhhhhcccccccccccccchhHHHHHHHHHHhCCCCCcccccCCceeeccc
Q 007193          503 EVVSKVLGCLQLPYNADIRERLVENLGVSADALKRSNLCSLIDGFGEYDPRAFSLLEEAASFGIVPCVSFKEIPVVVDAR  582 (613)
Q Consensus       503 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~g~~~~~a~~~~~~a~~~g~~p~~~~~~~~~~~~~~  582 (613)
                      +||..+++|+....+...+..|.+.+++.|...+|..++++|+++|...++|+.++++|.+.|++|+..+....+++|+|
T Consensus       848 ~T~~~vL~cl~~~~~~~~~~~m~~~m~~~~~~~~~~~y~~Li~g~~~~~~~A~~l~~em~~~Gi~p~~~~~~~~~~~d~~  927 (1060)
T PLN03218        848 EVLSQVLGCLQLPHDATLRNRLIENLGISADSQKQSNLSTLVDGFGEYDPRAFSLLEEAASLGVVPSVSFKKSPIVIDAE  927 (1060)
T ss_pred             HHHHHHHHHhcccccHHHHHHHHHHhccCCCCcchhhhHHHHHhhccChHHHHHHHHHHHHcCCCCCcccccCceEEEcc
Confidence            99999999998888888999999999999999999999999999998778999999999999999999888889999999


Q ss_pred             cCcchHHHHHHHHHHHHHHHhhHhh
Q 007193          583 KLEIHTAKVYLLTILKGLRHRLAAA  607 (613)
Q Consensus       583 ~~~~~~~~~~~~~~~~~~~~~~~~~  607 (613)
                      ++++++|++++|+||+++++++++|
T Consensus       928 ~~~~~aa~~~l~~wl~~~~~~~~~g  952 (1060)
T PLN03218        928 ELPVFAAEVYLLTILKGLKHRLAAG  952 (1060)
T ss_pred             cCcchhHHHHHHHHHHHHHHHHhcc
Confidence            9999999999999999999999998



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query613
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 82.2 bits (201), Expect = 2e-16
 Identities = 26/209 (12%), Positives = 56/209 (26%), Gaps = 2/209 (0%)

Query: 160 PNVHTYGALIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITACGQSGAVDRAFDV 219
           P       L+        +       G      +   +    A    C  +  +  A  +
Sbjct: 90  PWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHL 149

Query: 220 LAEM-NAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINC 278
           L                   A+M   A  G       V  M+    +      Y  A+ C
Sbjct: 150 LVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQC 209

Query: 279 CSQTGDWEFACSVY-DDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISV 337
             +            + M+++G+    +F + L+     A  ++A  ++           
Sbjct: 210 MGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLP 269

Query: 338 GIISYSSLMGACSNAKNWQKALELYEHMK 366
             ++ S L+             +L+  +K
Sbjct: 270 PPVNTSKLLRDVYAKDGRVSYPKLHLPLK 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.89
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.73
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.68
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.68
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.68
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.66
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.58
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.51
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.49
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.48
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.36
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.36
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.32
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.3
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.29
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.22
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.2
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.2
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.16
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.12
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.08
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.07
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.06
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.01
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.99
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.92
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.92
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.9
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.85
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.85
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.84
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.81
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.75
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.73
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.73
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.69
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.65
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.63
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.58
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.54
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.53
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.51
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.46
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.44
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.44
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.43
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.42
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.4
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.36
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.35
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.35
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.34
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.34
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.34
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.33
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.33
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.28
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.27
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.24
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.23
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.2
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.18
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.15
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.14
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.12
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.1
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.03
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.03
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.99
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.96
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.95
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.94
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.94
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.93
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.92
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.9
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.82
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.81
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.81
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.71
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.7
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.68
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.61
3k9i_A117 BH0479 protein; putative protein binding protein, 97.61
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.6
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.57
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.53
3k9i_A117 BH0479 protein; putative protein binding protein, 97.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.45
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.36
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.28
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.28
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.28
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.24
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.24
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.18
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.14
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.05
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.0
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.0
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.9
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.83
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.64
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.56
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.56
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.9
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.72
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.65
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.63
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.54
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.4
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.36
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.33
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.96
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.95
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.72
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.51
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.08
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.94
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.84
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.62
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.98
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.8
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.79
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.94
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.94
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 91.17
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.49
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 90.01
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.73
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.69
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.18
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 86.55
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 86.04
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 84.91
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 83.77
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.43
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 83.13
2p58_C116 Putative type III secretion protein YSCG; type III 82.91
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 81.41
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.58
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.2e-35  Score=319.63  Aligned_cols=416  Identities=8%  Similarity=-0.045  Sum_probs=358.1

Q ss_pred             hhHHHHHHHH----hcCCHHHHHHHHHHHHHcCCCCchHHHHHHHHHHHhhhHHHHHHHHHHHhC--CCCCHHHHHHHHH
Q 007193           27 EQLHSYNRLI----RQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLV--PNPTLSTFNMLMS  100 (613)
Q Consensus        27 ~~~~~~~~l~----~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~--~~~~~~~~~~li~  100 (613)
                      ++...|+.++    +.|++++|+.+|++|....  |.. .....++..+...|++++|..+|+++  .++++.+++.++.
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~--p~~-~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~  158 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDIT--GNP-NDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAF  158 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH--CCH-HHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhhC--CCc-hHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHH
Confidence            4556666555    7899999999999999765  444 44556888899999999999999998  4789999999999


Q ss_pred             HHHcCCChHHHHHHHHHHH-Hc--------------CCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCCHHHH
Q 007193          101 VCASSKDSEGAFQVLRLVQ-EA--------------GLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTY  165 (613)
Q Consensus       101 ~~~~~~~~~~A~~~~~~m~-~~--------------g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~  165 (613)
                      .|.+.|++++|..+|+++. ..              +.+++..+|+.++.+|.+.|++++|.++|++|.+.+ +.+...+
T Consensus       159 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~  237 (597)
T 2xpi_A          159 CLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-AKCYEAF  237 (597)
T ss_dssp             HHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHH
T ss_pred             HHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-chhhHHH
Confidence            9999999999999998532 11              223458899999999999999999999999998764 2233333


Q ss_pred             HH--------------------------------------HHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHH
Q 007193          166 GA--------------------------------------LIDGCAKAGQVAKAFGAYGIMRSKNVKPDRVVFNALITAC  207 (613)
Q Consensus       166 ~~--------------------------------------li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~li~~~  207 (613)
                      ..                                      ++..|.+.|++++|.++|+++.+.  +++..+|+.++.+|
T Consensus       238 ~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~  315 (597)
T 2xpi_A          238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTL  315 (597)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHH
Confidence            33                                      355667889999999999999875  68999999999999


Q ss_pred             HccCCHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHhcCCHHH
Q 007193          208 GQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTPEVYTIAINCCSQTGDWEF  287 (613)
Q Consensus       208 ~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~  287 (613)
                      .+.|++++|.++|+++....   +.+..++..++.+|.+.|++++|..+|+++.+.. +.+..+|+.++..|.+.|++++
T Consensus       316 ~~~g~~~~A~~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~  391 (597)
T 2xpi_A          316 FVRSRFIDVLAITTKILEID---PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISE  391 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHC---TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHH
T ss_pred             HHhcCHHHHHHHHHHHHHcC---cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHH
Confidence            99999999999999998642   3467789999999999999999999999998765 6678999999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCcCHHhHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 007193          288 ACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGACSNAKNWQKALELYEHMKS  367 (613)
Q Consensus       288 a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~  367 (613)
                      |.++|+++.+.... +..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+++.++.+|.+.|++++|.++|+++.+
T Consensus       392 A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  469 (597)
T 2xpi_A          392 ARRYFSKSSTMDPQ-FGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYA  469 (597)
T ss_dssp             HHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            99999999886433 68899999999999999999999999999875 56889999999999999999999999999987


Q ss_pred             CCCCCCHHHHHHHHHHHHcCCChhHHHHHHHHHHhC----CCCCC--HHHHHHHHHHHhhcCCHHHHHHHHHHHHHcCCC
Q 007193          368 IKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSL----GLCPN--TITYSILLVACERKDDVEVGLMLLSQAKEDGVI  441 (613)
Q Consensus       368 ~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~----g~~p~--~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~g~~  441 (613)
                      .. +.+..+|+.++..|.+.|++++|+++|+++.+.    +..|+  ..+|..+..+|.+.|++++|.++++++.+.+ .
T Consensus       470 ~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p  547 (597)
T 2xpi_A          470 LF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-T  547 (597)
T ss_dssp             HC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-S
T ss_pred             hC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-C
Confidence            64 457899999999999999999999999999875    66887  7899999999999999999999999999754 3


Q ss_pred             CCHHHHHHHHHHHHh
Q 007193          442 PNLVMFKCIIGMCSR  456 (613)
Q Consensus       442 p~~~~~~~li~~~~~  456 (613)
                      .+..+|..+..+|.+
T Consensus       548 ~~~~~~~~l~~~~~~  562 (597)
T 2xpi_A          548 NDANVHTAIALVYLH  562 (597)
T ss_dssp             CCHHHHHHHHHHHHH
T ss_pred             CChHHHHHHHHHHHH
Confidence            477888888887654



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query613
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.07
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.02
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.02
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.99
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.81
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.46
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.22
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.15
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.11
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.06
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.06
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.04
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.03
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.9
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.84
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.74
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.59
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.49
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.31
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.29
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.24
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.23
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.15
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.14
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.08
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.04
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.11
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.28
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.08
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.62
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.07
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.16
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.35
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 83.33
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.91  E-value=3.7e-20  Score=184.33  Aligned_cols=378  Identities=13%  Similarity=0.049  Sum_probs=267.8

Q ss_pred             HHHHhcCCHHHHHHHHHHHHHcCCCCchHHHHHHHHHHHhhhHHHHHHHHHHHhCC---CCCHHHHHHHHHHHHcCCChH
Q 007193           33 NRLIRQGRISECIDLLEDMERKGLLDMDKVYHARFFNVCKSQKAIKEAFRFFKLVP---NPTLSTFNMLMSVCASSKDSE  109 (613)
Q Consensus        33 ~~l~~~g~~~~A~~l~~~m~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~~~~~  109 (613)
                      +...+.|++++|++.|+++.+..  |.+......++.++...|++++|...|+++.   +.+..+|..+...+.+.|+++
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~--p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~   84 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQE--PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQ   84 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccc
Confidence            45568899999999999988876  6666667777777777888888888887653   445677778888888888888


Q ss_pred             HHHHHHHHHHHcCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH
Q 007193          110 GAFQVLRLVQEAGLKADCKLYTTLITTCAKSGKVDAMFEVFHEMVNAGIEPNVHTYGALIDGCAKAGQVAKAFGAYGIMR  189 (613)
Q Consensus       110 ~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  189 (613)
                      +|...+....+.. +.+..............+....+........... .................+....+...+....
T Consensus        85 ~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (388)
T d1w3ba_          85 EAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             ccccccccccccc-cccccccccccccccccccccccccccccccccc-cccccccccccccccccchhhhhHHHHHHhh
Confidence            8888888877765 4445555555555556666666665555554433 3344455555566667777777777777666


Q ss_pred             hCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHhhCCCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHhcCCCCCH
Q 007193          190 SKNVKPDRVVFNALITACGQSGAVDRAFDVLAEMNAEVHPVDPDHITIGALMKACANAGQVDRAREVYKMIHKYNIKGTP  269 (613)
Q Consensus       190 ~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~  269 (613)
                      ... +-+...+..+...+...|+.++|...+.+.....   +.+...+..+...+...|++++|...++.....+ +.+.
T Consensus       163 ~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~---p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~  237 (388)
T d1w3ba_         163 ETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD---PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHA  237 (388)
T ss_dssp             HHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC---TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCH
T ss_pred             ccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC---cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHH
Confidence            542 3345666677777778888888888887776531   3345667777777888888888888887777765 4556


Q ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCcCHHhHHHHHHHH
Q 007193          270 EVYTIAINCCSQTGDWEFACSVYDDMTKKGVIPDEVFLSALIDFAGHAGKVEAAFEILQEAKNQGISVGIISYSSLMGAC  349 (613)
Q Consensus       270 ~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~  349 (613)
                      ..+..+...+.+.|++++|+..|++..+..+. +..++..+...+...|++++|...+....... +.+...+..+...+
T Consensus       238 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~  315 (388)
T d1w3ba_         238 VVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANIK  315 (388)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSS-CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHHH
Confidence            67777777888888888888888887776443 56677777777888888888888887776654 55667777777778


Q ss_pred             HhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHcCCChhHHHHHHHHHHhCCCCC-CHHHHHHHHHHHhhcCC
Q 007193          350 SNAKNWQKALELYEHMKSIKLKPTVSTMNALITALCDGDQLPKTMEVLSDMKSLGLCP-NTITYSILLVACERKDD  424 (613)
Q Consensus       350 ~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p-~~~t~~~ll~a~~~~g~  424 (613)
                      .+.|++++|...|++..+.. +.+..+|..+...|.+.|++++|++.|++..+  +.| +...|..+..++.+.||
T Consensus       316 ~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         316 REQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            88888888888888776643 23466777777778888888888888877776  355 35567777777666654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure