Citrus Sinensis ID: 007468

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
MGKKNKKAGKGKEKTERKTAKAEEKRARRETKKISPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEEFDANEKDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVLAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASESEWVEASEGEDEDDDEDDSEDEGNGGSSSDETGDDDDDDEEDAEARDGDAGSLQMGDAVAIIKGEGKNVRRKEKRARIEQIRANLGLSDSQRTPMENP
cccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccEEEEEEEccccccccccccEEEEccccccEEEEEccccccccccEEcccEEEEEccccEEEEEcccccccccccEEEEEEccEEEEEcccccccccccccccccEEEEEcccccEEEEccccccccccccEEEEEccEEEEEccccccccccEEccEEEEEEccccEEEEEccccccccccccccccEEEEccEEEEEccccccccccccccccccccccEEEEEccccEEEEEEccccccccccccEEEEEccEEEEEcccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEccEEEEEcccccccccccccccEEEEEcccccEEEEEEccccccHHHccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccc
cccHccHccccHHHHHHHHHHHHHHHHHHHccccccHHcHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEccccccEEEEEEEEEcccccEEEEcEEEEEEccccEEEEEccccccccccccEEEEEccEEEEEEccccccccccEEEcccEEEEcccccEEEEEccccccccccccEEEEEccEEEEEEcccccccccEEEccEEEEEccccEEEEEcccccccccccccccEEEEEccEEEEEEcccccccccccccccccEcccEEEEcccccEEEEEccccccccccccEEEEEEccEEEEEEcccccccccccccccccccEEEEcccccEEEEEEccccccccccccccEEccccEEEEccccccccHcHcccccccccHHHHHHHcccccccccccccccccEEEEccccccccccccccccccccccHcccccccccccccccEEEEEccEEEEEEcEEEccccEEEccccEEEcHcccccEEEEEcccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccc
mgkknkkagkgkektERKTAKAEEKRARRetkkispeddIDAILLSIQKEEakkkevhvednvpapsprsncslninplkeTELILyggefyngnktyvygdlyrydvekqewkvisspnsppprsahqavsWKNYLYIfggeftspnqerfhhykdfwmLDLKTNQWEqlnlkgcpsprsghrmvlyKHKIIVFGGFYDTLrevryyndlyvfdldqfkwqeikprfgsmwpsprsgfqffvYQDEVFLYggyskevstdknqsekgiihsdlwsldprtwewskvkkigmppgpragfsmcVHKKRALLFGGVVDMEMKGDVIMSLFLNELygfqldnhrwyplelrkekstkdklkksseqkpnssalheklnpieaeefdanekdenaeyyeeademesnidnlsecvpnsvivddgvlaaksggkpyeskkksDMQKSLLpeivkpcgrinscmvvgkDTLYVYggmmeindqeitlddlyslnlskldewkciipasesewveasegededddeddsedegnggsssdetgddddddeedaeardgdagslqMGDAVAIIKGEGKNVRRKEKRARIEQIRANlglsdsqrtpmenp
mgkknkkagkgkekterktakaeekrarretkkispeddidAILLSIQKeeakkkevhvednvpapsprsncslniNPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVIsspnsppprsaHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEvstdknqsekgiihsdlwsldprTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRkekstkdklkksseqkpnssalheklnpieaeefdanekDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVLAAksggkpyeskkksdmqKSLLPEivkpcgrinscmvVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIpasesewveasegededddeddsedegnggsssdetgdddddDEEDAEardgdagslqmgdavaiikgegknvrrkekrARIEQiranlglsdsqrtpmenp
MgkknkkagkgkekterktakaeekrarretkkISPEDDIDAILLSIQkeeakkkevhveDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRkekstkdklkkssEQKPNSSALHEKLNPIEAEEFDAnekdenaeyyeeademeSNIDNLSECVPNSVIVDDGVLAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASESEWVeasegededddeddsedegnggsssdetgddddddeedaeardgdagsLQMGDAVAIIKGEGKNVRRKEKRARIEQIRANLGLSDSQRTPMENP
*************************************************************************LNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVI*************AVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEV********KGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLEL**************************************************************CVPNSVIVDDGVL*********************LPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPA****************************************************************************************************
***************************************IDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWY*****************************KLNPIEAEEFDANEKDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVLAAKSGGKPYESKK*************KPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCII***********************************************************************************************RTP****
**********************************SPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKV**************AVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRK*********************HEKLNPIEAEEFDANEKDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVLAAKS**************KSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASES**************************************************SLQMGDAVAIIKGEG*********ARIEQIRANLGLSD*********
**********************************SPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEK*******KSSEQKPNSSALHEKLNPIEAEEFDANEKDENAEYYEEADE***********VPNSV**DD*VLA****************QKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASES*W****************************************************************NVR*KEKRARIEQIRANLGLSDSQRT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKNKKAGKGxxxxxxxxxxxxxxxxxxxxxKISPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEEFxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPNSVIVDDGVLAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASESEWVEASEGEDEDDDEDDSEDEGNGGSSSDETGDDDDDDEEDAEARDGDAGSLQMGDAVAIIKGEGKNVRRKEKRARIEQIRANLGLSDSQRTPMENP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query602 2.2.26 [Sep-21-2011]
Q921I2584 Kelch domain-containing p yes no 0.765 0.789 0.375 3e-87
Q8TBB5520 Kelch domain-containing p yes no 0.792 0.917 0.365 3e-85
Q5R8W1522 Kelch domain-containing p yes no 0.747 0.862 0.372 2e-84
Q08979651 Kelch repeat-containing p yes no 0.714 0.660 0.311 1e-55
P87061 1147 Tip elongation aberrant p yes no 0.377 0.197 0.275 6e-24
O14248 1125 Tip elongation aberrant p no no 0.333 0.178 0.277 3e-21
Q7M3S9 943 RING finger protein B OS= yes no 0.375 0.239 0.270 2e-20
P38853 1164 Kelch repeat-containing p no no 0.373 0.193 0.258 5e-19
Q54C94 1127 Ras guanine nucleotide ex no no 0.420 0.224 0.241 7e-19
P50090 882 Kelch repeat-containing p no no 0.387 0.264 0.253 1e-17
>sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=1 SV=2 Back     alignment and function desciption
 Score =  323 bits (828), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 191/509 (37%), Positives = 281/509 (55%), Gaps = 48/509 (9%)

Query: 13  EKTERKTAKAEEKRARRETKKISPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNC 72
           EKT  K  K   KR+R+E      E+D++A++   Q  +AKK +V  E   P PSPR N 
Sbjct: 15  EKTAAKMEKKVSKRSRKE------EEDLEALIAHFQTLDAKKTQV-TETPCPPPSPRLNA 67

Query: 73  SLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAV- 131
           SL+ +P K+ ELIL+GGE++NG KT++Y +LY Y + K  W  +  P  PP R AHQAV 
Sbjct: 68  SLSAHPEKD-ELILFGGEYFNGQKTFMYNELYIYSIRKDTWTKVDIPGPPPRRCAHQAVV 126

Query: 132 --SWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYK 189
                  L++FGGEF SP+ E+F+HYKD W+L L T  WEQ+   G PS RSGHRMV +K
Sbjct: 127 VPQGGGQLWVFGGEFASPDGEQFYHYKDLWVLHLATKTWEQIRSTGGPSGRSGHRMVAWK 186

Query: 190 HKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVY-QDEV 248
            ++I+FGGF+++ R+  YY+D+Y F LD F+W ++ P      P+PRSG    V  Q  +
Sbjct: 187 RQLILFGGFHESARDYIYYSDVYTFSLDTFQWSKLSPSGAG--PTPRSGCLMAVTPQGSI 244

Query: 249 FLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPR-----TWEWSKVKKIGMPPGPRAGFSMC 303
            +YGGYSK+    K   +KG  HSD++ L P       W W+++   G+ P  R+GFS+ 
Sbjct: 245 AIYGGYSKQ--RVKKDVDKGTQHSDMFLLKPAEGGEGKWAWTRINPSGVKPTARSGFSVA 302

Query: 304 VH-KKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSS 362
           V    + L+FGGV D E +  +  S F ++LY +     RW+  +L+  KS K K ++  
Sbjct: 303 VAPNHQILVFGGVCDEEEEESLEGS-FFSDLYIYDAAKSRWFAAQLKGPKSEKKKRRRGK 361

Query: 363 EQKPNSSALHEKLNPIEAEEFDANEKDENAEYYEEADEMESNIDNLSECVPNSVIVDDGV 422
            + P  +           +E   +   E  E  +E    +  +  + +     V+   G+
Sbjct: 362 AEDPEGTT---------EQETGGSSAPEPLEVIKEVVSEDGTVVTIKQ-----VLTPSGL 407

Query: 423 LAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITL 482
                G +P  S K  D          +PC R N+ + V    LYVYGGM E  D+++TL
Sbjct: 408 -----GVQP--SPKADDSASEASSTGQEPCPRSNAMLAVKHGLLYVYGGMFEAGDRQVTL 460

Query: 483 DDLYSLNLSKLDEWKCII---PASESEWV 508
            DLY L+L K++EWK ++   P S+ EW+
Sbjct: 461 SDLYCLDLHKMEEWKTLVEMDPKSQ-EWL 488

Mus musculus (taxid: 10090)
>sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 Back     alignment and function description
>sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 Back     alignment and function description
>sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 Back     alignment and function description
>sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 Back     alignment and function description
>sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 Back     alignment and function description
>sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
118488318680 unknown [Populus trichocarpa] 0.946 0.838 0.795 0.0
225456767682 PREDICTED: kelch domain-containing prote 0.943 0.832 0.796 0.0
147781765697 hypothetical protein VITISV_027056 [Viti 0.951 0.822 0.782 0.0
255540383681 kelch repeat protein, putative [Ricinus 0.970 0.857 0.767 0.0
356508772661 PREDICTED: kelch domain-containing prote 0.936 0.853 0.748 0.0
356518912660 PREDICTED: kelch domain-containing prote 0.936 0.854 0.735 0.0
449440586668 PREDICTED: kelch domain-containing prote 0.931 0.839 0.763 0.0
18423130666 kelch repeat-containing protein [Arabido 0.943 0.852 0.741 0.0
297792335665 kelch repeat-containing protein [Arabido 0.941 0.852 0.747 0.0
38345333679 OSJNBa0081L15.6 [Oryza sativa Japonica G 0.955 0.846 0.678 0.0
>gi|118488318|gb|ABK95978.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/572 (79%), Positives = 510/572 (89%), Gaps = 2/572 (0%)

Query: 28  RRETKKISPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILY 87
           RRETKK+SPEDDIDAILLSIQKEEAKKK+VHVE+NV APSPRSNC+LNINPLK+TELILY
Sbjct: 28  RRETKKLSPEDDIDAILLSIQKEEAKKKDVHVEENVAAPSPRSNCTLNINPLKDTELILY 87

Query: 88  GGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSP 147
           GGEFYNG+KT+VYGDLYRYDVEKQEWK++SSPNSPPPRSAHQAV+WKNYLYIFGGEFTSP
Sbjct: 88  GGEFYNGSKTFVYGDLYRYDVEKQEWKLVSSPNSPPPRSAHQAVAWKNYLYIFGGEFTSP 147

Query: 148 NQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRY 207
           NQERFHHYKDFWMLDLKTNQWEQLN KG PSPRSGHRMVL+KHKII+FGGFYDTLREVRY
Sbjct: 148 NQERFHHYKDFWMLDLKTNQWEQLNFKGSPSPRSGHRMVLHKHKIILFGGFYDTLREVRY 207

Query: 208 YNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEK 267
           YNDL++FDLDQFKWQEIKP+ G+MWPS RSGFQFFVYQDEVFLYGGYSKEVS+DK+ SEK
Sbjct: 208 YNDLHIFDLDQFKWQEIKPKLGAMWPSARSGFQFFVYQDEVFLYGGYSKEVSSDKSISEK 267

Query: 268 GIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMS 327
           GI+HSD+WSLDPRTWEW+KVKK GMPPGPRAGFSMCVHKKRA+LFGGVVDMEM+GDV+MS
Sbjct: 268 GIVHSDMWSLDPRTWEWNKVKKSGMPPGPRAGFSMCVHKKRAMLFGGVVDMEMEGDVMMS 327

Query: 328 LFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEEFDANE 387
           LFLNELYGFQLDN RWYPLELRKEKSTKD+ KKSSEQ+  +S  ++K +    EE   N+
Sbjct: 328 LFLNELYGFQLDNRRWYPLELRKEKSTKDRSKKSSEQR-TTSFDNKKYSNDMGEEPTPND 386

Query: 388 KDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVL-AAKSGGKPYESKKKSDMQKSLLP 446
            DEN EY+EEA+ +ES+ID +S  +   + V DG L AAK  GKP  S+ K  +Q S+L 
Sbjct: 387 PDENLEYHEEAENIESSIDEISHNLTRKITVIDGSLSAAKLDGKPGTSEAKQILQNSVLS 446

Query: 447 EIVKPCGRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASESE 506
           E VKPCGRINSCMVVG+D LY+YGGMMEI DQEITLDDLYSLNLSKLDEWKCIIPASESE
Sbjct: 447 ETVKPCGRINSCMVVGRDMLYIYGGMMEIRDQEITLDDLYSLNLSKLDEWKCIIPASESE 506

Query: 507 WVEASEGEDEDDDEDDSEDEGNGGSSSDETGDDDDDDEEDAEARDGDAGSLQMGDAVAII 566
           WVEASE ED+D+DED S+ EG   S+ +    +DDDD+ D EAR+  +GSLQ+GDAVAII
Sbjct: 507 WVEASEDEDDDEDEDASDGEGGSDSNDETDDGEDDDDDNDVEARNNGSGSLQVGDAVAII 566

Query: 567 KGEGKNVRRKEKRARIEQIRANLGLSDSQRTP 598
           KGE KN+RRKEKRARIEQIRANLGLSD+QRTP
Sbjct: 567 KGEKKNLRRKEKRARIEQIRANLGLSDAQRTP 598

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456767|ref|XP_002276501.1| PREDICTED: kelch domain-containing protein 4 [Vitis vinifera] gi|297733624|emb|CBI14871.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781765|emb|CAN61297.1| hypothetical protein VITISV_027056 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540383|ref|XP_002511256.1| kelch repeat protein, putative [Ricinus communis] gi|223550371|gb|EEF51858.1| kelch repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356508772|ref|XP_003523128.1| PREDICTED: kelch domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356518912|ref|XP_003528120.1| PREDICTED: kelch domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449440586|ref|XP_004138065.1| PREDICTED: kelch domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18423130|ref|NP_568723.1| kelch repeat-containing protein [Arabidopsis thaliana] gi|15724228|gb|AAL06507.1|AF412054_1 AT5g50310/MXI22_1 [Arabidopsis thaliana] gi|332008541|gb|AED95924.1| kelch repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297792335|ref|XP_002864052.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309887|gb|EFH40311.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|38345333|emb|CAE03144.2| OSJNBa0081L15.6 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
TAIR|locus:2177542666 AT5G50310 [Arabidopsis thalian 0.767 0.693 0.722 1.4e-205
MGI|MGI:2384569584 Klhdc4 "kelch domain containin 0.508 0.523 0.408 8.4e-79
ASPGD|ASPL0000047740677 AN2090 [Emericella nidulans (t 0.398 0.354 0.378 6.9e-70
CGD|CAL0001573638 orf19.5009 [Candida albicans ( 0.564 0.532 0.370 1.1e-66
UNIPROTKB|Q5AKW8638 KEL3 "Putative uncharacterized 0.564 0.532 0.370 1.1e-66
SGD|S000006184651 KEL3 "Cytoplasmic protein of u 0.720 0.666 0.307 1.6e-54
POMBASE|SPCC1223.06 1147 tea1 "cell end marker Tea1" [S 0.392 0.205 0.286 4.9e-18
DICTYBASE|DDB_G0268860 943 rngB "Kelch repeat-containing 0.378 0.241 0.261 2.7e-17
DICTYBASE|DDB_G0293006 1127 gefF "Ras guanine nucleotide e 0.345 0.184 0.262 3.6e-16
TAIR|locus:2014400341 ESP "epithiospecifier protein" 0.438 0.774 0.266 5.1e-16
TAIR|locus:2177542 AT5G50310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1843 (653.8 bits), Expect = 1.4e-205, Sum P(2) = 1.4e-205
 Identities = 344/476 (72%), Positives = 390/476 (81%)

Query:    34 ISPEDDIDAILLSIQXXXXXXXXXXXXDNVPAPSPRSNCSLNINPLKETELILYGGEFYN 93
             +SPEDDIDAILL+IQ            +NV APSPRSNCSL INPLKETELILYGGEFYN
Sbjct:    34 LSPEDDIDAILLNIQKEEAKKKEVHVEENVAAPSPRSNCSLTINPLKETELILYGGEFYN 93

Query:    94 GNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFH 153
             G KTYVYGDLYRYDVEKQEWK++SSPNSPPPRS+HQAV+WKNYLYIFGGEFTSPNQERFH
Sbjct:    94 GQKTYVYGDLYRYDVEKQEWKLVSSPNSPPPRSSHQAVAWKNYLYIFGGEFTSPNQERFH 153

Query:   154 HYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYV 213
             HYKDFWMLD+KTNQWEQLNLKGCPSPRSGHRMVLYKHKII+FGGFYDTLREVRYYNDLYV
Sbjct:   154 HYKDFWMLDVKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIIFGGFYDTLREVRYYNDLYV 213

Query:   214 FDLDQFKWQEIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSD 273
             FDLDQ+KWQEIKP+ G+MWP+ RSGFQFFVYQDE+FLYGGYSKEVS++K+ SEKGI+H+D
Sbjct:   214 FDLDQYKWQEIKPKPGAMWPTARSGFQFFVYQDEIFLYGGYSKEVSSEKS-SEKGIVHAD 272

Query:   274 LWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNEL 333
             LWSLDPRTWEW+KVKKIGMPP  RAGFS+CVHKKRALLFGGVVDMEM+GDV+MSLFLNEL
Sbjct:   273 LWSLDPRTWEWNKVKKIGMPPSSRAGFSVCVHKKRALLFGGVVDMEMEGDVMMSLFLNEL 332

Query:   334 YGFQLDNHRWYPLELRXXXXXXXXXXXXXEQKPNSSALHEKLNPIEAEEFDAXXXXXXXX 393
             YGFQLDN RWYP+ELR             E KP +S   ++++  E +E           
Sbjct:   333 YGFQLDNRRWYPIELRKEKSSKDKAKKTLEAKPVASNNDDEMDSTEEDE---------SL 383

Query:   394 XXXXXXXXXSNIDNLSECVPNSVIVDDGVLAAKSGGKPYE-SKKKSDMQKSLLPEIVKPC 452
                       + D +SE +  ++ VD G  + KS  K  + +K + D Q S+  E+VKPC
Sbjct:   384 AMIEQTDGVGSSDGISERMATNLTVD-GNRSDKS--KALQGAKTRLDPQVSVSEEVVKPC 440

Query:   453 GRINSCMVVGKDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASESEWV 508
             GRINSCMVVGKDTLY+YGGMMEI D+E+TLDDLYSLNLSKLDEWKCIIP +E+EWV
Sbjct:   441 GRINSCMVVGKDTLYIYGGMMEIKDKEVTLDDLYSLNLSKLDEWKCIIPTTETEWV 496
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006869 "lipid transport" evidence=RCA
MGI|MGI:2384569 Klhdc4 "kelch domain containing 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000047740 AN2090 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0001573 orf19.5009 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AKW8 KEL3 "Putative uncharacterized protein KEL3" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000006184 KEL3 "Cytoplasmic protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPCC1223.06 tea1 "cell end marker Tea1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293006 gefF "Ras guanine nucleotide exchange factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2014400 ESP "epithiospecifier protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XV.1950.1
SubName- Full=Putative uncharacterized protein; (679 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00640202
hypothetical protein (1181 aa)
   •    0.497
estExt_Genewise1_v1.C_LG_VII2715
hypothetical protein (380 aa)
   •    0.491
gw1.86.17.1
hypothetical protein (573 aa)
   •    0.478
gw1.I.4832.1
hypothetical protein (422 aa)
   •    0.474
estExt_fgenesh4_pg.C_LG_XV0629
hypothetical protein (314 aa)
   •    0.460

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 6e-17
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-15
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 1e-11
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 3e-09
pfam1385442 pfam13854, Kelch_5, Kelch motif 8e-09
pfam1385442 pfam13854, Kelch_5, Kelch motif 6e-08
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 1e-06
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-06
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 3e-06
pfam02724 583 pfam02724, CDC45, CDC45-like protein 5e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-06
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 3e-05
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 6e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 8e-05
pfam1385442 pfam13854, Kelch_5, Kelch motif 9e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 1e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 1e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-04
pfam0134446 pfam01344, Kelch_1, Kelch motif 2e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-04
pfam05327 554 pfam05327, RRN3, RNA polymerase I specific transcr 8e-04
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 0.001
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.001
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.001
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.001
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.002
pfam0764648 pfam07646, Kelch_2, Kelch motif 0.002
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.002
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.002
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.003
pfam04147 809 pfam04147, Nop14, Nop14-like family 0.004
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information 
 Score = 82.0 bits (202), Expect = 6e-17
 Identities = 76/287 (26%), Positives = 132/287 (45%), Gaps = 27/287 (9%)

Query: 66  PSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPR 125
           P PR  CS  I  + + +L  +GGE    N+ ++  DLY +D     W  I+  N   PR
Sbjct: 20  PGPR--CSHGIAVVGD-KLYSFGGEL-KPNE-HIDKDLYVFDFNTHTWS-IAPANGDVPR 73

Query: 126 SAH---QAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWE---QLNLKGCPSP 179
            +    + V+    LYIFGG     +++R   + DF+  D   N+W    +L+ +G P  
Sbjct: 74  ISCLGVRMVAVGTKLYIFGGR----DEKR--EFSDFYSYDTVKNEWTFLTKLDEEGGPEA 127

Query: 180 RSGHRMVLYKHKIIVFGGFYD--TLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRS 237
           R+ H M   ++ + VFGG      ++    +  +  +++   KW ++ P  G  +   R 
Sbjct: 128 RTFHSMASDENHVYVFGGVSKGGLMKTPERFRTIEAYNIADGKWVQL-PDPGENF-EKRG 185

Query: 238 GFQFFVYQDEVFL-YGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGP 296
           G  F V Q ++++ YG  +  +   K+  E   +       DP + +W++V+  G  P  
Sbjct: 186 GAGFAVVQGKIWVVYGFATSILPGGKSDYESNAVQF----FDPASGKWTEVETTGAKPSA 241

Query: 297 RAGFSMCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRW 343
           R+ F+  V  K  ++FGG V  ++KG +      NE Y    +   W
Sbjct: 242 RSVFAHAVVGKYIIIFGGEVWPDLKGHLGPGTLSNEGYALDTETLVW 288

Length = 341
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 602
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02193470 nitrile-specifier protein 100.0
KOG1230521 consensus Protein containing repeated kelch motifs 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA03098534 kelch-like protein; Provisional 100.0
KOG0379482 consensus Kelch repeat-containing proteins [Genera 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.98
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.98
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.97
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.82
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.8
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.7
KOG2437723 consensus Muskelin [Signal transduction mechanisms 99.62
PF1396450 Kelch_6: Kelch motif 99.04
PF1396450 Kelch_6: Kelch motif 99.02
PLN02772398 guanylate kinase 98.87
PF1341549 Kelch_3: Galactose oxidase, central domain 98.82
PF1341549 Kelch_3: Galactose oxidase, central domain 98.79
PF1385442 Kelch_5: Kelch motif 98.77
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.76
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.74
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.72
PLN02772398 guanylate kinase 98.72
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.69
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.68
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.68
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.68
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.59
PF1385442 Kelch_5: Kelch motif 98.56
smart0061247 Kelch Kelch domain. 98.31
smart0061247 Kelch Kelch domain. 98.27
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.24
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.13
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.04
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.49
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.45
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.24
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.19
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.03
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.65
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.54
KOG2055514 consensus WD40 repeat protein [General function pr 96.24
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 96.24
PF12768281 Rax2: Cortical protein marker for cell polarity 95.68
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.47
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.43
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 95.06
KOG2055514 consensus WD40 repeat protein [General function pr 95.01
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.75
PRK04792448 tolB translocation protein TolB; Provisional 94.73
PRK04792448 tolB translocation protein TolB; Provisional 94.72
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.43
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.37
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 94.34
PF12768281 Rax2: Cortical protein marker for cell polarity 94.23
PRK05137435 tolB translocation protein TolB; Provisional 94.21
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.01
PRK04922433 tolB translocation protein TolB; Provisional 93.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.79
PRK05137435 tolB translocation protein TolB; Provisional 93.75
PRK00178430 tolB translocation protein TolB; Provisional 93.69
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.59
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.57
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 93.56
PRK13684334 Ycf48-like protein; Provisional 93.51
PRK04922433 tolB translocation protein TolB; Provisional 93.26
PRK03629429 tolB translocation protein TolB; Provisional 93.14
PRK11028330 6-phosphogluconolactonase; Provisional 93.13
PRK00178430 tolB translocation protein TolB; Provisional 92.84
PF04931784 DNA_pol_phi: DNA polymerase phi; InterPro: IPR0070 92.83
PF10446 458 DUF2457: Protein of unknown function (DUF2457); In 92.79
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.53
PRK02889427 tolB translocation protein TolB; Provisional 92.37
PRK13684334 Ycf48-like protein; Provisional 92.16
PRK11028330 6-phosphogluconolactonase; Provisional 91.76
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.73
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 91.11
KOG0310487 consensus Conserved WD40 repeat-containing protein 90.7
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.32
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.26
PLN029191057 haloacid dehalogenase-like hydrolase family protei 90.26
PRK03629429 tolB translocation protein TolB; Provisional 90.0
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.93
PRK04043419 tolB translocation protein TolB; Provisional 89.91
PF09026101 CENP-B_dimeris: Centromere protein B dimerisation 89.58
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.25
PLN00181793 protein SPA1-RELATED; Provisional 89.02
PTZ00421493 coronin; Provisional 88.92
PRK02889427 tolB translocation protein TolB; Provisional 87.57
PF02724 622 CDC45: CDC45-like protein; InterPro: IPR003874 CDC 87.4
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.26
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 87.22
PTZ00421493 coronin; Provisional 87.0
PRK04043419 tolB translocation protein TolB; Provisional 86.34
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 85.58
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 85.49
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 84.48
PLN00181793 protein SPA1-RELATED; Provisional 84.22
KOG0310487 consensus Conserved WD40 repeat-containing protein 83.07
PF02724 622 CDC45: CDC45-like protein; InterPro: IPR003874 CDC 82.18
KOG2321 703 consensus WD40 repeat protein [General function pr 81.76
KOG0772641 consensus Uncharacterized conserved protein, conta 81.48
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 80.07
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=5.3e-81  Score=624.80  Aligned_cols=480  Identities=46%  Similarity=0.776  Sum_probs=391.8

Q ss_pred             CCCCCCCCCCCc--hhhHHHHHHHHHHHHHHhhhcCCCchhHHHHHHHHHHhhhceeeEEeeccCCCCCCCcceEEEEec
Q 007468            1 MGKKNKKAGKGK--EKTERKTAKAEEKRARRETKKISPEDDIDAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINP   78 (602)
Q Consensus         1 m~k~~~~~~~~~--~k~~~k~~~~~~k~~~~~~~~~~~eedi~~~l~~~~~~e~~~~~~~~~~~~~~P~~R~~~s~~~~~   78 (602)
                      ||||+||++|+|  +|+++|+++|.   +||. ++++++.|+..|...|+..+++..+.+....+++|+||.++++++.|
T Consensus         1 MgKK~Kk~kkgk~aek~a~K~dkK~---akr~-kkl~~e~de~~i~~~iq~~eaK~~e~~~e~~~~~PspRsn~sl~~nP   76 (521)
T KOG1230|consen    1 MGKKNKKDKKGKGAEKTAAKQDKKF---AKRK-KKLNEELDEADIAEIIQSLEAKQIEHVVETSVPPPSPRSNPSLFANP   76 (521)
T ss_pred             CCccccCcccccchhhhHHHHHHHH---Hhhh-hhcCcccchHHHHHHHHhhhhhccceeeeccCCCCCCCCCcceeecc
Confidence            999988766665  55555555444   4444 66788888888888999999988788888999999999999999999


Q ss_pred             CCCCEEEEEcceecCCCCceeeCcEEEEEcCCCcEEEecCCCCCCCceeeEEEEEC-CEEEEEeCccCCCCCCcceecCe
Q 007468           79 LKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWK-NYLYIFGGEFTSPNQERFHHYKD  157 (602)
Q Consensus        79 ~~~~~iyv~GG~~~~g~~~~~~~dv~~yd~~~~~W~~l~~~~~P~~R~~hs~~~~~-~~iyV~GG~~~~~~~~~~~~~~d  157 (602)
                      .+ +.||+|||.+++++.+.++|++|.||+.+++|+++.+++.|+||++|++|++. +.+|||||.+.++++.+|+++.|
T Consensus        77 ek-eELilfGGEf~ngqkT~vYndLy~Yn~k~~eWkk~~spn~P~pRsshq~va~~s~~l~~fGGEfaSPnq~qF~HYkD  155 (521)
T KOG1230|consen   77 EK-EELILFGGEFYNGQKTHVYNDLYSYNTKKNEWKKVVSPNAPPPRSSHQAVAVPSNILWLFGGEFASPNQEQFHHYKD  155 (521)
T ss_pred             Cc-ceeEEecceeecceeEEEeeeeeEEeccccceeEeccCCCcCCCccceeEEeccCeEEEeccccCCcchhhhhhhhh
Confidence            87 59999999999999999999999999999999999999999999999999996 89999999999999999999999


Q ss_pred             EEEEECCCCcEEEcccCCCCCCCcccEEEEECCEEEEEcCccCCCCCeeeeceEEEEECCCCceEEeccCCCCCCCCCcc
Q 007468          158 FWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRS  237 (602)
Q Consensus       158 v~~yd~~t~~W~~~~~~~~p~~R~~h~~~~~~~~Lyv~GG~~~~~~~~~~~~~v~~yd~~t~~W~~v~~~~~~~~P~~R~  237 (602)
                      +|+||+.+++|+++...+.|+||++|.|+++.++|+||||++.+.+...|+|+||+||+.+.+|+.+.+.  +..|.||+
T Consensus       156 ~W~fd~~trkweql~~~g~PS~RSGHRMvawK~~lilFGGFhd~nr~y~YyNDvy~FdLdtykW~Kleps--ga~PtpRS  233 (521)
T KOG1230|consen  156 LWLFDLKTRKWEQLEFGGGPSPRSGHRMVAWKRQLILFGGFHDSNRDYIYYNDVYAFDLDTYKWSKLEPS--GAGPTPRS  233 (521)
T ss_pred             eeeeeeccchheeeccCCCCCCCccceeEEeeeeEEEEcceecCCCceEEeeeeEEEeccceeeeeccCC--CCCCCCCC
Confidence            9999999999999999889999999999999999999999999999999999999999999999999995  56899999


Q ss_pred             ceeEEEe-CCEEEEEcCccCCCCCccCCCCCCceeeeEEEEeCCC-----CeeEEeecCCCCCCCCceeEEEEE-CCeEE
Q 007468          238 GFQFFVY-QDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRT-----WEWSKVKKIGMPPGPRAGFSMCVH-KKRAL  310 (602)
Q Consensus       238 ~~~~~~~-~~~Iyv~GG~~~~~~~~~~~~~~~~~~~dv~~yd~~t-----~~W~~l~~~g~~P~~R~~~s~~~~-~~~ly  310 (602)
                      ||++++. ++.|||+|||+..  ........+..++|+|.+++.+     +.|+++.+.|..|.||+++++++. +++.|
T Consensus       234 Gcq~~vtpqg~i~vyGGYsK~--~~kK~~dKG~~hsDmf~L~p~~~~~dKw~W~kvkp~g~kPspRsgfsv~va~n~kal  311 (521)
T KOG1230|consen  234 GCQFSVTPQGGIVVYGGYSKQ--RVKKDVDKGTRHSDMFLLKPEDGREDKWVWTKVKPSGVKPSPRSGFSVAVAKNHKAL  311 (521)
T ss_pred             cceEEecCCCcEEEEcchhHh--hhhhhhhcCceeeeeeeecCCcCCCcceeEeeccCCCCCCCCCCceeEEEecCCceE
Confidence            9999999 9999999999988  5777888999999999999988     899999999999999999999998 56999


Q ss_pred             EeccccccccccccccccccCeeEEEECCCCceEEeEecCCCchhhhhcccccCCCCchhhhhccCchhhhhcccCccch
Q 007468          311 LFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEEFDANEKDE  390 (602)
Q Consensus       311 v~GG~~~~~~~~~~~~~~~~ndv~~yd~~t~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  390 (602)
                      +|||+.+.+....++.+.|+||+|.||++.++|+..++.+..+.... +|+.+..... .+.       .-..+++..|-
T Consensus       312 ~FGGV~D~eeeeEsl~g~F~NDLy~fdlt~nrW~~~qlq~~~S~~~~-~r~~~Kd~~k-~~~-------~~~~G~~tkd~  382 (521)
T KOG1230|consen  312 FFGGVCDLEEEEESLSGEFFNDLYFFDLTRNRWSEGQLQGKKSPATS-RRRSRKDQEK-ELQ-------RPTVGPNTKDL  382 (521)
T ss_pred             EecceecccccchhhhhhhhhhhhheecccchhhHhhhccCCCCccc-cccccccccc-ccc-------CcccCCCcccc
Confidence            99999998888999999999999999999999999988777766544 2222211110 000       00011111110


Q ss_pred             hhhhhhhhhhcccccccccccCCCceeeccCcee-e---ecCCCCCCccccccccccCCCCCcCCccCcccceeeecCeE
Q 007468          391 NAEYYEEADEMESNIDNLSECVPNSVIVDDGVLA-A---KSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTL  466 (602)
Q Consensus       391 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~---~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~~~~~~v~~~~l  466 (602)
                      ++.                ...+.....-|+.++ +   ....+..+.++......+...+.--|+||+++.+++..+.|
T Consensus       383 e~~----------------~v~k~v~~~~d~l~i~v~v~~~g~~~~p~s~~e~s~~~~~e~~~~~~pr~d~~~~v~~G~~  446 (521)
T KOG1230|consen  383 EVQ----------------AVDKAVCPTTDSLFIYVGVWEPGEADYPESEDEASREGDREPDEGEFPRMDDELSVKVGVL  446 (521)
T ss_pred             cce----------------ecceeeeecCCceEEEeecCCCCCCCCcccccccccccCCCCCCCCCccCCCccCcccceE
Confidence            100                001111111112222 1   11122222222222223333333369999999999999999


Q ss_pred             EEEeceEEecCeeeeecchhhcccCCCCccEEeecCChh--hhhhccCCC
Q 007468          467 YVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASES--EWVEASEGE  514 (602)
Q Consensus       467 yv~GG~~e~g~~~~~l~Dl~~ldl~~~~~W~~~~~~~~~--~w~~~~~~~  514 (602)
                      ||+||+++-+|++.||+|||+|+||++.+||+|.+++..  ||++..+++
T Consensus       447 ~i~gGi~ee~d~q~tl~dfyal~~hr~~~~K~L~~~sfe~~E~re~~ds~  496 (521)
T KOG1230|consen  447 YIGGGIFEERDWQPTLRDFYALDLHRNEKGKQLKTKSFELCEWRERRDSE  496 (521)
T ss_pred             EecCCCcccccccchHHHHhhhhhhhhhhhhhhccCCchhhhhhhhhhhh
Confidence            999999999999999999999999998899999999884  899766553

>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46 Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 5e-05
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 4e-04
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 86/220 (39%), Gaps = 31/220 (14%)
Query: 124 PRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGH 183
           PR+    V+ +N +Y+ GG +     +       F+ LD  +++W  + L   PS R   
Sbjct: 46  PRNHSSIVTQQNQVYVVGGLYVDEENKDQPLQSYFFQLDNVSSEW--VGLPPLPSARCLF 103
Query: 184 RMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGFQFFV 243
            +     KI V  G    L+     + +  +D    KW E+K       P    G     
Sbjct: 104 GLGEVDDKIYVVAG--KDLQTEASLDSVLCYDPVAAKWSEVKN-----LPIKVYGHNVIS 156
Query: 244 YQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMC 303
           +   ++  GG +     DK  + +  I+      +P+  +W   K +     PR+ F + 
Sbjct: 157 HNGMIYCLGGKTD----DKKCTNRVFIY------NPKKGDW---KDLAPMKTPRSMFGVA 203
Query: 304 VHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRW 343
           +HK + ++ GGV +  +   V           F L  ++W
Sbjct: 204 IHKGKIVIAGGVTEDGLSASV---------EAFDLKTNKW 234
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-37
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-28
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 7e-30
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-28
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-27
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-13
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 7e-27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-23
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 9e-26
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-25
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 9e-23
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-20
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-19
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-14
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-09
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-06
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-20
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-16
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-22
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-12
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 7e-08
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 4e-04
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score =  144 bits (365), Expect = 9e-37
 Identities = 47/285 (16%), Positives = 95/285 (33%), Gaps = 35/285 (12%)

Query: 41  DAILLSIQKEEAKKKEVHVEDNVPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVY 100
           + + LSI  ++   K + V  +   P  R   +      +  +L+L GG           
Sbjct: 413 EILQLSIHYDKIDMKNIEVSSS-EVPVARMCHTFTTIS-RNNQLLLIGGR--KAPHQG-L 467

Query: 101 GDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKN-YLYIFGGEFTSPNQERFHHYKDFW 159
            D + +D++ +EW +I   +    R  H A S  +  + I GG    P            
Sbjct: 468 SDNWIFDMKTREWSMI--KSLSHTRFRHSACSLPDGNVLILGGVTEGP---------AML 516

Query: 160 MLDLKTNQWEQLNLKG-CPSPRSGHRMVLY---KHKIIVFGGFYDTLREVRYYNDLYVFD 215
           + ++    ++ +  K            + +     + I+ GG +     V     ++ +D
Sbjct: 517 LYNVTEEIFKDVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYD 576

Query: 216 LDQFKWQEIKPRFGSMWPSPRSGFQF-FVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDL 274
            +         +        R G Q  ++   ++ + GG S     D+         + +
Sbjct: 577 AENATEPITVIKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDR--------TNSI 628

Query: 275 WSLDPRTWEWSKVKKIGMPPGP----RAGFSMC-VHKKRALLFGG 314
            SLDP +   + +              AGFS+         + GG
Sbjct: 629 ISLDPLSETLTSIPISRRIWEDHSLMLAGFSLVSTSMGTIHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.98
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.97
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.97
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.92
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.87
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.84
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.79
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.74
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.67
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.65
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.51
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.42
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.25
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.04
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.03
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.95
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.94
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.91
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.86
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.85
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.81
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.75
3jrp_A379 Fusion protein of protein transport protein SEC13 96.71
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.67
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.67
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.6
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.55
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.52
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.52
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.48
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.46
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.44
3jrp_A379 Fusion protein of protein transport protein SEC13 96.28
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.24
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.19
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.13
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.07
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.06
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.04
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 96.03
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 96.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.99
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.91
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.9
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.88
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.84
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.84
3jro_A 753 Fusion protein of protein transport protein SEC13 95.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.83
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.82
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.81
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.81
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.79
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 95.76
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.76
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.7
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.67
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.64
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 95.63
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.62
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.6
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.59
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 95.57
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.49
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.47
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.46
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.46
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.43
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.43
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.42
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.41
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 95.4
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 95.33
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 95.31
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.28
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.28
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.26
4g56_B357 MGC81050 protein; protein arginine methyltransfera 95.25
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.22
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.2
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.2
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.15
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.1
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 95.09
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.99
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.97
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.95
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 94.92
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 94.86
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.85
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.79
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.77
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.77
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.76
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.72
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.67
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.66
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.62
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.61
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.58
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 94.45
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 94.41
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.37
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.37
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.33
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 94.3
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.22
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 94.22
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.17
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 94.17
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.17
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.14
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.13
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.06
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 94.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.87
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.82
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 93.79
3jro_A 753 Fusion protein of protein transport protein SEC13 93.71
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.69
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 93.67
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 93.61
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.54
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 93.43
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.41
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 93.4
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.36
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 93.23
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.22
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.1
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 93.05
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 93.05
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.03
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 92.96
2pm7_B297 Protein transport protein SEC13, protein transport 92.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 92.86
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.84
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 92.82
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.79
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 92.79
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.69
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 92.65
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 92.63
3ott_A 758 Two-component system sensor histidine kinase; beta 92.59
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.58
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.46
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 92.27
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 92.18
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.14
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 92.11
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 92.09
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.01
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 91.92
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 91.89
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.84
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 91.78
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 91.77
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 91.77
3ott_A758 Two-component system sensor histidine kinase; beta 91.76
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.72
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 91.7
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.7
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 91.62
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 91.54
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 91.36
2pm7_B297 Protein transport protein SEC13, protein transport 91.25
2xyi_A430 Probable histone-binding protein CAF1; transcripti 91.2
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 91.19
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 91.19
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 91.17
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 91.09
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.08
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 91.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 90.94
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 90.85
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 90.83
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 90.82
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 90.79
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 90.78
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 90.58
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.57
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 90.07
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.98
2fp8_A322 Strictosidine synthase; six bladed beta propeller 89.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 89.75
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 89.72
1itv_A195 MMP9; adaptive molecular recognition, beta propell 89.41
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 89.38
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 89.13
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 89.09
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 89.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 88.92
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.8
3ju4_A670 Endo-N-acetylneuraminidase; endonf, polysia, high- 88.65
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 88.46
2ymu_A577 WD-40 repeat protein; unknown function, two domain 87.92
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 87.87
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 87.55
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.48
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 87.02
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 86.97
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 86.83
2xyi_A430 Probable histone-binding protein CAF1; transcripti 86.79
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 86.68
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.55
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.42
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 86.4
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 86.27
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.49
2fp8_A322 Strictosidine synthase; six bladed beta propeller 85.44
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 84.46
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 84.39
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 84.32
1itv_A195 MMP9; adaptive molecular recognition, beta propell 83.46
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 82.66
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 82.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 82.2
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 82.14
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 81.72
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 81.29
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 81.15
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 80.82
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 80.58
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 80.57
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 80.41
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 80.06
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 80.02
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=3.6e-46  Score=385.39  Aligned_cols=291  Identities=18%  Similarity=0.258  Sum_probs=244.3

Q ss_pred             CCCCCCCcceEEEEecCCCCEEEEEcceecCCCCceeeCcEEEEEcCCCcEEEecCCCCCCCceeeEEEEECCEEEEEeC
Q 007468           63 VPAPSPRSNCSLNINPLKETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGG  142 (602)
Q Consensus        63 ~~~P~~R~~~s~~~~~~~~~~iyv~GG~~~~g~~~~~~~dv~~yd~~~~~W~~l~~~~~P~~R~~hs~~~~~~~iyV~GG  142 (602)
                      .+.|.+|..|+++.+   ++.||||||.  ++   ..++++++||+.+++|..++.  +|.+|.+|+++++++.|||+||
T Consensus         9 ~~~~~~~~~~~~~~~---~~~i~v~GG~--~~---~~~~~~~~~d~~~~~W~~~~~--~p~~r~~~~~~~~~~~lyv~GG   78 (308)
T 1zgk_A            9 HSSGLVPRGSHAPKV---GRLIYTAGGY--FR---QSLSYLEAYNPSNGTWLRLAD--LQVPRSGLAGCVVGGLLYAVGG   78 (308)
T ss_dssp             ------------CCC---CCCEEEECCB--SS---SBCCCEEEEETTTTEEEECCC--CSSCCBSCEEEEETTEEEEECC
T ss_pred             ccCCeeeCCccccCC---CCEEEEEeCc--CC---CCcceEEEEcCCCCeEeECCC--CCcccccceEEEECCEEEEECC
Confidence            457788999999988   8999999996  22   367899999999999999965  6789999999999999999999


Q ss_pred             ccCCCCCCcceecCeEEEEECCCCcEEEcccCCCCCCCcccEEEEECCEEEEEcCccCCCCCeeeeceEEEEECCCCceE
Q 007468          143 EFTSPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQ  222 (602)
Q Consensus       143 ~~~~~~~~~~~~~~dv~~yd~~t~~W~~~~~~~~p~~R~~h~~~~~~~~Lyv~GG~~~~~~~~~~~~~v~~yd~~t~~W~  222 (602)
                      .......  ...++++|+||+.+++|+.+++  +|.+|.+|++++++++||||||....    ..++++++||+.+++|+
T Consensus        79 ~~~~~~~--~~~~~~~~~~d~~~~~W~~~~~--~p~~r~~~~~~~~~~~iyv~GG~~~~----~~~~~~~~yd~~~~~W~  150 (308)
T 1zgk_A           79 RNNSPDG--NTDSSALDCYNPMTNQWSPCAP--MSVPRNRIGVGVIDGHIYAVGGSHGC----IHHNSVERYEPERDEWH  150 (308)
T ss_dssp             EEEETTE--EEECCCEEEEETTTTEEEECCC--CSSCCBTCEEEEETTEEEEECCEETT----EECCCEEEEETTTTEEE
T ss_pred             CcCCCCC--CeecceEEEECCCCCeEeECCC--CCcCccccEEEEECCEEEEEcCCCCC----cccccEEEECCCCCeEe
Confidence            8421111  2467899999999999999987  89999999999999999999998653    35899999999999999


Q ss_pred             EeccCCCCCCCCCccceeEEEeCCEEEEEcCccCCCCCccCCCCCCceeeeEEEEeCCCCeeEEeecCCCCCCCCceeEE
Q 007468          223 EIKPRFGSMWPSPRSGFQFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSM  302 (602)
Q Consensus       223 ~v~~~~~~~~P~~R~~~~~~~~~~~Iyv~GG~~~~~~~~~~~~~~~~~~~dv~~yd~~t~~W~~l~~~g~~P~~R~~~s~  302 (602)
                      .++++     |.+|.+|++++++++|||+||....           ..++++++||+.+++|+.+.++   |.+|.+|++
T Consensus       151 ~~~~~-----p~~r~~~~~~~~~~~iyv~GG~~~~-----------~~~~~~~~yd~~~~~W~~~~~~---p~~r~~~~~  211 (308)
T 1zgk_A          151 LVAPM-----LTRRIGVGVAVLNRLLYAVGGFDGT-----------NRLNSAECYYPERNEWRMITAM---NTIRSGAGV  211 (308)
T ss_dssp             ECCCC-----SSCCBSCEEEEETTEEEEECCBCSS-----------CBCCCEEEEETTTTEEEECCCC---SSCCBSCEE
T ss_pred             ECCCC-----CccccceEEEEECCEEEEEeCCCCC-----------CcCceEEEEeCCCCeEeeCCCC---CCccccceE
Confidence            99877     8899999999999999999998765           3478999999999999999764   889999999


Q ss_pred             EEECCeEEEeccccccccccccccccccCeeEEEECCCCceEEeEecCCCchhhhhcccccCCCCchhhhhccCchhhhh
Q 007468          303 CVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEE  382 (602)
Q Consensus       303 ~~~~~~lyv~GG~~~~~~~~~~~~~~~~ndv~~yd~~t~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  382 (602)
                      ++++++||||||....         ..++++++||+.+++|+.+..                                  
T Consensus       212 ~~~~~~iyv~GG~~~~---------~~~~~v~~yd~~~~~W~~~~~----------------------------------  248 (308)
T 1zgk_A          212 CVLHNCIYAAGGYDGQ---------DQLNSVERYDVETETWTFVAP----------------------------------  248 (308)
T ss_dssp             EEETTEEEEECCBCSS---------SBCCCEEEEETTTTEEEECCC----------------------------------
T ss_pred             EEECCEEEEEeCCCCC---------CccceEEEEeCCCCcEEECCC----------------------------------
Confidence            9999999999998752         348999999999999998765                                  


Q ss_pred             cccCccchhhhhhhhhhhcccccccccccCCCceeeccCceeeecCCCCCCccccccccccCCCCCcCCccCcccceeee
Q 007468          383 FDANEKDENAEYYEEADEMESNIDNLSECVPNSVIVDDGVLAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVG  462 (602)
Q Consensus       383 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~~~~~~v~  462 (602)
                                                                                         +|.+|..|++++.
T Consensus       249 -------------------------------------------------------------------~p~~r~~~~~~~~  261 (308)
T 1zgk_A          249 -------------------------------------------------------------------MKHRRSALGITVH  261 (308)
T ss_dssp             -------------------------------------------------------------------CSSCCBSCEEEEE
T ss_pred             -------------------------------------------------------------------CCCCccceEEEEE
Confidence                                                                               6899999999999


Q ss_pred             cCeEEEEeceEEecCeeeeecchhhcccCCCCccEEeecCChh
Q 007468          463 KDTLYVYGGMMEINDQEITLDDLYSLNLSKLDEWKCIIPASES  505 (602)
Q Consensus       463 ~~~lyv~GG~~e~g~~~~~l~Dl~~ldl~~~~~W~~~~~~~~~  505 (602)
                      +++|||+||...    ...++|+|+||+.+ ++|+.+.++...
T Consensus       262 ~~~i~v~GG~~~----~~~~~~v~~yd~~~-~~W~~~~~~p~~  299 (308)
T 1zgk_A          262 QGRIYVLGGYDG----HTFLDSVECYDPDT-DTWSEVTRMTSG  299 (308)
T ss_dssp             TTEEEEECCBCS----SCBCCEEEEEETTT-TEEEEEEECSSC
T ss_pred             CCEEEEEcCcCC----CcccceEEEEcCCC-CEEeecCCCCCC
Confidence            999999999753    23689999999998 999999776553
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 602
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-13
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-06
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.0 bits (164), Expect = 4e-13
 Identities = 41/285 (14%), Positives = 65/285 (22%), Gaps = 47/285 (16%)

Query: 94  GNKTYVYG--------DLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFT 145
           G   Y  G         L  Y+     W  +   +   PRS          LY  GG   
Sbjct: 4   GRLIYTAGGYFRQSLSYLEAYNPSNGTWLRL--ADLQVPRSGLAGCVVGGLLYAVGGRNN 61

Query: 146 SPNQERFHHYKDFWMLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREV 205
           SP+        D +                   PR+   + +    I   GG +  +   
Sbjct: 62  SPDGNTDSSALDCYNPMTNQWSPCA----PMSVPRNRIGVGVIDGHIYAVGGSHGCIHHN 117

Query: 206 RYYNDLYVFDLDQFKWQEIKPRFGSMWPSPR------SGFQFFVYQDEVFLYGGYSKEVS 259
                    D        +  R G              GF      +    Y     E  
Sbjct: 118 SVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWR 177

Query: 260 TDKNQSEKGIIHS------------------DLWSLDPRTWEWSKVKKIGMPPGPRAGFS 301
                +                          L S++    E      +      R+   
Sbjct: 178 MITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALG 237

Query: 302 MCVHKKRALLFGGVVDMEMKGDVIMSLFLNELYGFQLDNHRWYPL 346
           + VH+ R  + GG              FL+ +  +  D   W  +
Sbjct: 238 ITVHQGRIYVLGGYDGHT---------FLDSVECYDPDTDTWSEV 273
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.98
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.46
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.45
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.02
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.75
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.72
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.66
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.21
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.16
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.76
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.74
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.73
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.71
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.23
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.2
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 94.02
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 93.75
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.69
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.68
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 93.67
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.61
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.5
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.27
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.05
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.05
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 93.0
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 92.62
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.18
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 91.91
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 91.7
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 91.56
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 91.27
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.18
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.45
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.24
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 90.2
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 89.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.64
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 89.52
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 89.24
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.43
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 87.94
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 87.16
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 86.37
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 86.1
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 86.02
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 85.41
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 84.62
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 83.43
d1tbga_340 beta1-subunit of the signal-transducing G protein 81.89
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.1e-41  Score=338.74  Aligned_cols=277  Identities=19%  Similarity=0.298  Sum_probs=242.2

Q ss_pred             CCCEEEEEcceecCCCCceeeCcEEEEEcCCCcEEEecCCCCCCCceeeEEEEECCEEEEEeCccCCCCCCcceecCeEE
Q 007468           80 KETELILYGGEFYNGNKTYVYGDLYRYDVEKQEWKVISSPNSPPPRSAHQAVSWKNYLYIFGGEFTSPNQERFHHYKDFW  159 (602)
Q Consensus        80 ~~~~iyv~GG~~~~g~~~~~~~dv~~yd~~~~~W~~l~~~~~P~~R~~hs~~~~~~~iyV~GG~~~~~~~~~~~~~~dv~  159 (602)
                      .++.||||||..  .   ..++++++||+.+++|+.+++  +|.+|++|++++++++|||+||.......  ...++++|
T Consensus         3 ~g~~iyv~GG~~--~---~~~~~~~~yd~~t~~W~~~~~--~p~~R~~~~~~~~~~~iyv~GG~~~~~~~--~~~~~~~~   73 (288)
T d1zgka1           3 VGRLIYTAGGYF--R---QSLSYLEAYNPSNGTWLRLAD--LQVPRSGLAGCVVGGLLYAVGGRNNSPDG--NTDSSALD   73 (288)
T ss_dssp             CCCCEEEECCBS--S---SBCCCEEEEETTTTEEEECCC--CSSCCBSCEEEEETTEEEEECCEEEETTE--EEECCCEE
T ss_pred             cCCEEEEECCcC--C---CCCceEEEEECCCCeEEECCC--CCCccceeEEEEECCEEEEEeCcccCCCC--ccccchhh
Confidence            478899999962  2   257899999999999999976  67899999999999999999998644332  34678999


Q ss_pred             EEECCCCcEEEcccCCCCCCCcccEEEEECCEEEEEcCccCCCCCeeeeceEEEEECCCCceEEeccCCCCCCCCCccce
Q 007468          160 MLDLKTNQWEQLNLKGCPSPRSGHRMVLYKHKIIVFGGFYDTLREVRYYNDLYVFDLDQFKWQEIKPRFGSMWPSPRSGF  239 (602)
Q Consensus       160 ~yd~~t~~W~~~~~~~~p~~R~~h~~~~~~~~Lyv~GG~~~~~~~~~~~~~v~~yd~~t~~W~~v~~~~~~~~P~~R~~~  239 (602)
                      +||+.+++|+.+++  +|.+|++|++++++++||++||....    ..++.++.|++.+..|......     |.+|.+|
T Consensus        74 ~yd~~~~~w~~~~~--~p~~r~~~~~~~~~~~i~~~gg~~~~----~~~~~~~~~~~~~~~~~~~~~~-----~~~r~~~  142 (288)
T d1zgka1          74 CYNPMTNQWSPCAP--MSVPRNRIGVGVIDGHIYAVGGSHGC----IHHNSVERYEPERDEWHLVAPM-----LTRRIGV  142 (288)
T ss_dssp             EEETTTTEEEECCC--CSSCCBTCEEEEETTEEEEECCEETT----EECCCEEEEETTTTEEEECCCC-----SSCCBSC
T ss_pred             hccccccccccccc--ccceecceeccccceeeEEecceecc----cccceeeeeccccCcccccccc-----ccccccc
Confidence            99999999999987  89999999999999999999998653    3689999999999999988777     8899999


Q ss_pred             eEEEeCCEEEEEcCccCCCCCccCCCCCCceeeeEEEEeCCCCeeEEeecCCCCCCCCceeEEEEECCeEEEeccccccc
Q 007468          240 QFFVYQDEVFLYGGYSKEVSTDKNQSEKGIIHSDLWSLDPRTWEWSKVKKIGMPPGPRAGFSMCVHKKRALLFGGVVDME  319 (602)
Q Consensus       240 ~~~~~~~~Iyv~GG~~~~~~~~~~~~~~~~~~~dv~~yd~~t~~W~~l~~~g~~P~~R~~~s~~~~~~~lyv~GG~~~~~  319 (602)
                      +++++.+.+|++||....           ....++++||+.+++|......   +.++..|++++++++|+++||...  
T Consensus       143 ~~~~~~~~~~~~GG~~~~-----------~~~~~~~~~d~~~~~~~~~~~~---~~~~~~~~~~~~~~~i~i~GG~~~--  206 (288)
T d1zgka1         143 GVAVLNRLLYAVGGFDGT-----------NRLNSAECYYPERNEWRMITAM---NTIRSGAGVCVLHNCIYAAGGYDG--  206 (288)
T ss_dssp             EEEEETTEEEEECCBCSS-----------CBCCCEEEEETTTTEEEECCCC---SSCCBSCEEEEETTEEEEECCBCS--
T ss_pred             eeeeeeecceEecCcccc-----------cccceEEEeecccccccccccc---ccccccccccceeeeEEEecCccc--
Confidence            999999999999998765           5667899999999999988653   778899999999999999999865  


Q ss_pred             cccccccccccCeeEEEECCCCceEEeEecCCCchhhhhcccccCCCCchhhhhccCchhhhhcccCccchhhhhhhhhh
Q 007468          320 MKGDVIMSLFLNELYGFQLDNHRWYPLELRKEKSTKDKLKKSSEQKPNSSALHEKLNPIEAEEFDANEKDENAEYYEEAD  399 (602)
Q Consensus       320 ~~~~~~~~~~~ndv~~yd~~t~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  399 (602)
                             ...+++++.||+.+++|..++.                                                   
T Consensus       207 -------~~~~~~~~~~~~~~~~~~~~~~---------------------------------------------------  228 (288)
T d1zgka1         207 -------QDQLNSVERYDVETETWTFVAP---------------------------------------------------  228 (288)
T ss_dssp             -------SSBCCCEEEEETTTTEEEECCC---------------------------------------------------
T ss_pred             -------cccccceeeeeecceeeecccC---------------------------------------------------
Confidence                   2457899999999999998765                                                   


Q ss_pred             hcccccccccccCCCceeeccCceeeecCCCCCCccccccccccCCCCCcCCccCcccceeeecCeEEEEeceEEecCee
Q 007468          400 EMESNIDNLSECVPNSVIVDDGVLAAKSGGKPYESKKKSDMQKSLLPEIVKPCGRINSCMVVGKDTLYVYGGMMEINDQE  479 (602)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~R~~~~~~v~~~~lyv~GG~~e~g~~~  479 (602)
                                                                        .|.+|.+|++++.+++||||||...    .
T Consensus       229 --------------------------------------------------~p~~r~~~~~~~~~~~l~v~GG~~~----~  254 (288)
T d1zgka1         229 --------------------------------------------------MKHRRSALGITVHQGRIYVLGGYDG----H  254 (288)
T ss_dssp             --------------------------------------------------CSSCCBSCEEEEETTEEEEECCBCS----S
T ss_pred             --------------------------------------------------ccCcccceEEEEECCEEEEEecCCC----C
Confidence                                                              5899999999999999999999753    3


Q ss_pred             eeecchhhcccCCCCccEEeecCChh
Q 007468          480 ITLDDLYSLNLSKLDEWKCIIPASES  505 (602)
Q Consensus       480 ~~l~Dl~~ldl~~~~~W~~~~~~~~~  505 (602)
                      ..++++|+||+.+ ++|++|-++...
T Consensus       255 ~~~~~v~~yd~~~-~~W~~~~~~p~~  279 (288)
T d1zgka1         255 TFLDSVECYDPDT-DTWSEVTRMTSG  279 (288)
T ss_dssp             CBCCEEEEEETTT-TEEEEEEECSSC
T ss_pred             eecceEEEEECCC-CEEEECCCCCCC
Confidence            5789999999999 999999877553
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure