Citrus Sinensis ID: 007515
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 600 | ||||||
| 359476356 | 601 | PREDICTED: ankyrin repeat-containing pro | 0.983 | 0.981 | 0.684 | 0.0 | |
| 224142976 | 591 | predicted protein [Populus trichocarpa] | 0.978 | 0.993 | 0.689 | 0.0 | |
| 255550978 | 595 | ankyrin repeat-containing protein, putat | 0.981 | 0.989 | 0.664 | 0.0 | |
| 147765315 | 580 | hypothetical protein VITISV_020094 [Viti | 0.948 | 0.981 | 0.656 | 0.0 | |
| 225430027 | 595 | PREDICTED: ankyrin repeat-containing pro | 0.98 | 0.988 | 0.610 | 0.0 | |
| 296081888 | 600 | unnamed protein product [Vitis vinifera] | 0.971 | 0.971 | 0.607 | 0.0 | |
| 296081857 | 470 | unnamed protein product [Vitis vinifera] | 0.763 | 0.974 | 0.672 | 0.0 | |
| 147812174 | 574 | hypothetical protein VITISV_033967 [Viti | 0.918 | 0.959 | 0.547 | 1e-172 | |
| 297743226 | 1064 | unnamed protein product [Vitis vinifera] | 0.921 | 0.519 | 0.398 | 1e-109 | |
| 224059128 | 534 | predicted protein [Populus trichocarpa] | 0.863 | 0.970 | 0.427 | 1e-107 |
| >gi|359476356|ref|XP_003631824.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 814 bits (2102), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 412/602 (68%), Positives = 501/602 (83%), Gaps = 12/602 (1%)
Query: 10 MERHLFETILRGDTQAFLSLIQQDEAKIKQTVPGSLNTILHLTARFGHEELASEILKLCP 69
M+R LFE +L+GD +FLSL Q++E IKQ VPGSLNT+LHL ARFGH ELASEI+ L P
Sbjct: 1 MDRRLFEAVLKGDVSSFLSLAQEEEDIIKQVVPGSLNTVLHLAARFGHLELASEIVNLRP 60
Query: 70 EMVAAENEKMETPLHEACREGRLNFVKLFVGIDPSVIYKLNRDNESVLYVACERGRLDVA 129
E+ +AENEK+ETPLHEACREGR+ V L + +D + K+NR++ESVL+V CERG+LDV
Sbjct: 61 ELSSAENEKLETPLHEACREGRVEIVALLMKVDQWIAPKVNRNDESVLFVGCERGKLDVV 120
Query: 130 KQLL-NYSSLLILEVDGLTTSLHVSAMAGHLDIVKELLEARQEFAWKKDLNGHTPLHLSC 188
K LL N+S LL+LE+D TTSLH +A GH D+VKE++ R +F+WKKD G TPLHL+C
Sbjct: 121 KHLLVNHSWLLMLELDAPTTSLHAAASGGHTDVVKEIIRERPDFSWKKDSQGCTPLHLAC 180
Query: 189 SKGHLEITRELLKLDPDLSSLPDNEGRTPLHWAAIKGRINIIDEILSLNLQSAEMRTIHG 248
SKGHLEITRELL+LDPDL+SL DN+GRTPLHWAA+KGR+NIIDEILS++LQSAEMRT HG
Sbjct: 181 SKGHLEITRELLRLDPDLTSLQDNDGRTPLHWAAMKGRVNIIDEILSVSLQSAEMRTEHG 240
Query: 249 ETVLHLTVKNNQYEAVKYLMETLNITKLANMPDNDGNTILHLATAGKLTTMVIYLLKLGV 308
ETVLHL VKNNQYEAVKYL ETLNI++L N PD+DGNTILHLATAGKLTT V+YLLKLGV
Sbjct: 241 ETVLHLAVKNNQYEAVKYLTETLNISQLLNTPDSDGNTILHLATAGKLTTTVLYLLKLGV 300
Query: 309 DVNAINRKGYTALDVVESDASNSGALQIVPALEEAGARRCDQLPPMSPHDIQPIGDTSPI 368
+VNA+NRKGYT LDVVE+DASNSG+L +VPAL EAGA+RCDQLPP+S +IQ I + S
Sbjct: 301 NVNALNRKGYTPLDVVETDASNSGSLVVVPALLEAGAKRCDQLPPVS-QEIQTITEPSSG 359
Query: 369 SAQSSIPR------RAPRESPSRHHRRRNRRRREKQIELQTEGLRNARKTIIIVAVLIAT 422
+ P + P ESP++HHRR+++RRREKQ+E QTEGLRNAR TI +VAVLIAT
Sbjct: 360 RLYPTSPNLPPPWPKRPPESPAKHHRRKHQRRREKQLEQQTEGLRNARNTITVVAVLIAT 419
Query: 423 VTFAAGINPPGGFNQVSGKSLVGKQTSFKVFMVCNIVALFLSLGIVIFLVSIIPFQRKSM 482
VTF+AG+NPPGGFNQ SGK+++GK+T FKVFMVCNI+ALFLSLGIVI LVSIIPF+RKSM
Sbjct: 420 VTFSAGVNPPGGFNQSSGKAIMGKKTPFKVFMVCNILALFLSLGIVIVLVSIIPFRRKSM 479
Query: 483 MQLLVVTHRVMWLSVSFLAAAYIAAIWTILPRGRGMVWVSAAVVSLGGGFTLAIFTGLGV 542
M+LL+ TH+VMW+SV+F+AAAYIAA WTILP G WV +VS+GGG T+ I GLGV
Sbjct: 480 MKLLISTHKVMWMSVTFMAAAYIAATWTILPGGPSTKWVLVTLVSIGGGCTMTICVGLGV 539
Query: 543 LLARHWLRKWEWRKMKEKNR--SPNSSI-SRVEELRMMKKTSHES-SNSDLDSSDQGGYH 598
LL +HWLRKWEW+K K KN+ SP+SS+ SRV E++ +K+ H+S SNSD+DSS++GGYH
Sbjct: 540 LLIQHWLRKWEWKKTKRKNKDGSPHSSMNSRVGEMQTIKRGDHDSTSNSDVDSSEKGGYH 599
Query: 599 LY 600
LY
Sbjct: 600 LY 601
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224142976|ref|XP_002324803.1| predicted protein [Populus trichocarpa] gi|222866237|gb|EEF03368.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255550978|ref|XP_002516537.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223544357|gb|EEF45878.1| ankyrin repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147765315|emb|CAN66947.1| hypothetical protein VITISV_020094 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225430027|ref|XP_002281561.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081888|emb|CBI20893.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081857|emb|CBI20862.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147812174|emb|CAN61518.1| hypothetical protein VITISV_033967 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743226|emb|CBI36093.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224059128|ref|XP_002299729.1| predicted protein [Populus trichocarpa] gi|222846987|gb|EEE84534.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 600 | ||||||
| TAIR|locus:2012873 | 578 | AT1G10340 "AT1G10340" [Arabido | 0.256 | 0.266 | 0.484 | 8.8e-69 | |
| TAIR|locus:2046628 | 601 | AT2G24600 "AT2G24600" [Arabido | 0.888 | 0.886 | 0.304 | 2e-65 | |
| TAIR|locus:2009046 | 573 | AT1G34050 "AT1G34050" [Arabido | 0.511 | 0.535 | 0.288 | 6.3e-55 | |
| TAIR|locus:2157553 | 598 | AT5G54710 "AT5G54710" [Arabido | 0.843 | 0.846 | 0.269 | 2.7e-52 | |
| TAIR|locus:2026489 | 543 | AT1G07710 "AT1G07710" [Arabido | 0.785 | 0.867 | 0.268 | 1.5e-42 | |
| TAIR|locus:2045233 | 662 | AT2G31820 [Arabidopsis thalian | 0.793 | 0.719 | 0.255 | 2.2e-40 | |
| TAIR|locus:2181768 | 524 | ANK1 "ankyrin-like1" [Arabidop | 0.816 | 0.935 | 0.253 | 4.2e-40 | |
| TAIR|locus:2092522 | 590 | ITN1 "INCREASED TOLERANCE TO N | 0.843 | 0.857 | 0.265 | 5.3e-40 | |
| TAIR|locus:2031948 | 627 | AT1G05640 "AT1G05640" [Arabido | 0.791 | 0.757 | 0.261 | 6.7e-39 | |
| TAIR|locus:2075009 | 607 | AT3G09550 [Arabidopsis thalian | 0.746 | 0.738 | 0.262 | 1.3e-38 |
| TAIR|locus:2012873 AT1G10340 "AT1G10340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 380 (138.8 bits), Expect = 8.8e-69, Sum P(2) = 8.8e-69
Identities = 76/157 (48%), Positives = 97/157 (61%)
Query: 398 QIELQTEGLRNARKXXXXXXXXXXXXXXXXGINPPGGFNQVS---GKSLVGKQTSFKVFM 454
+ ++ E L+NAR GINPPGG Q GKSLVGK T+FKVF
Sbjct: 393 EYQMHIEALQNARNTIAIVAVLIASVAYAGGINPPGGVYQDGPWRGKSLVGKTTAFKVFA 452
Query: 455 VCNIVALFLSLGIVIFLVSIIPFQRKSMMQLLVVTHRVMWLSVSFLAAAYIAAIWTILPR 514
+CN +ALF SLGIVI LVSIIP++RK + +LLV THR+MW+SV F+A AYIAA W +P
Sbjct: 453 ICNNIALFTSLGIVILLVSIIPYKRKPLKRLLVATHRMMWVSVGFMATAYIAASWVTIPH 512
Query: 515 GRGMVWVSAAVVSLGGGFTLAIFTGLGVLLARHWLRK 551
G W+ A+V++ GG +F LGV HW +K
Sbjct: 513 YHGTQWLFPAIVAVAGGALTVLFFYLGVETIGHWFKK 549
|
|
| TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157553 AT5G54710 "AT5G54710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00032438001 | SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (593 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 600 | |||
| pfam13962 | 114 | pfam13962, PGG, Domain of unknown function | 9e-35 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 5e-28 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 3e-25 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-19 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-17 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-15 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-15 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 6e-14 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-13 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 1e-12 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-12 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-12 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-10 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 2e-10 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 5e-10 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 3e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 5e-08 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-07 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 2e-07 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 2e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 5e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 6e-07 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 7e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 8e-07 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 8e-07 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 1e-06 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 3e-06 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 3e-06 | |
| PHA02859 | 209 | PHA02859, PHA02859, ankyrin repeat protein; Provis | 3e-06 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 6e-06 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 8e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-05 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-05 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 1e-05 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 2e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 2e-05 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 5e-05 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 5e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 6e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 2e-04 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 3e-04 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 6e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 7e-04 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 9e-04 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 0.002 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 0.004 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.004 |
| >gnl|CDD|222475 pfam13962, PGG, Domain of unknown function | Back alignment and domain information |
|---|
Score = 126 bits (320), Expect = 9e-35
Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 7/114 (6%)
Query: 404 EGLRNARKTIIIVAVLIATVTFAAGINPPGGFNQVSGKS------LVGKQTSFKVFMVCN 457
E L R ++++VA LIATVTFAAG PPGG+ Q G L GK FK F V N
Sbjct: 2 EWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVSN 61
Query: 458 IVALFLSLGIVIFLVSIIPFQRKSMMQLLVVTHRVMWLSVSFLAAAYIAAIWTI 511
+A SL VI L+ I+P + + +LL + ++WLS+ L A+ A + +
Sbjct: 62 TIAFVASLVAVILLLYIVPSFSRRLPRLLAL-LTLLWLSLLSLMVAFAAGSYRV 114
|
The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 100.0 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 100.0 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 100.0 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 100.0 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 100.0 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.98 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.97 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.96 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.96 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.94 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.93 | |
| PF13962 | 113 | PGG: Domain of unknown function | 99.93 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.93 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.92 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.92 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.92 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.92 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.9 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.9 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.9 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.9 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.9 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.89 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.86 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.86 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.84 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.83 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.82 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.8 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.78 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.78 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.77 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.75 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.75 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.74 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.74 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.73 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.72 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.7 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.7 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.66 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.61 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.6 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.56 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.55 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.54 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.39 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.39 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.38 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.29 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.29 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.28 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.25 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.23 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.15 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.14 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.13 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.08 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.05 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.95 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.69 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.67 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.65 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.43 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.42 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.42 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.33 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.32 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.3 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.25 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.22 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.21 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.2 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.1 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.09 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.07 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.0 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.72 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.68 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.6 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.49 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.49 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.32 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.21 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.17 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.94 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.48 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.38 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 94.91 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 93.95 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 93.86 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 93.31 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 92.42 | |
| cd07920 | 322 | Pumilio Pumilio-family RNA binding domain. Puf rep | 91.84 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 87.43 | |
| cd07920 | 322 | Pumilio Pumilio-family RNA binding domain. Puf rep | 86.46 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 82.38 |
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-42 Score=356.31 Aligned_cols=314 Identities=26% Similarity=0.353 Sum_probs=272.4
Q ss_pred ccCccccHHHHHHHHcCCHHHHHHHHhhchhhhhccCCCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhccCCCCCcHhH
Q 007515 5 AINPYMERHLFETILRGDTQAFLSLIQQDEAKIKQTVPGSLNTILHLTARFGHEELASEILKLCPEMVAAENEKMETPLH 84 (600)
Q Consensus 5 ~~~~~~~~~L~~A~~~gd~~~~~~ll~~~~~~l~~~~~~~g~T~Lh~Aa~~g~~e~v~~Ll~~~~~~l~~~n~~g~TpLh 84 (600)
+.+......|+.|+..+-++.++.+++.+... ...+..+.+|||+|+..|+.+..+.|++++.+ ++..|+.|.||||
T Consensus 83 a~D~~~n~~l~~a~~~~~~~~i~~Lls~gad~--~~~n~~~~aplh~A~~~~~~s~L~~Ll~~~~d-vnl~de~~~TpLh 159 (929)
T KOG0510|consen 83 AKDSADNTPLHAAVEYNQGDKIQVLLSYGADT--PLRNLNKNAPLHLAADSGNYSCLKLLLDYGAD-VNLEDENGFTPLH 159 (929)
T ss_pred hhhcccCchhHHHhhcchHHHHHHHHhcCCCC--ChhhhhccCchhhccccchHHHHHHHHHhcCC-ccccccCCCchhh
Confidence 34566778889999999999999999887654 34566789999999999999999999999966 8999999999999
Q ss_pred HHHHcCCHHHHHHHHhCCcccccccCCCCCcHHHHHHHhCCHHHHHHHHh-----CCcccccccCCCChHHHHHHhcCCH
Q 007515 85 EACREGRLNFVKLFVGIDPSVIYKLNRDNESVLYVACERGRLDVAKQLLN-----YSSLLILEVDGLTTSLHVSAMAGHL 159 (600)
Q Consensus 85 ~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~e~v~~Ll~-----~~~~~~~~~~~~~t~Lh~A~~~g~~ 159 (600)
+||+.++.|..+.|++.++++ .+.|.+|.+|+|.|+.+|..|+.+..+. ....++..+.++.+|||.|+..|+.
T Consensus 160 ~A~~~~~~E~~k~Li~~~a~~-~K~~~~~~~~iH~aa~s~s~e~mEi~l~~~g~~r~~~in~~~n~~~~pLhlAve~g~~ 238 (929)
T KOG0510|consen 160 LAARKNKVEAKKELINKGADP-CKSDIDGNFPIHEAARSGSKECMEIFLPEHGYERQTHINFDNNEKATPLHLAVEGGDI 238 (929)
T ss_pred HHHhcChHHHHHHHHhcCCCC-CcccCcCCchHHHHHHhcchhhhhhhhccccchhhcccccccCCCCcchhhhhhcCCH
Confidence 999999999889999999887 5568999999999999999999999988 5566777788888999999999999
Q ss_pred HHHHHHHhcCccc--------------cccCCCCCChHHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCCCHHHHHHHcC
Q 007515 160 DIVKELLEARQEF--------------AWKKDLNGHTPLHLSCSKGHLEITRELLKLDPDLSSLPDNEGRTPLHWAAIKG 225 (600)
Q Consensus 160 ~~v~~Ll~~~~~~--------------~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~Aa~~g 225 (600)
++++.+|+.+... .+..|.+|+||||+||+.|+.+.++.|+..|+++.. ++.++.||||.||..|
T Consensus 239 e~lk~~L~n~~~~a~~~~~~~~q~kelv~~~d~dg~tpLH~a~r~G~~~svd~Ll~~Ga~I~~-kn~d~~spLH~AA~yg 317 (929)
T KOG0510|consen 239 EMLKMCLQNGKKIADVQLDAMQQEKELVNDEDNDGCTPLHYAARQGGPESVDNLLGFGASINS-KNKDEESPLHFAAIYG 317 (929)
T ss_pred HHHHHHHhCccccchhhhHHHHHHHHHhhcccccCCchHHHHHHcCChhHHHHHHHcCCcccc-cCCCCCCchHHHHHcc
Confidence 9999999876533 245788999999999999999999999999999876 7889999999999999
Q ss_pred CHHHHHHHHh-ccccccccccccccchhhHhHhcCchhHHHHHHHhcccccccCCCCCCCChHhHHHHhCCcHHHHHHHH
Q 007515 226 RINIIDEILS-LNLQSAEMRTIHGETVLHLTVKNNQYEAVKYLMETLNITKLANMPDNDGNTILHLATAGKLTTMVIYLL 304 (600)
Q Consensus 226 ~~~~v~~Ll~-~~~~~~~~~~~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~~n~~d~~G~T~Lh~A~~~~~~~iv~~Ll 304 (600)
+.+.++.||+ .+....+..|..|.||||+|+++|+..+++.|++++.........|.+|+||||+|+..|+..+|+.|+
T Consensus 318 ~~ntv~rLL~~~~~rllne~D~~g~tpLHlaa~~gH~~v~qlLl~~GA~~~~~~e~D~dg~TaLH~Aa~~g~~~av~~Li 397 (929)
T KOG0510|consen 318 RINTVERLLQESDTRLLNESDLHGMTPLHLAAKSGHDRVVQLLLNKGALFLNMSEADSDGNTALHLAAKYGNTSAVQKLI 397 (929)
T ss_pred cHHHHHHHHhCcCccccccccccCCCchhhhhhcCHHHHHHHHHhcChhhhcccccccCCchhhhHHHHhccHHHHHHHH
Confidence 9999999999 454566778889999999999999999999999984332111156999999999999999999999999
Q ss_pred hcCCCcccccCCCCCHHHH
Q 007515 305 KLGVDVNAINRKGYTALDV 323 (600)
Q Consensus 305 ~~gad~n~~n~~G~T~l~~ 323 (600)
.+||++..+|++|.|++|+
T Consensus 398 ~~Ga~I~~~n~~g~SA~~~ 416 (929)
T KOG0510|consen 398 SHGADIGVKNKKGKSAFDT 416 (929)
T ss_pred HcCCceeeccccccccccc
Confidence 9999999999999999995
|
|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13962 PGG: Domain of unknown function | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >cd07920 Pumilio Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >cd07920 Pumilio Pumilio-family RNA binding domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 600 | ||||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 7e-19 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-14 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 5e-12 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 1e-11 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 2e-05 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 2e-10 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 1e-04 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 2e-10 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 7e-09 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-10 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-08 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-10 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 4e-08 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 5e-08 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-10 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-08 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-10 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 7e-10 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 1e-09 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 2e-09 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 3e-08 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-09 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-09 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 3e-09 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 3e-08 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 4e-09 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-09 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-09 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-09 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 5e-09 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 7e-09 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 2e-07 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 8e-09 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 2e-07 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 1e-08 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-08 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-08 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-07 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 7e-08 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 1e-06 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 8e-08 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 1e-06 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 1e-07 | ||
| 1ikn_D | 236 | IkappabalphaNF-Kappab Complex Length = 236 | 2e-07 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 2e-07 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 4e-07 | ||
| 1nfi_E | 213 | I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | 2e-07 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 2e-07 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 4e-07 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-07 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 2e-07 | ||
| 3f6q_A | 179 | Crystal Structure Of Integrin-Linked Kinase Ankyrin | 5e-07 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 5e-07 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 5e-07 | ||
| 2kbx_A | 171 | Solution Structure Of Ilk-Pinch Complex Length = 17 | 6e-07 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 8e-07 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 5e-06 | ||
| 1ixv_A | 231 | Crystal Structure Analysis Of Homolog Of Oncoprotei | 8e-06 | ||
| 2dzn_A | 228 | Crystal Structure Analysis Of Yeast Nas6p Complexed | 8e-06 | ||
| 1wg0_A | 243 | Structural Comparison Of Nas6p Protein Structures I | 9e-06 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 1e-05 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 3e-05 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 2e-05 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 1e-04 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 2e-05 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 3e-05 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 4e-05 | ||
| 3zkj_A | 261 | Crystal Structure Of Ankyrin Repeat And Socs Box-co | 3e-05 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 3e-05 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 3e-05 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 3e-05 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-05 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 5e-05 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 6e-05 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 6e-05 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 8e-05 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 3e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 1e-04 | ||
| 1k1b_A | 241 | Crystal Structure Of The Ankyrin Repeat Domain Of B | 4e-04 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 5e-04 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 5e-04 | ||
| 4a63_B | 239 | Crystal Structure Of The P73-Aspp2 Complex At 2.6a | 6e-04 | ||
| 1ycs_B | 239 | P53-53bp2 Complex Length = 239 | 6e-04 |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
|
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 | Back alignment and structure |
| >pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 | Back alignment and structure |
| >pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 | Back alignment and structure |
| >pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 600 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-54 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-53 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-53 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-53 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-52 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 7e-49 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-43 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-08 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-48 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-47 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 2e-46 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-35 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 7e-47 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-36 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 4e-33 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-27 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-05 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 2e-46 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-45 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-39 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-44 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-39 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-34 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-28 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-26 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 9e-44 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-41 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-40 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-39 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-16 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-43 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-35 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-28 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-41 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 9e-40 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-35 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 3e-21 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 5e-41 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-40 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-37 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-31 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-29 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-21 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 1e-12 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-41 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-38 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 1e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-40 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-33 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-28 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-40 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-39 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-39 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 8e-09 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-39 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-39 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-37 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 9e-07 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-39 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-34 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 1e-29 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-39 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-30 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 6e-18 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-09 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-38 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 8e-37 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-35 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 6e-16 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-37 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-33 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-30 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-28 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-37 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-33 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 5e-33 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-31 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 6e-25 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-13 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-35 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-33 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-32 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-26 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 8e-18 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 9e-08 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-34 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-34 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 9e-32 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-29 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-26 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-22 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-33 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-25 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-18 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 9e-09 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-05 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-33 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 2e-32 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-28 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-14 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-32 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 5e-29 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 8e-27 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-26 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-26 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 6e-13 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 7e-06 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-32 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 9e-28 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-27 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 2e-27 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-21 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-21 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-31 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-28 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-27 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 4e-24 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-18 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 4e-10 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-31 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 7e-29 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 8e-25 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 3e-17 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 9e-29 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-26 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 8e-17 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 6e-05 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-28 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 6e-18 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 6e-13 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-28 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-23 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-21 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 8e-12 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-10 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-07 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 3e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 5e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-28 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-22 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 6e-22 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 5e-28 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-24 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-24 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-22 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 8e-12 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 5e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-27 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 4e-27 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 4e-27 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-08 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 2e-27 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-23 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-23 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 8e-13 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-27 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-25 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-24 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-23 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 4e-20 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-04 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-27 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-19 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 9e-09 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-08 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 3e-06 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-27 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-26 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 8e-25 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-21 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 7e-19 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-26 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-24 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 8e-10 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-05 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-26 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-26 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 9e-25 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 9e-23 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-07 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 8e-26 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 5e-21 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-11 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 8e-26 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 9e-25 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 4e-24 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-23 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-17 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-17 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-07 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-24 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 2e-24 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 6e-20 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-07 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-22 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-22 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-21 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-12 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 8e-11 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 5e-22 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 9e-22 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 8e-20 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-13 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 7e-22 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-20 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 6e-13 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 9e-21 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 5e-17 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-13 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 5e-09 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-08 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 6e-19 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-17 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 6e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 6e-11 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-07 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 9e-19 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 9e-18 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-16 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 1e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-05 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 3e-18 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 2e-17 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-11 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 5e-10 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-09 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-06 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-09 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 1e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 2e-06 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 6e-06 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 7e-07 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 9e-07 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 7e-06 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-04 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 4e-04 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 2e-06 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 3e-06 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 9e-04 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
Score = 190 bits (486), Expect = 1e-54
Identities = 92/308 (29%), Positives = 137/308 (44%), Gaps = 28/308 (9%)
Query: 46 NTILHLTARFGHEELASEILKLCPEMVAAENEKMETPLHEACREGRLNFVKLFV--GIDP 103
T LH+ AR GH E+A +L+ + V A+ + +TPLH A R G N VKL + +
Sbjct: 48 ETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN- 105
Query: 104 SVIYKLNRDNESVLYVACERGRLDVAKQLLNYSSLL-ILEVDGLTTSLHVSAMAGHLDIV 162
+ L++A G ++ LL + + G T LHV+A G + +
Sbjct: 106 --PNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKG-FTPLHVAAKYGKVRVA 162
Query: 163 KELLE--ARQEFAWKKDLNGHTPLHLSCSKGHLEITRELLKLDPDLSSLPDNEGRTPLHW 220
+ LLE A NG TPLH++ +L+I + LL S P G TPLH
Sbjct: 163 ELLLERDAHPN---AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS-PAWNGYTPLHI 218
Query: 221 AAIKGRINIIDEILSLNLQSA--EMRTIHGETVLHLTVKNNQYEAVKYLMET-LNITKLA 277
AA + ++ + +L ++ G T LHL + E V L+ N
Sbjct: 219 AAKQNQVEVARSLLQ---YGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG---- 271
Query: 278 NMPDNDGNTILHLATAGKLTTMVIYLLKLGVDVNAINRKGYTALDVVESDASNSGALQIV 337
N+ + G T LHL + L+K GV V+A R GYT L V AS+ G +++V
Sbjct: 272 NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHV----ASHYGNIKLV 327
Query: 338 PALEEAGA 345
L + A
Sbjct: 328 KFLLQHQA 335
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.98 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.97 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.97 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.97 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.97 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.97 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.97 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.97 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.97 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.96 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.96 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.96 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.95 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.95 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.94 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.94 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.94 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.94 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.94 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.93 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.93 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.93 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.93 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.93 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.93 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.93 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.93 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.92 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.92 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.92 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.92 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.92 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.91 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.9 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.87 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.86 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.86 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.86 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.85 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.85 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.85 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.83 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.83 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.83 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.83 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.83 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.81 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.81 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.8 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.79 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.79 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.79 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.78 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.77 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.75 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.75 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.75 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.75 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.74 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.74 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.71 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.69 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.59 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.56 |
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-48 Score=411.58 Aligned_cols=333 Identities=28% Similarity=0.349 Sum_probs=217.8
Q ss_pred ccccCccccHHHHHHHHcCCHHHHHHHHhhchhhhhccCCCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhccCCCCCcH
Q 007515 3 IEAINPYMERHLFETILRGDTQAFLSLIQQDEAKIKQTVPGSLNTILHLTARFGHEELASEILKLCPEMVAAENEKMETP 82 (600)
Q Consensus 3 ~~~~~~~~~~~L~~A~~~gd~~~~~~ll~~~~~~l~~~~~~~g~T~Lh~Aa~~g~~e~v~~Ll~~~~~~l~~~n~~g~Tp 82 (600)
++..+..+.++|+.|+..|+.+.++.+++.+.+. ...+..|.||||+||..|+.++|++|++.+.+ ++.++..|.||
T Consensus 7 ~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~--~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~-~~~~~~~g~t~ 83 (437)
T 1n11_A 7 GGGGGESGLTPLHVASFMGHLPIVKNLLQRGASP--NVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTP 83 (437)
T ss_dssp --------CCHHHHHHHHTCHHHHHHHHHTTCCS--CCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-SSCCCTTSCCH
T ss_pred ccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCC--CCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC-CCCCCCCCCCH
Confidence 4455566666777777777777777776654332 23344566666666666666666666666655 55566666666
Q ss_pred hHHHHHcCCHHHHHHHHhCCccccc--------------------------------ccCCCCCcHHHHHHHhCCHHHHH
Q 007515 83 LHEACREGRLNFVKLFVGIDPSVIY--------------------------------KLNRDNESVLYVACERGRLDVAK 130 (600)
Q Consensus 83 Lh~Aa~~g~~~iv~~Ll~~~~~~~~--------------------------------~~~~~g~tpL~~A~~~g~~e~v~ 130 (600)
||+|+..|+.++|++|++.++++.. ..+..|.||||+|+..|+.++++
T Consensus 84 L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~ 163 (437)
T 1n11_A 84 LHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAE 163 (437)
T ss_dssp HHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHH
T ss_pred HHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHH
Confidence 6666666666666666665554421 12334444555555555555555
Q ss_pred HHHhCCcccccccCCCChHHHHHHhcCCHHHHHHHHhcCccccccCCCCCChHHHHHHhcCcHHHHHHHHhcCCCCCCCC
Q 007515 131 QLLNYSSLLILEVDGLTTSLHVSAMAGHLDIVKELLEARQEFAWKKDLNGHTPLHLSCSKGHLEITRELLKLDPDLSSLP 210 (600)
Q Consensus 131 ~Ll~~~~~~~~~~~~~~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~ 210 (600)
+|++++.+++..+..+.||||.|+..|+.+++++|++.+.+.. ..+.+|.||||+|+..|+.+++++|++.++++.. .
T Consensus 164 ~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~-~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~-~ 241 (437)
T 1n11_A 164 LLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH-SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA-E 241 (437)
T ss_dssp HHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSC-CCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTC-C
T ss_pred HHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-CcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCC-C
Confidence 5555554444444445555555555555555555555555443 4455566666666666666666666666666543 5
Q ss_pred CCCCCCHHHHHHHcCCHHHHHHHHhccccccccccccccchhhHhHhcCchhHHHHHHHhcccccccCCCCCCCChHhHH
Q 007515 211 DNEGRTPLHWAAIKGRINIIDEILSLNLQSAEMRTIHGETVLHLTVKNNQYEAVKYLMETLNITKLANMPDNDGNTILHL 290 (600)
Q Consensus 211 d~~g~tpL~~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~~n~~d~~G~T~Lh~ 290 (600)
+..|.||||+|+..|+.+++++|++.+ ...+..+..|.||||+|+..|+.+++++|++. +..+|.+|..|+||||+
T Consensus 242 ~~~g~t~L~~A~~~g~~~~v~~Ll~~~-~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~---g~~~~~~~~~g~t~L~~ 317 (437)
T 1n11_A 242 SVQGVTPLHLAAQEGHAEMVALLLSKQ-ANGNLGNKSGLTPLHLVAQEGHVPVADVLIKH---GVMVDATTRMGYTPLHV 317 (437)
T ss_dssp CTTCCCHHHHHHHTTCHHHHHHHHTTT-CCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHH---TCCTTCCCSSCCCHHHH
T ss_pred CCCCCCHHHHHHHCCCHHHHHHHHhcC-CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC---CccCCCCCCCCCCHHHH
Confidence 666777777777777777777777765 34566677778888888888888888888776 55678888999999999
Q ss_pred HHhCCcHHHHHHHHhcCCCcccccCCCCCHHHHHhhhcCCcchhhHHHHHHHhccccc
Q 007515 291 ATAGKLTTMVIYLLKLGVDVNAINRKGYTALDVVESDASNSGALQIVPALEEAGARRC 348 (600)
Q Consensus 291 A~~~~~~~iv~~Ll~~gad~n~~n~~G~T~l~~a~~~a~~~~~~~i~~~L~~~ga~~~ 348 (600)
|+..|+.+++++|+++|+++|.+|..|.|||++|.. .++.+++++|+++|+++.
T Consensus 318 A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~----~g~~~iv~~Ll~~ga~~~ 371 (437)
T 1n11_A 318 ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQ----QGHTDIVTLLLKNGASPN 371 (437)
T ss_dssp HHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHH----TTCHHHHHHHHHTTCCSC
T ss_pred HHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHH----CChHHHHHHHHHCcCCCC
Confidence 999999999999999999999999999999998654 467889999999998754
|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 600 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-31 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-31 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-29 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-26 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-22 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 8e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-30 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-28 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-18 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 6e-14 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-24 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 7e-21 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 7e-12 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-11 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 6e-24 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 1e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-23 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-21 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 7e-17 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-19 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-17 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-16 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 1e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-17 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-15 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-17 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-12 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 3e-05 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.001 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-16 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-15 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 6e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-07 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-16 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 6e-14 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-10 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-14 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 7e-14 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 1e-13 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-09 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 6e-14 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 3e-11 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 6e-10 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-08 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 6e-08 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 7e-07 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 2e-04 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 7e-08 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 2e-07 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 2e-06 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 3e-05 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 0.001 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 3e-07 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 8e-06 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 5e-07 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 6e-07 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 3e-06 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 9e-06 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 2e-05 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 7e-05 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 1e-05 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 6e-05 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 9e-05 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 2e-05 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 2e-05 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 1e-04 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 0.001 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 2e-04 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 0.002 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 0.004 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 123 bits (308), Expect = 5e-31
Identities = 83/308 (26%), Positives = 123/308 (39%), Gaps = 41/308 (13%)
Query: 47 TILHLTARFGHEELASEILKLCPEMVAAENEKMETPLHEACREGRLNFVKLFVGIDPSVI 106
T LH+ + GH + +L+ N K+ETPLH A R G K + V
Sbjct: 2 TPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 60
Query: 107 YKLNRDNESVLYVACERGRLDVAKQLLNYSSLLILEVDGLTTS----------------- 149
K +D+++ L+ A G ++ K LL ++ L T
Sbjct: 61 AK-AKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119
Query: 150 ----------------LHVSAMAGHLDIVKELLEARQEFAWKKDLNGHTPLHLSCSKGHL 193
LHV+A G + + + LLE NG TPLH++ +L
Sbjct: 120 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNNL 178
Query: 194 EITRELLKLDPDLSSLPDNEGRTPLHWAAIKGRINIIDEILSLNLQSAEMRTIHGETVLH 253
+I + LL S P G TPLH AA + ++ + +L SA ++ G T LH
Sbjct: 179 DIVKLLLPRGGSPHS-PAWNGYTPLHIAAKQNQVEVARSLLQ-YGGSANAESVQGVTPLH 236
Query: 254 LTVKNNQYEAVKYLMETLNITKLANMPDNDGNTILHLATAGKLTTMVIYLLKLGVDVNAI 313
L + E V L+ + N+ + G T LHL + L+K GV V+A
Sbjct: 237 LAAQEGHAEMVALLL---SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDAT 293
Query: 314 NRKGYTAL 321
R GYT L
Sbjct: 294 TRMGYTPL 301
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 600 | |||
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 100.0 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.98 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.97 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.97 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.97 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.97 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.94 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.94 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.93 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.92 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.91 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.91 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.9 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.9 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.9 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.89 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.89 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.85 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.84 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.83 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.81 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.8 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.78 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.74 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.4e-42 Score=357.67 Aligned_cols=320 Identities=28% Similarity=0.359 Sum_probs=270.9
Q ss_pred HHHHHHHHcCCHHHHHHHHhhchhhhhccCCCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhccCCCCCcHhHHHHHcCC
Q 007515 12 RHLFETILRGDTQAFLSLIQQDEAKIKQTVPGSLNTILHLTARFGHEELASEILKLCPEMVAAENEKMETPLHEACREGR 91 (600)
Q Consensus 12 ~~L~~A~~~gd~~~~~~ll~~~~~~l~~~~~~~g~T~Lh~Aa~~g~~e~v~~Ll~~~~~~l~~~n~~g~TpLh~Aa~~g~ 91 (600)
++|+.|+..||.+.++.+++.+.+. ...+..|+||||+||..|+.++|++|++.|.+ ++.+|..|.||||+|+..|+
T Consensus 2 TpL~~Aa~~g~~~~v~~Ll~~g~~i--n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad-i~~~~~~g~t~L~~A~~~g~ 78 (408)
T d1n11a_ 2 TPLHVASFMGHLPIVKNLLQRGASP--NVSNVKVETPLHMAARAGHTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGH 78 (408)
T ss_dssp CHHHHHHHHTCHHHHHHHHHTTCCS--CCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCC-SSCCCTTSCCHHHHHHHHTC
T ss_pred ChHHHHHHCcCHHHHHHHHHCCCCC--CCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCC
Confidence 5799999999999999999987553 34578899999999999999999999999987 89999999999999999999
Q ss_pred HHHHHHHHhCCccc--------------------------------ccccCCCCCcHHHHHHHhCCHHHHHHHHhCCccc
Q 007515 92 LNFVKLFVGIDPSV--------------------------------IYKLNRDNESVLYVACERGRLDVAKQLLNYSSLL 139 (600)
Q Consensus 92 ~~iv~~Ll~~~~~~--------------------------------~~~~~~~g~tpL~~A~~~g~~e~v~~Ll~~~~~~ 139 (600)
.+++++|+...++. ....+..+.++++.|+..++.+++++|++++.++
T Consensus 79 ~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~ 158 (408)
T d1n11a_ 79 TNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP 158 (408)
T ss_dssp HHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT
T ss_pred HHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCC
Confidence 99999998544321 1234667888999999999999999999998888
Q ss_pred ccccCCCChHHHHHHhcCCHHHHHHHHhcCcccc--------------------------------ccCCCCCChHHHHH
Q 007515 140 ILEVDGLTTSLHVSAMAGHLDIVKELLEARQEFA--------------------------------WKKDLNGHTPLHLS 187 (600)
Q Consensus 140 ~~~~~~~~t~Lh~A~~~g~~~~v~~Ll~~~~~~~--------------------------------~~~d~~g~tpLh~A 187 (600)
+..+..+.+|||.|+..|+.++++.|++.+.++. ...+..|.||||+|
T Consensus 159 ~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a 238 (408)
T d1n11a_ 159 NAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLA 238 (408)
T ss_dssp TCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHH
T ss_pred CcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHH
Confidence 8777778889999999999999999988776543 12344566677777
Q ss_pred HhcCcHHHHHHHHhcCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhccccccccccccccchhhHhHhcCchhHHHHH
Q 007515 188 CSKGHLEITRELLKLDPDLSSLPDNEGRTPLHWAAIKGRINIIDEILSLNLQSAEMRTIHGETVLHLTVKNNQYEAVKYL 267 (600)
Q Consensus 188 ~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpL~~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~Lh~Av~~~~~~iv~~L 267 (600)
+..++.++++.+++.+..... .+..|.||++.|+..++.+++++|++.+ ...+..+..+.||||.++..++.++++++
T Consensus 239 ~~~~~~~~~~~~~~~~~~~~~-~~~~g~~~l~~a~~~~~~~i~~~Ll~~g-~~~~~~~~~~~t~L~~~~~~~~~~~~~~l 316 (408)
T d1n11a_ 239 AQEGHAEMVALLLSKQANGNL-GNKSGLTPLHLVAQEGHVPVADVLIKHG-VMVDATTRMGYTPLHVASHYGNIKLVKFL 316 (408)
T ss_dssp HHTTCHHHHHHHHTTTCCTTC-CCTTCCCHHHHHHHHTCHHHHHHHHHHT-CCTTCCCSSCCCHHHHHHHSSCSHHHHHH
T ss_pred HHhCcHhHhhhhhcccccccc-ccCCCCChhhhhhhcCcHHHHHHHHHCC-CccccccccccccchhhcccCcceeeeee
Confidence 777777888888887776654 6778899999999999999999999876 45667777889999999999999999999
Q ss_pred HHhcccccccCCCCCCCChHhHHHHhCCcHHHHHHHHhcCCCcccccCCCCCHHHHHhhhcCCcchhhHHHHHHHh
Q 007515 268 METLNITKLANMPDNDGNTILHLATAGKLTTMVIYLLKLGVDVNAINRKGYTALDVVESDASNSGALQIVPALEEA 343 (600)
Q Consensus 268 l~~~~~~~~~n~~d~~G~T~Lh~A~~~~~~~iv~~Ll~~gad~n~~n~~G~T~l~~a~~~a~~~~~~~i~~~L~~~ 343 (600)
++. +.++|.+|.+|+||||+|++.|+.++|++|+++|||+|.+|++|+|||++|.. .++.+++++|...
T Consensus 317 l~~---g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~----~~~~~iv~~L~~~ 385 (408)
T d1n11a_ 317 LQH---QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKR----LGYISVTDVLKVV 385 (408)
T ss_dssp HHT---TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHH----TTCHHHHHHHHHH
T ss_pred ccc---cccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH----cCCHHHHHHHHHH
Confidence 886 66799999999999999999999999999999999999999999999999654 4677888877544
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|