Citrus Sinensis ID: 007574
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FJX0 | 595 | Peptidyl-prolyl cis-trans | yes | no | 0.989 | 0.993 | 0.775 | 0.0 | |
| Q9D787 | 521 | Peptidyl-prolyl cis-trans | yes | no | 0.860 | 0.986 | 0.450 | 1e-127 | |
| Q13356 | 520 | Peptidyl-prolyl cis-trans | yes | no | 0.865 | 0.994 | 0.443 | 1e-123 | |
| Q5AXT6 | 580 | Peptidyl-prolyl cis-trans | yes | no | 0.899 | 0.925 | 0.400 | 1e-115 | |
| Q4WVU5 | 579 | Peptidyl-prolyl cis-trans | yes | no | 0.847 | 0.873 | 0.409 | 1e-112 | |
| Q2U5W8 | 570 | Peptidyl-prolyl cis-trans | yes | no | 0.840 | 0.880 | 0.391 | 1e-105 | |
| P0CP90 | 573 | Peptidyl-prolyl cis-trans | yes | no | 0.874 | 0.910 | 0.375 | 3e-96 | |
| P0CP91 | 573 | Peptidyl-prolyl cis-trans | N/A | no | 0.874 | 0.910 | 0.375 | 3e-96 | |
| Q4IBK5 | 588 | Peptidyl-prolyl cis-trans | yes | no | 0.850 | 0.863 | 0.360 | 4e-95 | |
| Q7RXA6 | 597 | Peptidyl-prolyl cis-trans | N/A | no | 0.767 | 0.767 | 0.374 | 3e-89 |
| >sp|Q9FJX0|PPIL2_ARATH Peptidyl-prolyl cis-trans isomerase-like 2 OS=Arabidopsis thaliana GN=PUB49 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 931 bits (2405), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 466/601 (77%), Positives = 522/601 (86%), Gaps = 10/601 (1%)
Query: 1 MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
MGKKQHSKDRMFITKTEWATEWGGAKSKE RTPFK LP+YCCALTF PFEDPVCT DGSV
Sbjct: 1 MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSV 60
Query: 61 FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
FE+ +I PYIRK+GKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct: 61 FEITTIVPYIRKFGKHPVTGAPLKGEDLIPLIFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120
Query: 121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
TTGNVFC+EAIKELNIKTKNWKELLT+EPFT+ DLITIQNPNA+D KVT+EFDHVK GLK
Sbjct: 121 TTGNVFCYEAIKELNIKTKNWKELLTEEPFTRADLITIQNPNAVDGKVTVEFDHVKNGLK 180
Query: 181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAIL 240
+DDEEL+KM SDP YNINV+GDIK ML +LGT+K +E AL GGGG+KA+ ERAAA+AAIL
Sbjct: 181 IDDEELKKMNSDPAYNINVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAIL 240
Query: 241 AARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAG 300
+RS+I+E SK++ + + +S+VDAASASV GRSA AAK SSDKTAARIAMHMAG
Sbjct: 241 ESRSKIKEVSKAE-----QPKQTYSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAG 295
Query: 301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
+RTPVN+K+VKSRY++GAASRSFTS+A+ PVT N+FE IKVEKNPKKKGYVQ TTHGDL
Sbjct: 296 DRTPVNSKMVKSRYSSGAASRSFTSSAFTPVTKNDFELIKVEKNPKKKGYVQFQTTHGDL 355
Query: 361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFK 420
NIELHCDI PR+CENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTG+GGESIWGKPFK
Sbjct: 356 NIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGKGGESIWGKPFK 415
Query: 421 DEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAME 480
DE NSKLLHSGRGVVSMANSGPHTNGSQFF+LYKSATHLNYKHTVFGGVVGGL TLAAME
Sbjct: 416 DEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGGLATLAAME 475
Query: 481 KVPVDENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNAEDEDKDKVGSWYSNPG 540
VPVDE+DRPLEEIKI +VFVNPY+E +EEEE++ +++ ED+D +K+GSWYSNPG
Sbjct: 476 NVPVDESDRPLEEIKIIEASVFVNPYTE-LDEEEEKEKAEKEKNEDKDIEKIGSWYSNPG 534
Query: 541 TGTQAGAVGGGGVGKYLKARS--APIDSAAD-DGGLTAIATAKKRKVGVSAGE-FKDFSG 596
+GT GGGGVGKYLKA S A D+ D ++ I +KKRK SA FKDFS
Sbjct: 535 SGTTEAGAGGGGVGKYLKAMSSTATKDTKGSLDSDISTIGVSKKRKTTASASTGFKDFSS 594
Query: 597 W 597
W
Sbjct: 595 W 595
|
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Arabidopsis thaliana (taxid: 3702) EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8 |
| >sp|Q9D787|PPIL2_MOUSE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Mus musculus GN=Ppil2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q13356|PPIL2_HUMAN Peptidyl-prolyl cis-trans isomerase-like 2 OS=Homo sapiens GN=PPIL2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5AXT6|PPIL2_EMENI Peptidyl-prolyl cis-trans isomerase-like 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4WVU5|PPIL2_ASPFU Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp8 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q2U5W8|PPIL2_ASPOR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0CP90|PPIL2_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0CP91|PPIL2_CRYNB Peptidyl-prolyl cis-trans isomerase-like 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4IBK5|PPIL2_GIBZE Peptidyl-prolyl cis-trans isomerase-like 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP8 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7RXA6|PPIL2_NEUCR Peptidyl-prolyl cis-trans isomerase-like 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-8 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | ||||||
| 255568603 | 599 | cyclophilin-10, putative [Ricinus commun | 1.0 | 0.996 | 0.854 | 0.0 | |
| 359480543 | 597 | PREDICTED: peptidyl-prolyl cis-trans iso | 1.0 | 1.0 | 0.832 | 0.0 | |
| 356496987 | 597 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.996 | 0.996 | 0.831 | 0.0 | |
| 449525478 | 592 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.991 | 1.0 | 0.830 | 0.0 | |
| 356541623 | 597 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.996 | 0.996 | 0.823 | 0.0 | |
| 357482585 | 603 | Peptidyl-prolyl cis-trans isomerase-like | 0.986 | 0.976 | 0.810 | 0.0 | |
| 449448224 | 583 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.976 | 1.0 | 0.815 | 0.0 | |
| 343171886 | 593 | peptidyl-prolyl cis-trans isomerase-like | 0.991 | 0.998 | 0.801 | 0.0 | |
| 357113547 | 590 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.988 | 1.0 | 0.765 | 0.0 | |
| 343171888 | 593 | peptidyl-prolyl cis-trans isomerase-like | 0.991 | 0.998 | 0.797 | 0.0 |
| >gi|255568603|ref|XP_002525275.1| cyclophilin-10, putative [Ricinus communis] gi|223535433|gb|EEF37103.1| cyclophilin-10, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1010 bits (2612), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 512/599 (85%), Positives = 553/599 (92%), Gaps = 2/599 (0%)
Query: 1 MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
MGKKQHSKDRM+ITKTEWATEWGGAKSKEV TPFKRLPFYCCALTFTP+E PVCTADGSV
Sbjct: 1 MGKKQHSKDRMYITKTEWATEWGGAKSKEVHTPFKRLPFYCCALTFTPYESPVCTADGSV 60
Query: 61 FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
FE+M ITPYIRKYGKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct: 61 FEIMHITPYIRKYGKHPVTGAPLKQEDLIPLNFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120
Query: 121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
TTGNVFC+EAIKELNIKTKNW+ELLTDEPF+KEDLITIQNPNALDT+VTL+FDHVK+GLK
Sbjct: 121 TTGNVFCYEAIKELNIKTKNWRELLTDEPFSKEDLITIQNPNALDTRVTLDFDHVKQGLK 180
Query: 181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALAAIL 240
VDDEEL+ M SDP YNIN++GDIKQML+ELGTEKG++TAL GGGGSKAQ ERAAAL AIL
Sbjct: 181 VDDEELKHMSSDPAYNINISGDIKQMLEELGTEKGRQTALHGGGGSKAQNERAAALEAIL 240
Query: 241 AARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAG 300
AARSRI+E+SKSD+NG +K + +SIVDAASA+VHGRSA+AAK S DKTAARIAMHMAG
Sbjct: 241 AARSRIKEDSKSDSNGNSKPPQTYSIVDAASAAVHGRSAAAAKATSGDKTAARIAMHMAG 300
Query: 301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
ER PVNAKLV+SRYTTGAASRSFTST++DPVT N+FEYIKVEKNPKKKGYVQLHTTHGDL
Sbjct: 301 ERAPVNAKLVRSRYTTGAASRSFTSTSFDPVTKNDFEYIKVEKNPKKKGYVQLHTTHGDL 360
Query: 361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFK 420
NIELHCDITPR+CENFITLCE+GYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFK
Sbjct: 361 NIELHCDITPRTCENFITLCEQGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFK 420
Query: 421 DEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAME 480
DE NSKLLHSGRGVVSMANSGPHTNGSQFFILYKSA HLN+KHTVFGGVVGGLTTLA ME
Sbjct: 421 DEPNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSANHLNFKHTVFGGVVGGLTTLATME 480
Query: 481 KVPVDENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNAEDEDKDKVGSWYSNPG 540
KVPVD+NDRPLEEIKI VT+FVNPY+E DEEEE+EKAKDEK+AEDE+ DKVGSWYSNPG
Sbjct: 481 KVPVDDNDRPLEEIKIISVTIFVNPYTETDEEEEKEKAKDEKDAEDEENDKVGSWYSNPG 540
Query: 541 TGTQAGAV--GGGGVGKYLKARSAPIDSAADDGGLTAIATAKKRKVGVSAGEFKDFSGW 597
TGT GGGGVGKYLKAR++ +SAA D GLT I +KKRKV V EFKDFSGW
Sbjct: 541 TGTTESRTVGGGGGVGKYLKARNSQPESAAIDAGLTTITASKKRKVSVPTSEFKDFSGW 599
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359480543|ref|XP_002276839.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Vitis vinifera] gi|296087308|emb|CBI33682.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356496987|ref|XP_003517346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449525478|ref|XP_004169744.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356541623|ref|XP_003539273.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357482585|ref|XP_003611579.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|355512914|gb|AES94537.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449448224|ref|XP_004141866.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|343171886|gb|AEL98647.1| peptidyl-prolyl cis-trans isomerase-like protein, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
| >gi|357113547|ref|XP_003558564.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 2-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|343171888|gb|AEL98648.1| peptidyl-prolyl cis-trans isomerase-like protein, partial [Silene latifolia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 597 | ||||||
| TAIR|locus:2158636 | 595 | PUB49 "plant U-box 49" [Arabid | 0.989 | 0.993 | 0.670 | 1.4e-213 | |
| UNIPROTKB|F1NPF4 | 521 | PPIL2 "Uncharacterized protein | 0.363 | 0.416 | 0.506 | 1.3e-119 | |
| RGD|1309484 | 521 | Ppil2 "peptidylprolyl isomeras | 0.363 | 0.416 | 0.493 | 7e-113 | |
| MGI|MGI:2447857 | 521 | Ppil2 "peptidylprolyl isomeras | 0.363 | 0.416 | 0.493 | 1.1e-112 | |
| UNIPROTKB|F1RL00 | 522 | PPIL2 "Uncharacterized protein | 0.346 | 0.396 | 0.535 | 6.2e-112 | |
| UNIPROTKB|Q13356 | 520 | PPIL2 "Peptidyl-prolyl cis-tra | 0.363 | 0.417 | 0.502 | 6.2e-112 | |
| UNIPROTKB|E2RE23 | 523 | PPIL2 "Uncharacterized protein | 0.485 | 0.554 | 0.423 | 6.2e-112 | |
| ZFIN|ZDB-GENE-040426-1096 | 524 | ppil2 "peptidylprolyl isomeras | 0.363 | 0.414 | 0.511 | 9e-111 | |
| UNIPROTKB|Q2T9V1 | 554 | PPIL2 "Uncharacterized protein | 0.346 | 0.373 | 0.520 | 1.3e-109 | |
| FB|FBgn0034109 | 517 | CG7747 [Drosophila melanogaste | 0.335 | 0.386 | 0.519 | 2.7e-107 |
| TAIR|locus:2158636 PUB49 "plant U-box 49" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2064 (731.6 bits), Expect = 1.4e-213, P = 1.4e-213
Identities = 403/601 (67%), Positives = 442/601 (73%)
Query: 1 MGKKQHSKDRMFITKTEWATEWGGAKSKEVRTPFKRLPFYCCALTFTPFEDPVCTADGSV 60
MGKKQHSKDRMFITKTEWATEWGGAKSKE RTPFK LP+YCCALTF PFEDPVCT DGSV
Sbjct: 1 MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSV 60
Query: 61 FELMSITPYIRKYGKHPVTGTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVK 120
FE+ +I PYIRK+GKHPVTG PLK EDLIPL FHKN+EGEYHCPVLNKVFTEFTHIVAVK
Sbjct: 61 FEITTIVPYIRKFGKHPVTGAPLKGEDLIPLIFHKNSEGEYHCPVLNKVFTEFTHIVAVK 120
Query: 121 TTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQNPNALDTKVTLEFDHVKKGLK 180
TTGNVFC+EAIKELNIKTKNWKELLT+EPFT+ DLITIQNPNA+D KVT+EFDHVK GLK
Sbjct: 121 TTGNVFCYEAIKELNIKTKNWKELLTEEPFTRADLITIQNPNAVDGKVTVEFDHVKNGLK 180
Query: 181 VDDEELRKMESDPTYNINVAGDIKQMLQELGTEKGQETALLGGGGXXXXXXXXXXXXXXX 240
+DDEEL+KM SDP YNINV+GDIK ML +LGT+K +E AL GGGG
Sbjct: 181 IDDEELKKMNSDPAYNINVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAIL 240
Query: 241 XXXXXXXXNSKSDANGEAKATKAFSIVDAASASVHGRXXXXXXXXXXXXXXXRIAMHMAG 300
SK++ + K T +S+VDAASASV GR RIAMHMAG
Sbjct: 241 ESRSKIKEVSKAE---QPKQT--YSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAG 295
Query: 301 ERTPVNAKLVKSRYTTGAASRSFTSTAYDPVTTNEFEYIKVEKNPKKKGYVQLHTTHGDL 360
+RTPVN+K+VKSRY++GAASRSFTS+A+ PVT N+FE IKVEKNPKKKGYVQ TTHGDL
Sbjct: 296 DRTPVNSKMVKSRYSSGAASRSFTSSAFTPVTKNDFELIKVEKNPKKKGYVQFQTTHGDL 355
Query: 361 NIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQXXXXXXXXXXXESIWGKPFK 420
NIELHCDI PR+CENFITLCERGYYNGVAFHRSIRNFMIQ ESIWGKPFK
Sbjct: 356 NIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGKGGESIWGKPFK 415
Query: 421 DEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFXXXXXXXXXXXXME 480
DE NSKLLHSGRGVVSMANSGPHTNGSQFF+LYKSATHLNYKHTVF ME
Sbjct: 416 DEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGGLATLAAME 475
Query: 481 KVPVDENDRPLEEIKITGVTVFVNPYSEPXXXXXXXXXXXXXXXXXXXXXXVGSWYSNPX 540
VPVDE+DRPLEEIKI +VFVNPY+E +GSWYSNP
Sbjct: 476 NVPVDESDRPLEEIKIIEASVFVNPYTE-LDEEEEKEKAEKEKNEDKDIEKIGSWYSNPG 534
Query: 541 XXXXXXXXXXXXXXKYLKARS--APIDSAAD-DGGLTAIATAKKRKVGVSAGE-FKDFSG 596
KYLKA S A D+ D ++ I +KKRK SA FKDFS
Sbjct: 535 SGTTEAGAGGGGVGKYLKAMSSTATKDTKGSLDSDISTIGVSKKRKTTASASTGFKDFSS 594
Query: 597 W 597
W
Sbjct: 595 W 595
|
|
| UNIPROTKB|F1NPF4 PPIL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1309484 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2447857 Ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RL00 PPIL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13356 PPIL2 "Peptidyl-prolyl cis-trans isomerase-like 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE23 PPIL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1096 ppil2 "peptidylprolyl isomerase (cyclophilin)-like 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2T9V1 PPIL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034109 CG7747 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9D787 | PPIL2_MOUSE | 5, ., 2, ., 1, ., 8 | 0.4503 | 0.8609 | 0.9865 | yes | no |
| Q4WVU5 | PPIL2_ASPFU | 5, ., 2, ., 1, ., 8 | 0.4091 | 0.8475 | 0.8739 | yes | no |
| P0CP90 | PPIL2_CRYNJ | 5, ., 2, ., 1, ., 8 | 0.3759 | 0.8743 | 0.9109 | yes | no |
| Q13356 | PPIL2_HUMAN | 5, ., 2, ., 1, ., 8 | 0.4433 | 0.8659 | 0.9942 | yes | no |
| Q5AXT6 | PPIL2_EMENI | 5, ., 2, ., 1, ., 8 | 0.4006 | 0.8994 | 0.9258 | yes | no |
| Q4IBK5 | PPIL2_GIBZE | 5, ., 2, ., 1, ., 8 | 0.3605 | 0.8509 | 0.8639 | yes | no |
| Q9FJX0 | PPIL2_ARATH | 5, ., 2, ., 1, ., 8 | 0.7753 | 0.9899 | 0.9932 | yes | no |
| Q2U5W8 | PPIL2_ASPOR | 5, ., 2, ., 1, ., 8 | 0.3913 | 0.8408 | 0.8807 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 5.2.1 | 0.983 |
| 4th Layer | 5.2.1.8 | 0.979 |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 597 | |||
| cd01923 | 159 | cd01923, cyclophilin_RING, cyclophilin_RING: cyclo | 1e-105 | |
| cd01928 | 153 | cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 | 7e-76 | |
| cd00317 | 146 | cd00317, cyclophilin, cyclophilin: cyclophilin-typ | 9e-64 | |
| cd01927 | 148 | cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo | 6e-63 | |
| cd01925 | 171 | cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC | 9e-62 | |
| pfam00160 | 144 | pfam00160, Pro_isomerase, Cyclophilin type peptidy | 3e-58 | |
| COG0652 | 158 | COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase | 3e-57 | |
| cd01922 | 146 | cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY | 1e-55 | |
| cd01921 | 166 | cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph | 6e-46 | |
| cd01926 | 164 | cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik | 5e-45 | |
| PTZ00060 | 183 | PTZ00060, PTZ00060, cyclophilin; Provisional | 4e-36 | |
| PLN03149 | 186 | PLN03149, PLN03149, peptidyl-prolyl isomerase H (c | 3e-33 | |
| cd01920 | 155 | cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP | 2e-26 | |
| PRK10791 | 164 | PRK10791, PRK10791, peptidyl-prolyl cis-trans isom | 5e-20 | |
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 5e-16 | |
| PRK10903 | 190 | PRK10903, PRK10903, peptidyl-prolyl cis-trans isom | 1e-15 | |
| cd01924 | 176 | cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 | 9e-15 | |
| PTZ00221 | 249 | PTZ00221, PTZ00221, cyclophilin; Provisional | 4e-14 | |
| pfam04564 | 73 | pfam04564, U-box, U-box domain | 2e-05 | |
| pfam04641 | 254 | pfam04641, Rtf2, Replication termination factor 2 | 8e-05 |
| >gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
Score = 314 bits (807), Expect = e-105
Identities = 115/159 (72%), Positives = 129/159 (81%)
Query: 350 YVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGR 409
YV+LHT GDLN+ELHCD P++CENFI LC++GYY+G FHRSIRNFMIQGGDPTGTGR
Sbjct: 1 YVRLHTNKGDLNLELHCDKAPKACENFIKLCKKGYYDGTIFHRSIRNFMIQGGDPTGTGR 60
Query: 410 GGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGV 469
GGESIWGKPFKDE L H GRGV+SMANSGP+TNGSQFFI Y+S HL+ KHTVFG V
Sbjct: 61 GGESIWGKPFKDEFKPNLSHDGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTVFGRV 120
Query: 470 VGGLTTLAAMEKVPVDENDRPLEEIKITGVTVFVNPYSE 508
VGGL TL AME VP DRP EEIKI +VFV+P+ E
Sbjct: 121 VGGLETLEAMENVPDPGTDRPKEEIKIEDTSVFVDPFEE 159
|
This group includes the nuclear proteins, Human hCyP-60 and Caenorhabditis elegans MOG-6 which, compared to the archetypal cyclophilin Human cyclophilin A exhibit reduced peptidylprolyl cis- trans isomerase activity and lack a residue important for cyclophilin binding. Human hCyP-60 has been shown to physically interact with the proteinase inhibitor peptide eglin c and; C. elegans MOG-6 to physically interact with MEP-1, a nuclear zinc finger protein. MOG-6 has been shown to function in germline sex determination. Length = 159 |
| >gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | Back alignment and domain information |
|---|
| >gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203049 pfam04564, U-box, U-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|218188 pfam04641, Rtf2, Replication termination factor 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| KOG0883 | 518 | consensus Cyclophilin type, U box-containing pepti | 100.0 | |
| KOG0881 | 164 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 100.0 | |
| cd01923 | 159 | cyclophilin_RING cyclophilin_RING: cyclophilin-typ | 100.0 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 100.0 | |
| KOG0884 | 161 | consensus Similar to cyclophilin-type peptidyl-pro | 100.0 | |
| cd01921 | 166 | cyclophilin_RRM cyclophilin_RRM: cyclophilin-type | 100.0 | |
| KOG0880 | 217 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 100.0 | |
| cd01925 | 171 | cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: | 100.0 | |
| cd01928 | 153 | Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro | 100.0 | |
| cd01927 | 148 | cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ | 100.0 | |
| COG0652 | 158 | PpiB Peptidyl-prolyl cis-trans isomerase (rotamase | 100.0 | |
| KOG0885 | 439 | consensus Peptidyl-prolyl cis-trans isomerase [Pos | 100.0 | |
| cd01922 | 146 | cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c | 100.0 | |
| KOG0879 | 177 | consensus U-snRNP-associated cyclophilin type pept | 100.0 | |
| PLN03149 | 186 | peptidyl-prolyl isomerase H (cyclophilin H); Provi | 100.0 | |
| PTZ00221 | 249 | cyclophilin; Provisional | 100.0 | |
| KOG0415 | 479 | consensus Predicted peptidyl prolyl cis-trans isom | 100.0 | |
| cd01926 | 164 | cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph | 100.0 | |
| PRK10903 | 190 | peptidyl-prolyl cis-trans isomerase A (rotamase A) | 100.0 | |
| PRK10791 | 164 | peptidyl-prolyl cis-trans isomerase B (rotamase B) | 100.0 | |
| PTZ00060 | 183 | cyclophilin; Provisional | 100.0 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 100.0 | |
| cd01920 | 155 | cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc | 100.0 | |
| cd00317 | 146 | cyclophilin cyclophilin: cyclophilin-type peptidyl | 100.0 | |
| PF00160 | 155 | Pro_isomerase: Cyclophilin type peptidyl-prolyl ci | 100.0 | |
| cd01924 | 176 | cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc | 100.0 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 100.0 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 99.98 | |
| KOG0865 | 167 | consensus Cyclophilin type peptidyl-prolyl cis-tra | 99.97 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 99.86 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.15 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.13 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.24 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.13 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 98.09 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 97.67 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.51 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.5 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.47 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.36 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 97.22 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.14 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.12 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.08 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.05 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.78 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 96.76 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.71 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.68 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.53 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 96.05 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 95.95 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 95.93 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 95.89 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 95.79 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.61 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 95.56 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 95.3 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 95.3 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 95.08 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 95.07 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 94.8 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 94.57 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 94.31 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 94.29 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 94.13 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 94.06 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 93.41 | |
| PF12903 | 147 | DUF3830: Protein of unknown function (DUF3830); In | 93.28 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 93.26 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 93.04 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 93.01 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 92.89 | |
| PRK00969 | 508 | hypothetical protein; Provisional | 92.41 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 92.28 | |
| TIGR03268 | 503 | methan_mark_3 putative methanogenesis marker prote | 91.52 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.51 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 91.4 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.31 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 91.25 | |
| COG4070 | 512 | Predicted peptidyl-prolyl cis-trans isomerase (rot | 90.91 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 90.57 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 90.33 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 89.4 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 88.81 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 87.59 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 87.54 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.49 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 87.06 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 86.15 | |
| KOG2042 | 943 | consensus Ubiquitin fusion degradation protein-2 [ | 86.14 | |
| COG5113 | 929 | UFD2 Ubiquitin fusion degradation protein 2 [Postt | 84.87 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 84.65 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.4 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 84.04 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 82.88 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 82.88 | |
| PF06416 | 113 | DUF1076: Protein of unknown function (DUF1076); In | 82.32 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 81.83 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 81.35 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.76 |
| >KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.3e-150 Score=1147.21 Aligned_cols=511 Identities=58% Similarity=0.940 Sum_probs=458.4
Q ss_pred CCCCCCCCCCeeeeHHHHhhhcCCcccc-ccCCCCCCCCCccccCCCCCCCCceecCCCCeeeHHhHHHHHHhcCCCCCC
Q 007574 1 MGKKQHSKDRMFITKTEWATEWGGAKSK-EVRTPFKRLPFYCCALTFTPFEDPVCTADGSVFELMSITPYIRKYGKHPVT 79 (597)
Q Consensus 1 Mgk~~~~~dk~yiT~~E~~~~~gg~k~~-~~~~~~~~lpf~~C~LSl~pl~~PV~t~~G~ly~ke~Il~~L~k~~~~Pvt 79 (597)
|||+||||||||||++||+..|||++.. ..+..|+||||+||+|++.||++|||+.+|.+||..+|++||++|++||+|
T Consensus 1 MGKkQHqKDkmylT~tEw~~~~Ggkk~~~~n~~~FkrLP~~hC~lt~~Pfe~PvC~~dg~vFd~~~Ivp~lkk~g~nP~t 80 (518)
T KOG0883|consen 1 MGKKQHQKDKMYLTTTEWKSIYGGKKDTGENRTQFKRLPFNHCSLTMLPFEDPVCTVDGTVFDLTAIVPWLKKHGTNPIT 80 (518)
T ss_pred CCcccccccceEEeehhhhhhcCCCCCCcccccccccCChhhceeccccccCcccccCCcEEeeehhhHHHHHcCCCCCC
Confidence 9999999999999999999999999885 348999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCccccccccccCcccccccccccccCceeEEEEecCcceehHHHHHHHhhcccCccccCCCCCCCCCCeeEec
Q 007574 80 GTPLKLEDLIPLTFHKNAEGEYHCPVLNKVFTEFTHIVAVKTTGNVFCFEAIKELNIKTKNWKELLTDEPFTKEDLITIQ 159 (597)
Q Consensus 80 g~~l~lkdLi~l~f~kn~~~~~~CPvt~k~ft~~t~~v~ik~~G~V~s~eai~~l~~k~k~~~~lv~~~~f~~~DII~Lq 159 (597)
|++|+.+|||+|+|++|++++|||||++++|++++|||||+++|||||||||++|||+.++|+||++++||+|.|||+||
T Consensus 81 G~kl~~~dLIkL~F~Kns~geyhcPvlfk~FT~~sHIvAv~TTGNvy~~eai~~LNiK~knwkdLltdepFtR~DiItiQ 160 (518)
T KOG0883|consen 81 GQKLDGKDLIKLKFHKNSEGEYHCPVLFKVFTRFSHIVAVRTTGNVYSWEAIEELNIKTKNWKDLLTDEPFTRADIITIQ 160 (518)
T ss_pred CCccccccceeeeeccCCCCcccCceeeeeecccceEEEEEecCceeeHHHHHHhCcchhhHHHhhccCCcchhceeeec
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcchhccchhhhhhcCCccChHHHhhccCCCC-ccc-ccchhHHHHHHHhhhcccccccccCCCCchhHHHHHHHHH
Q 007574 160 NPNALDTKVTLEFDHVKKGLKVDDEELRKMESDPT-YNI-NVAGDIKQMLQELGTEKGQETALLGGGGSKAQKERAAALA 237 (597)
Q Consensus 160 dp~~~~~~~~~~f~h~k~~~~~~~~~~~~~~~~~~-~~~-~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 237 (597)
||++++++++++|+|||+++++.++++++++.+|+ ..+ ++|-+++..|+||.+++.. +
T Consensus 161 dP~~lek~~~~~F~hvk~~lk~~~eeek~~~~dpa~~~~k~~n~e~ks~l~el~k~~~p--------------------~ 220 (518)
T KOG0883|consen 161 DPNNLEKFNMSDFYHVKKNLKTADEEEKKAKKDPALGYIKAMNLETKSTLPELSKEYQP--------------------K 220 (518)
T ss_pred CcchhhccchhhHHHHhcccccCcHHHHHhhcCchhhhhhhcchhhhhhhHHHhhhhcc--------------------c
Confidence 99999999999999999999999888888899998 455 7888999999999997630 0
Q ss_pred HHHHHhhhhhcccccccccccccccccccccccccccccCccchhccccchHHHHHHHHhhhcCCCcccccccccccCCC
Q 007574 238 AILAARSRIEENSKSDANGEAKATKAFSIVDAASASVHGRSASAAKTASSDKTAARIAMHMAGERTPVNAKLVKSRYTTG 317 (597)
Q Consensus 238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~stg 317 (597)
+.. ++..+ ...++++++|||||
T Consensus 221 ~~~-------------------------------a~t~~---------------------------~~aD~~naahyStG 242 (518)
T KOG0883|consen 221 KSI-------------------------------ASTMK---------------------------RSADKINAAHYSTG 242 (518)
T ss_pred hhh-------------------------------hhhcc---------------------------ccchhhhhhhcccc
Confidence 000 00000 11256689999999
Q ss_pred ccccccccCCCCCCCcccchhhhhh----cCCCcceEEEEEEeCeeEEEEeCCCCChhhHHHHHHHHhccccCCceEEEe
Q 007574 318 AASRSFTSTAYDPVTTNEFEYIKVE----KNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRS 393 (597)
Q Consensus 318 ~~~~s~tSt~~~p~t~~~~~~~~~~----~~~k~~~~V~l~T~~G~I~IEL~~d~aP~tv~NFl~L~~~g~Y~gt~fhRv 393 (597)
.+|+|||||+|+|+|.++++.++.+ .+++++|||+|+|+.|.|+||||||.+|++|+||+.||+.|||+|+.|||.
T Consensus 243 ~vaasfTSTam~PvT~neaaiid~d~~ry~rvKkkgyvrl~Tn~G~lNlELhcd~~P~aceNFI~lc~~gYYnnt~FHRs 322 (518)
T KOG0883|consen 243 AVAASFTSTAMTPVTKNEAAIIDEDDVRYTRVKKKGYVRLVTNHGPLNLELHCDYAPRACENFITLCKNGYYNNTIFHRS 322 (518)
T ss_pred ceeceeccceeeecccchhhhccchhhhhccccccceEEEeccCCceeeEeecCcchHHHHHHHHHHhcccccchHHHHH
Confidence 9999999999999999999998877 789999999999999999999999999999999999999999999999999
Q ss_pred ecCcEEEecCCCCCCCCCCccCCCCCCCcccccccCCCccEEEEecCCCCCCCcceEEeccCCCCCCCCCcEEEEEEcCh
Q 007574 394 IRNFMIQGGDPTGTGRGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGL 473 (597)
Q Consensus 394 i~~f~IQgGdptg~g~gg~si~g~~f~dE~~~~l~h~~rG~lsman~g~ntngSqFFItl~~~p~LD~k~tVFGrVv~G~ 473 (597)
|+|||||||||+|+|+||+||||.+|.|||.+.|.|++||+|||||+|||+|||||||++++|.|||++||||||||+|+
T Consensus 323 IrnFmiQGGDPTGTG~GGeSiWgKpFkDEf~~~l~H~gRGvlSMANsGpnTNgSQFFItyrsckhLd~KHTIFGrvVGGl 402 (518)
T KOG0883|consen 323 IRNFMIQGGDPTGTGRGGESIWGKPFKDEFCSNLSHDGRGVLSMANSGPNTNGSQFFITYRSCKHLDNKHTIFGRVVGGL 402 (518)
T ss_pred HHHHeeeCCCCCCCCCCCccccCCccccccCCCCCcCCcceEeeccCCCCCCCceEEEEecchhhccccceeeeeeeccH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCCCCCCCccccEEeEEEEEeCCCCCCChhhHHHHHhhhhccccccccccCCcccCCCCCCCCCCcCcccc
Q 007574 474 TTLAAMEKVPVDENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNAEDEDKDKVGSWYSNPGTGTQAGAVGGGGV 553 (597)
Q Consensus 474 dvL~~Ie~~~td~~~rP~~~I~I~~~~Vl~dPf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gv 553 (597)
++|.+||++++++.++|..+|+|.++.||+|||+|.+++.++|+++. .+.++++..+.++ ++|.+++..+.+++.||
T Consensus 403 dtL~amEnve~d~~DrP~e~I~i~~~~VFVdPfeEa~~e~~kEr~e~-~k~~~e~~~k~~s--~~~~~~s~~~~~~~~gV 479 (518)
T KOG0883|consen 403 DTLTAMENVETDEKDRPKEEIKIEDAIVFVDPFEEADKEREKERAER-LKEEEEDNLKRTS--SQPKSGSTTPHALGAGV 479 (518)
T ss_pred HHHHHHhcCCCCCCCCcccceEEeeeEEeeCcHHHHHHHHHHHHHHH-hhccchhhhhhhc--cCccccCCCcccccccH
Confidence 99999999999999999999999999999999999999776666553 3333444455555 67888888889999999
Q ss_pred cccccccCCCCCCCCCCCCchhhhhhhcccccccCCCCCCCCCC
Q 007574 554 GKYLKARSAPIDSAADDGGLTAIATAKKRKVGVSAGEFKDFSGW 597 (597)
Q Consensus 554 gkyl~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~f~~f~~w 597 (597)
||||++.+...... ...++.. . .+||++...||||||+|
T Consensus 480 GKYlk~~~s~~~~~-~~~tt~~---v-~~~kKk~~~GfgdFssW 518 (518)
T KOG0883|consen 480 GKYLKKAASLEKKE-FPMTTAT---V-NKKKKKAATGFGDFSSW 518 (518)
T ss_pred HHHHHHHhhhhccc-CCccccc---c-chhcccccccccCcccC
Confidence 99999875433222 1111111 1 23333445899999999
|
|
| >KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) | Back alignment and domain information |
|---|
| >KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 | Back alignment and domain information |
|---|
| >cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like | Back alignment and domain information |
|---|
| >cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain | Back alignment and domain information |
|---|
| >COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 | Back alignment and domain information |
|---|
| >KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional | Back alignment and domain information |
|---|
| >PTZ00221 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain | Back alignment and domain information |
|---|
| >PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional | Back alignment and domain information |
|---|
| >PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional | Back alignment and domain information |
|---|
| >PTZ00060 cyclophilin; Provisional | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E | Back alignment and domain information |
|---|
| >cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases | Back alignment and domain information |
|---|
| >PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms | Back alignment and domain information |
|---|
| >cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PRK00969 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >PF06416 DUF1076: Protein of unknown function (DUF1076); InterPro: IPR010489 This entry is represented by Bacteriophage 2851, Orf74 (EP2851_74) | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 597 | ||||
| 1zkc_A | 197 | Crystal Structure Of The Cyclophiln_ring Domain Of | 1e-49 | ||
| 2oju_A | 167 | X-Ray Structure Of Complex Of Human Cyclophilin J W | 1e-38 | ||
| 1xyh_A | 161 | Crystal Structure Of Recombinant Human Cyclophilin | 2e-38 | ||
| 3bo7_A | 201 | Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro | 2e-31 | ||
| 2hq6_A | 185 | Structure Of The Cyclophilin_cecyp16-like Domain Of | 4e-30 | ||
| 2b71_A | 196 | Plasmodium Yoelii Cyclophilin-Like Protein Length = | 1e-29 | ||
| 2poe_A | 185 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 1e-27 | ||
| 2x7k_A | 166 | The Crystal Structure Of Ppil1 In Complex With Cycl | 2e-27 | ||
| 1xwn_A | 174 | Solution Structure Of Cyclophilin Like 1(Ppil1) And | 2e-27 | ||
| 2k7n_A | 203 | Solution Structure Of The Ppil1 Bound To A Fragment | 2e-27 | ||
| 2fu0_A | 160 | Plasmodium Falciparum Cyclophilin Pfe0505w Putative | 4e-26 | ||
| 2a2n_A | 176 | Crystal Structure Of The Peptidylprolyl Isomerase D | 5e-24 | ||
| 2rmc_A | 182 | Crystal Structure Of Murine Cyclophilin C Complexed | 5e-21 | ||
| 2esl_A | 190 | Human Cyclophilin C In Complex With Cyclosporin A L | 1e-20 | ||
| 2he9_A | 192 | Structure Of The Peptidylprolyl Isomerase Domain Of | 3e-20 | ||
| 1c5f_A | 177 | Crystal Structure Of The Cyclophilin-Like Domain Fr | 4e-20 | ||
| 2ck1_A | 172 | The Structure Of Oxidised Cyclophilin A From S. Man | 8e-20 | ||
| 1qoi_A | 177 | U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = | 1e-19 | ||
| 3r49_A | 166 | Human Cyclophilin D Complexed With Quinolin-8-Amine | 2e-18 | ||
| 3qyu_A | 164 | Crystal Structure Of Human Cyclophilin D At 1.54 A | 2e-18 | ||
| 2bit_X | 165 | Crystal Structure Of Human Cyclophilin D At 1.7 A R | 2e-18 | ||
| 2z6w_A | 165 | Crystal Structure Of Human Cyclophilin D In Complex | 2e-18 | ||
| 3bkp_A | 232 | Crystal Structure Of The Toxoplasma Gondii Cyclophi | 7e-18 | ||
| 4fru_A | 185 | Crystal Structure Of Horse Wild-Type Cyclophilin B | 9e-18 | ||
| 4frv_A | 185 | Crystal Structure Of Mutated Cyclophilin B That Cau | 9e-18 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 2e-17 | ||
| 1w74_A | 191 | X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer | 2e-17 | ||
| 3ich_A | 188 | Crystal Structure Of Cyclophilin B At 1.2 A Resolut | 3e-17 | ||
| 3k2c_A | 193 | Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom | 4e-17 | ||
| 1cyn_A | 178 | Cyclophilin B Complexed With [d-(Cholinylester)ser8 | 4e-17 | ||
| 2hqj_A | 183 | Cyclophilin From Leishmania Major Length = 183 | 5e-17 | ||
| 2r99_A | 173 | Crystal Structure Of Cyclophilin Abh-Like Domain Of | 9e-17 | ||
| 2gw2_A | 198 | Crystal Structure Of The Peptidyl-Prolyl Isomerase | 1e-16 | ||
| 1dyw_A | 173 | Biochemical And Structural Characterization Of A Di | 1e-16 | ||
| 1zmf_A | 165 | C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 | 1e-16 | ||
| 2wfj_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 1e-16 | ||
| 1qng_A | 170 | Plasmodium Falciparum Cyclophilin Complexed With Cy | 1e-16 | ||
| 2wfi_A | 179 | Atomic Resolution Crystal Structure Of The Ppiase D | 2e-16 | ||
| 2alf_A | 164 | Crystal Structure Of Human Cypa Mutant K131a Length | 2e-16 | ||
| 2xgy_B | 173 | Complex Of Rabbit Endogenous Lentivirus (Relik)caps | 2e-16 | ||
| 1bck_A | 165 | Human Cyclophilin A Complexed With 2-Thr Cyclospori | 3e-16 | ||
| 5cyh_A | 164 | Cyclophilin A Complexed With Dipeptide Gly-Pro Leng | 3e-16 | ||
| 3rdd_A | 184 | Human Cyclophilin A Complexed With An Inhibitor Len | 3e-16 | ||
| 1m9e_A | 164 | X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- | 3e-16 | ||
| 4i9y_A | 167 | Structure Of The C-terminal Domain Of Nup358 Length | 3e-16 | ||
| 2rma_A | 165 | Crystal Structures Of Cyclophilin A Complexed With | 3e-16 | ||
| 2wlw_A | 165 | Structure Of The N-Terminal Capsid Domain Of Hiv-2 | 4e-16 | ||
| 4dgd_A | 165 | Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 | 4e-16 | ||
| 2haq_A | 172 | Crystal Structure Of Cyclophilin A From Leishmania | 5e-16 | ||
| 1ist_A | 162 | Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng | 6e-16 | ||
| 2x83_B | 163 | Evolutionary Basis Of Hiv Restriction By The Antire | 6e-16 | ||
| 3k0o_A | 165 | Room Temperature Structure Of Cypa Mutant Ser99thr | 6e-16 | ||
| 1qnh_A | 170 | Plasmodium Falciparum Cyclophilin (Double Mutant) C | 7e-16 | ||
| 3k0r_A | 165 | Cryogenic Structure Of Cypa Mutant Arg55lys Length | 7e-16 | ||
| 1xo7_A | 166 | Crystal Structure Of Cyclophilin From Trypanosoma C | 7e-16 | ||
| 3bt8_A | 172 | Crystal Structure Of Mutant Cyclophilin (R147a) Fro | 1e-15 | ||
| 2cfe_A | 162 | The 1.5 A Crystal Structure Of The Malassezia Sympo | 1e-15 | ||
| 2x2c_K | 165 | Acetyl-Cypa:cyclosporine Complex Length = 165 | 1e-15 | ||
| 2x2a_A | 165 | Free Acetyl-Cypa Trigonal Form Length = 165 | 1e-15 | ||
| 2plu_A | 186 | Crystal Structure Of Cryptosporidium Parvum Cycloph | 2e-15 | ||
| 2x25_B | 169 | Free Acetyl-Cypa Orthorhombic Form Length = 169 | 3e-15 | ||
| 1h0p_A | 182 | Cyclophilin_5 From C. Elegans Length = 182 | 6e-15 | ||
| 3uch_A | 174 | Crystal Structure Of A Hypotherical Peptidyl-Prolyl | 8e-15 | ||
| 1aws_A | 164 | Secypa Complexed With Hagpia (Pseudo-Symmetric Mono | 2e-14 | ||
| 1z81_A | 229 | Crystal Structure Of Cyclophilin From Plasmodium Yo | 9e-14 | ||
| 2c3b_A | 172 | The Crystal Structure Of Aspergillus Fumigatus Cycl | 2e-13 | ||
| 1lop_A | 164 | Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P | 2e-12 | ||
| 2nul_A | 164 | Peptidylprolyl Isomerase From E. Coli Length = 164 | 2e-12 | ||
| 3pmp_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 4e-11 | ||
| 3o7t_A | 164 | Crystal Structure Of Cyclophilin A From Moniliophth | 5e-11 | ||
| 3s6m_A | 167 | The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer | 9e-11 | ||
| 3t1u_A | 163 | Crystal Structure Of The Complex Of Cyclophilin-a E | 2e-09 | ||
| 1j2a_A | 166 | Structure Of E. Coli Cyclophilin B K163t Mutant Len | 2e-07 | ||
| 1clh_A | 166 | Three-Dimensional Solution Structure Of Escherichia | 2e-07 |
| >pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 | Back alignment and structure |
|
| >pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 | Back alignment and structure |
| >pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 | Back alignment and structure |
| >pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 | Back alignment and structure |
| >pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 | Back alignment and structure |
| >pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 | Back alignment and structure |
| >pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 | Back alignment and structure |
| >pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 | Back alignment and structure |
| >pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 | Back alignment and structure |
| >pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 | Back alignment and structure |
| >pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 | Back alignment and structure |
| >pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 | Back alignment and structure |
| >pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 | Back alignment and structure |
| >pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 | Back alignment and structure |
| >pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 | Back alignment and structure |
| >pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 | Back alignment and structure |
| >pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 | Back alignment and structure |
| >pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 | Back alignment and structure |
| >pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 | Back alignment and structure |
| >pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 | Back alignment and structure |
| >pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 | Back alignment and structure |
| >pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 | Back alignment and structure |
| >pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 | Back alignment and structure |
| >pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 | Back alignment and structure |
| >pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 | Back alignment and structure |
| >pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 | Back alignment and structure |
| >pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 | Back alignment and structure |
| >pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 | Back alignment and structure |
| >pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 | Back alignment and structure |
| >pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 | Back alignment and structure |
| >pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 | Back alignment and structure |
| >pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 | Back alignment and structure |
| >pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 | Back alignment and structure |
| >pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 | Back alignment and structure |
| >pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 | Back alignment and structure |
| >pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 | Back alignment and structure |
| >pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 | Back alignment and structure |
| >pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 | Back alignment and structure |
| >pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 | Back alignment and structure |
| >pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 | Back alignment and structure |
| >pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 | Back alignment and structure |
| >pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 | Back alignment and structure |
| >pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 | Back alignment and structure |
| >pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 | Back alignment and structure |
| >pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 | Back alignment and structure |
| >pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 | Back alignment and structure |
| >pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 | Back alignment and structure |
| >pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 | Back alignment and structure |
| >pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 | Back alignment and structure |
| >pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 | Back alignment and structure |
| >pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 | Back alignment and structure |
| >pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 | Back alignment and structure |
| >pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 | Back alignment and structure |
| >pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 | Back alignment and structure |
| >pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 | Back alignment and structure |
| >pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 | Back alignment and structure |
| >pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 | Back alignment and structure |
| >pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 | Back alignment and structure |
| >pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 | Back alignment and structure |
| >pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 | Back alignment and structure |
| >pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 | Back alignment and structure |
| >pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 | Back alignment and structure |
| >pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 | Back alignment and structure |
| >pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 | Back alignment and structure |
| >pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 | Back alignment and structure |
| >pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 | Back alignment and structure |
| >pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 | Back alignment and structure |
| >pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 | Back alignment and structure |
| >pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 | Back alignment and structure |
|---|
Score = 325 bits (834), Expect = e-109
Identities = 111/181 (61%), Positives = 137/181 (75%), Gaps = 1/181 (0%)
Query: 345 PKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDP 404
P+ GYV+LHT GDLN+ELHCD+TP++CENFI LC++ YY+G FHRSIRNF+IQGGDP
Sbjct: 16 PRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDP 75
Query: 405 TGTGRGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHT 464
TGTG GGES WGKPFKDE L H+GRG++SMANSGP++N SQFFI ++S +L+ KHT
Sbjct: 76 TGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHT 135
Query: 465 VFGGVVGGLTTLAAMEKVPVD-ENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKN 523
+FG VVGG L AME V D + DRP EEI+I TVFV+PY E D + +E+ K
Sbjct: 136 IFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKV 195
Query: 524 A 524
A
Sbjct: 196 A 196
|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| 1zkc_A | 197 | Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr | 100.0 | |
| 3bo7_A | 201 | Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; | 100.0 | |
| 2ok3_A | 161 | Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b | 100.0 | |
| 2poe_A | 185 | Cyclophilin-like protein, putative; cryptosporidiu | 100.0 | |
| 2b71_A | 196 | Cyclophilin-like protein; structural genomics, str | 100.0 | |
| 2x7k_A | 166 | Peptidyl-prolyl CIS-trans isomerase-like 1; isomer | 100.0 | |
| 2fu0_A | 160 | Cyclophilin, putative; PFE0505W, cyclosporin-bindi | 100.0 | |
| 3bkp_A | 232 | Cyclophilin; malaria, isomerase, structural GENO s | 100.0 | |
| 2hq6_A | 185 | Serologically defined colon cancer antigen 10; pro | 100.0 | |
| 2a2n_A | 176 | Peptidylprolyl isomerase domain and WD repeat CON; | 100.0 | |
| 2k7n_A | 203 | Peptidyl-prolyl CIS-trans isomerase-like 1; beta b | 100.0 | |
| 3ich_A | 188 | Peptidyl-prolyl CIS-trans isomerase B; beta sandwi | 100.0 | |
| 1w74_A | 191 | Peptidyl-prolyl CIS-trans isomerase A; cyclophilin | 100.0 | |
| 2wfi_A | 179 | Peptidyl-prolyl CIS-trans isomerase G; phosphoprot | 100.0 | |
| 1a58_A | 177 | Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala | 100.0 | |
| 1mzw_A | 177 | Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc | 100.0 | |
| 2he9_A | 192 | NK-tumor recognition protein; cyclosporin, isomera | 100.0 | |
| 2cmt_A | 172 | Peptidyl-prolyl CIS-trans isomerase E; rotamase ac | 100.0 | |
| 2haq_A | 172 | Cyclophilin; rotamase, proline, isomerase, CIS-tra | 100.0 | |
| 2r99_A | 173 | Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i | 100.0 | |
| 2igv_A | 173 | Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 | 100.0 | |
| 2z6w_A | 165 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 1qng_A | 170 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 4fru_A | 185 | Cyclophilin B, peptidyl-prolyl CIS-trans isomerase | 100.0 | |
| 3pmp_A | 164 | Cyclophilin A; peptidyl prolyl isomerase, isomeras | 100.0 | |
| 2poy_A | 186 | Peptidyl-prolyl CIS-trans isomerase; isomerase-imm | 100.0 | |
| 2c3b_A | 172 | Ppiase, cyclophilin; isomerase, 3D domain swapping | 100.0 | |
| 3s6m_A | 167 | Peptidyl-prolyl CIS-trans isomerase; seattle struc | 100.0 | |
| 2ose_A | 234 | Probable peptidyl-prolyl CIS-trans isomerase; cycl | 100.0 | |
| 1lop_A | 164 | Cyclophilin A; rotamase, isomerase-isomerase inhib | 100.0 | |
| 1z81_A | 229 | Cyclophilin; structural genomics, structural genom | 100.0 | |
| 3k2c_A | 193 | Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, | 100.0 | |
| 3rdd_A | 184 | Peptidyl-prolyl CIS-trans isomerase A; beta barrel | 100.0 | |
| 1v9t_A | 166 | Cyclophilin B; beta barrel, isomerase-isomerase in | 100.0 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 100.0 | |
| 3rfy_A | 369 | Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; | 100.0 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.45 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.12 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.11 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.08 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.07 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.93 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.78 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.67 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.4 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 98.37 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.13 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 97.93 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.81 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.51 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.49 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.48 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.46 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.42 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.41 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.41 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.38 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.37 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.35 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.35 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.34 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.33 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.33 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.32 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.32 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.3 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.28 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.27 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.23 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.21 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.21 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.2 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.2 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.19 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.18 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.14 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.12 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.05 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.02 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 96.97 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 96.97 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 96.96 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 96.91 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 96.89 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 96.88 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.88 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 96.86 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 96.84 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 96.82 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 96.81 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 96.75 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 96.75 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 96.74 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.72 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 96.7 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 96.69 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 96.68 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 96.65 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 96.57 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 96.55 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 96.54 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.53 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 96.4 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 96.38 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 96.35 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 96.34 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 96.32 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 96.25 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 96.23 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 96.21 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 96.21 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 96.18 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 96.06 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 96.05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 95.98 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 95.98 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 95.89 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 95.86 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.82 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 95.77 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 95.76 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 95.66 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 95.65 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 95.65 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 95.41 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 95.38 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 95.2 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 95.19 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 95.17 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 95.14 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 95.01 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 94.88 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 94.8 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 94.79 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 94.73 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 94.72 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 94.63 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 94.61 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 94.56 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 94.44 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 94.43 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 94.37 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 94.34 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 94.13 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 94.09 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 93.82 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 93.69 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 93.59 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 92.97 | |
| 3kop_A | 188 | Uncharacterized protein; protein with A cyclophili | 92.56 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 92.45 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 92.11 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 91.95 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 91.92 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 91.62 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 91.23 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 91.07 | |
| 2nnz_A | 153 | Hypothetical protein; beta-barrel, structural geno | 90.66 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 88.9 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 88.42 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 88.39 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 88.14 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 87.07 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 86.52 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 86.18 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 86.16 | |
| 2kkx_A | 102 | Uncharacterized protein ECS2156; methods developme | 85.19 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 84.49 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 84.28 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 83.17 |
| >1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-51 Score=399.79 Aligned_cols=175 Identities=62% Similarity=1.133 Sum_probs=167.8
Q ss_pred cCCCcceEEEEEEeCeeEEEEeCCCCChhhHHHHHHHHhccccCCceEEEeecCcEEEecCCCCCCCCCCccCCCCCCCc
Q 007574 343 KNPKKKGYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDE 422 (597)
Q Consensus 343 ~~~k~~~~V~l~T~~G~I~IEL~~d~aP~tv~NFl~L~~~g~Y~gt~fhRvi~~f~IQgGdptg~g~gg~si~g~~f~dE 422 (597)
+.+++..+|+|+|+.|+|+||||++.||+||+||+.||+.|||+|+.||||+++||||||||+++|.|++++||.+|+||
T Consensus 14 ~~~~~~~~v~l~T~~G~I~ieL~~~~aP~tv~NF~~L~~~g~Ydg~~FhRVi~~f~iQgGd~~~~g~Gg~si~g~~f~dE 93 (197)
T 1zkc_A 14 LVPRGSGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDE 93 (197)
T ss_dssp CCCCSCEEEEEEETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEECCTTSSSSCCCBTTBSCBCCC
T ss_pred CCCCCCcEEEEEeCCccEEEEEcCCCCcHHHHHHHHHHhcCCCCCCEEEEEeCCCEEEcCCCCCCCCCCCccCCCccccc
Confidence 46788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccCCCccEEEEecCCCCCCCcceEEeccCCCCCCCCCcEEEEEEcChHHHHHHhcCCCCCC-CCCccccEEeEEEE
Q 007574 423 VNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAMEKVPVDEN-DRPLEEIKITGVTV 501 (597)
Q Consensus 423 ~~~~l~h~~rG~lsman~g~ntngSqFFItl~~~p~LD~k~tVFGrVv~G~dvL~~Ie~~~td~~-~rP~~~I~I~~~~V 501 (597)
+++.++|+.+|+|||||.||++|+|||||++.+++|||++|+|||+|++|||||++|++++++.. ++|..+|+|.+|+|
T Consensus 94 ~~~~l~h~~~G~lsMAn~gp~sngSQFFIt~~~~~~LDg~~tVFG~Vv~Gmdvv~~I~~~~t~~~~~~P~~~i~I~~~~v 173 (197)
T 1zkc_A 94 FRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTV 173 (197)
T ss_dssp CCTTCCSCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHHSCBCTTTCCBSSCCEEEEEEE
T ss_pred cCcCcCCCCceEEEEecCCCCCcccEEEEEcCCCCccCCCccEEEEEEcCHHHHHHHHcCCCCCCCCCcCCCeEEEEEEE
Confidence 88999999999999999999999999999999999999999999999999999999999999986 99999999999999
Q ss_pred EeCCCCCCChhhHHHH
Q 007574 502 FVNPYSEPDEEEEEEK 517 (597)
Q Consensus 502 l~dPf~~~~~~~~~~~ 517 (597)
+.|||+++.....+++
T Consensus 174 ~~dPf~d~~~~~~~~~ 189 (197)
T 1zkc_A 174 FVDPYEEADAQIAQER 189 (197)
T ss_dssp EECTTHHHHHHHHHHH
T ss_pred EcCCcccHHHHHHHHH
Confidence 9999998877766533
|
| >3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* | Back alignment and structure |
|---|
| >2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A | Back alignment and structure |
|---|
| >2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A | Back alignment and structure |
|---|
| >2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A | Back alignment and structure |
|---|
| >1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* | Back alignment and structure |
|---|
| >1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A | Back alignment and structure |
|---|
| >2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A | Back alignment and structure |
|---|
| >2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A | Back alignment and structure |
|---|
| >2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A | Back alignment and structure |
|---|
| >2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A | Back alignment and structure |
|---|
| >2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... | Back alignment and structure |
|---|
| >1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* | Back alignment and structure |
|---|
| >4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* | Back alignment and structure |
|---|
| >3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A | Back alignment and structure |
|---|
| >2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* | Back alignment and structure |
|---|
| >2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* | Back alignment and structure |
|---|
| >2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} | Back alignment and structure |
|---|
| >1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A | Back alignment and structure |
|---|
| >1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 | Back alignment and structure |
|---|
| >3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 597 | ||||
| d1zkca1 | 178 | b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso | 4e-63 | |
| d1xwna1 | 166 | b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome | 4e-51 | |
| d2ok3a1 | 159 | b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B | 1e-48 | |
| d2b71a1 | 169 | b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 | 2e-45 | |
| d2fu0a1 | 155 | b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { | 5e-41 | |
| d2cfea1 | 162 | b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s | 6e-40 | |
| d1w74a_ | 171 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-39 | |
| d1a33a_ | 174 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( | 9e-37 | |
| d1h0pa_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd | 3e-36 | |
| d2rmca_ | 182 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus | 6e-36 | |
| d1qnga_ | 170 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium | 6e-36 | |
| d2a2na1 | 164 | b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma | 1e-35 | |
| d1lopa_ | 164 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-35 | |
| d2c3ba1 | 171 | b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper | 1e-34 | |
| d1xo7a_ | 166 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom | 2e-34 | |
| d2igva1 | 172 | b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno | 4e-34 | |
| d2z6wa1 | 164 | b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c | 3e-32 | |
| d1qoia_ | 173 | b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom | 6e-32 | |
| d1ihga2 | 195 | b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain | 3e-31 | |
| d1v9ta_ | 166 | b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 2e-30 | |
| d2r99a1 | 161 | b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl | 4e-29 | |
| d1z81a1 | 186 | b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas | 1e-28 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 6e-07 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 7e-04 |
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 203 bits (517), Expect = 4e-63
Identities = 110/177 (62%), Positives = 135/177 (76%), Gaps = 1/177 (0%)
Query: 349 GYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTG 408
GYV+LHT GDLN+ELHCD+TP++CENFI LC++ YY+G FHRSIRNF+IQGGDPTGTG
Sbjct: 1 GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTG 60
Query: 409 RGGESIWGKPFKDEVNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGG 468
GGES WGKPFKDE L H+GRG++SMANSGP++N SQFFI ++S +L+ KHT+FG
Sbjct: 61 TGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGR 120
Query: 469 VVGGLTTLAAMEKVPVD-ENDRPLEEIKITGVTVFVNPYSEPDEEEEEEKAKDEKNA 524
VVGG L AME V D + DRP EEI+I TVFV+PY E D + +E+ K A
Sbjct: 121 VVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVA 177
|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 597 | |||
| d1zkca1 | 178 | Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop | 100.0 | |
| d2ok3a1 | 159 | Cyclophilin-like protein PPIL3B {Human (Homo sapie | 100.0 | |
| d2fu0a1 | 155 | Putative cyclophilin PFE0505w {Plasmodium falcipar | 100.0 | |
| d2b71a1 | 169 | Cyclophilin-like protein PY00693 {Plasmodium yoeli | 100.0 | |
| d1xwna1 | 166 | Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 | 100.0 | |
| d1w74a_ | 171 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob | 100.0 | |
| d2a2na1 | 164 | Peptidylprolyl isomerase domain and WD repeat-cont | 100.0 | |
| d2rmca_ | 182 | Cyclophilin (eukaryotic) {Mouse (Mus musculus), va | 100.0 | |
| d1h0pa_ | 182 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d2igva1 | 172 | Cyclophilin (eukaryotic) {Caenorhabditis elegans, | 100.0 | |
| d1xo7a_ | 166 | Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId | 100.0 | |
| d1qnga_ | 170 | Cyclophilin (eukaryotic) {Plasmodium falciparum [T | 100.0 | |
| d1v9ta_ | 166 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d2z6wa1 | 164 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1a33a_ | 174 | Cyclophilin (eukaryotic) {Nematode (Brugia malayi) | 100.0 | |
| d2cfea1 | 162 | Cyclophilin-like allergen Mal s 6 {Malassezia symp | 100.0 | |
| d2r99a1 | 161 | Mitochondrial peptidyl-prolyl cis-trans isomerase, | 100.0 | |
| d1qoia_ | 173 | Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 | 100.0 | |
| d1lopa_ | 164 | Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche | 100.0 | |
| d1ihga2 | 195 | Cyclophilin 40 isomerase domain {Cow (Bos taurus) | 100.0 | |
| d1z81a1 | 186 | Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId | 100.0 | |
| d2c3ba1 | 171 | Cyclophilin (eukaryotic) {Aspergillus fumigatus [T | 100.0 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.21 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.96 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.68 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.67 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.2 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.64 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.51 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.49 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.47 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 97.32 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.3 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.1 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 96.98 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.96 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 96.51 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 96.42 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.26 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.19 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 95.21 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 95.04 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 94.7 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 94.14 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 93.99 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 93.63 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 93.46 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 91.67 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 91.31 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 90.27 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 89.57 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 88.82 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 85.88 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 80.13 |
| >d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cyclophilin-like superfamily: Cyclophilin-like family: Cyclophilin (peptidylprolyl isomerase) domain: Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.2e-45 Score=352.06 Aligned_cols=172 Identities=63% Similarity=1.144 Sum_probs=163.2
Q ss_pred eEEEEEEeCeeEEEEeCCCCChhhHHHHHHHHhccccCCceEEEeecCcEEEecCCCCCCCCCCccCCCCCCCccccccc
Q 007574 349 GYVQLHTTHGDLNIELHCDITPRSCENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGTGRGGESIWGKPFKDEVNSKLL 428 (597)
Q Consensus 349 ~~V~l~T~~G~I~IEL~~d~aP~tv~NFl~L~~~g~Y~gt~fhRvi~~f~IQgGdptg~g~gg~si~g~~f~dE~~~~l~ 428 (597)
|||+|+|+.|+|+||||.+.||+||+||++||+.+||+|+.|||++++|+||+||+..++.++.+.++.+|++|....++
T Consensus 1 ~~v~l~T~~G~i~IeL~~~~aP~tv~nF~~L~~~~~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~E~~~~l~ 80 (178)
T d1zkca1 1 GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLS 80 (178)
T ss_dssp EEEEEEETTEEEEEEECTTTSHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEECCTTSSSSCCCBTTBSCBCCCCCTTCC
T ss_pred CEEEEEeCCEEEEEEEcCCCChHHHHHHHHHHhcCCcCceEeeeccceeEEecCCccCCCCCCcccCCCCcCCccccccC
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999888899
Q ss_pred CCCccEEEEecCCCCCCCcceEEeccCCCCCCCCCcEEEEEEcChHHHHHHhcCCCCC-CCCCccccEEeEEEEEeCCCC
Q 007574 429 HSGRGVVSMANSGPHTNGSQFFILYKSATHLNYKHTVFGGVVGGLTTLAAMEKVPVDE-NDRPLEEIKITGVTVFVNPYS 507 (597)
Q Consensus 429 h~~rG~lsman~g~ntngSqFFItl~~~p~LD~k~tVFGrVv~G~dvL~~Ie~~~td~-~~rP~~~I~I~~~~Vl~dPf~ 507 (597)
|+.+|+|||+++++++++|||||++.++++||++|+|||+|++|||||++|++++++. +++|.++|+|.+|.|+.|||+
T Consensus 81 ~~~~G~lsma~~~~~s~~sqF~It~~~~~~ld~~~~vFG~Vv~G~dvl~~I~~~~t~~~~~~P~~~v~I~~~~Il~~pf~ 160 (178)
T d1zkca1 81 HTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYE 160 (178)
T ss_dssp SCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHHSCBCTTTCCBSSCCEEEEEEEEECTTH
T ss_pred CCCCeEEEEeecCCCCccceeeccccCCcccCCcceEEEEeeCcHHHHHHHHcCCCCCCCCccCCCeEEEEEEEEcCCcc
Confidence 9999999999999999999999999999999999999999999999999999999985 689999999999999999999
Q ss_pred CCChhhHHHHHhh
Q 007574 508 EPDEEEEEEKAKD 520 (597)
Q Consensus 508 ~~~~~~~~~~~~~ 520 (597)
+++.+..++++..
T Consensus 161 ~~~~~~~~~~~~~ 173 (178)
T d1zkca1 161 EADAQIAQERKTQ 173 (178)
T ss_dssp HHHHHHHHHHHHH
T ss_pred hhhHHHhhhhhhh
Confidence 8876666655443
|
| >d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} | Back information, alignment and structure |
|---|
| >d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} | Back information, alignment and structure |
|---|
| >d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|