Citrus Sinensis ID: 007579

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------

MGGDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQQQPSQLNIHQLQHQHQQSHSQVNFQQQQQNGGTATKPESNQ

cccccccccccccHHHHHccccccccccccccccHHHcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccc

ccccccccccccHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccEcHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccc

mggdsnegnggntDMMQRIQssfgtssssipkqqtllsanqldlpqlnqnQLRARHFSQFatnfggdsskrvgippshpnqippispyssipvsrpgnqqmgsqnyspgpthsrslsqpssffsldslpplspspfrdspstsmsdqvstdvsmedrdgnshsllppspfnrgnasrigeslpprnkhrrsnsdipfgfstvmqsssplisprfaggldkavsgrenpgvakpaqlvkkesswerggesngegmgerksegevVDDLFSAYMNLEnidalnssgtddkngnenredldsrasgtktnggdssdneaessvneSGNSLQragmnssaekregikrtaggdvasttrhyrsvsmdsfmgklnfgdespklppspgtrpgqlspsnsidanspafslefgngefsgAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRdsvgltnqnNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQemasesdpskgmanqqlpmnsqmfqvhqqqpsqlnIHQLQHQHQQSHSQVNFQQqqqnggtatkpesnq

mggdsnegnggnTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDrdgnshsllppspfnrgNASRIGeslpprnkhrrsnSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSgrenpgvakpaqlvkkesswerggesngegmgerkseGEVVDDLFSAYMNLENIDalnssgtddkngnenredldsrasgtktnggdssdneaessvnesgnslqragmnssaekregikrtaggdvasttrHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAeialtdpkrakrilanrqsaarskerKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATqemasesdpskGMANQQLPMNSQMFQVHQQQPSQLNIHQLQHQHQQSHSQVNFQQQQqnggtatkpesnq

MGGDSNEGNGGNTDMMQRIQssfgtssssIPKQQTLLSAnqldlpqlnqnqlRARHFSQFATNFGGDSSKRVGIPPSHpnqippispyssipvsrpGNQQMGSQNYSPGPTHsrslsqpssffsldslpplspspfrdspsTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVqtlqteattlsaqltllqRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQQQPsqlnihqlqhqhqqshsqvnfqqqqqnGGTATKPESNQ

*************************************************************************************************************************************************************************************************************************************************************************DLFSAYMNLE******************************************************************************************************************************************************************************************************LSAQLTLLQ*******************************************************************************************************************

***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YISELEHKVQTLQTEATTLSAQLTLLQRDSVG*TNQNNE********************ALTAEVRR***************************************************************************

*********GGNTDMMQRIQ***********KQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVS***********************QPSSFFSLDSLPPLSP***************************SHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRE**********************************GEVVDDLFSAYMNLENIDALNSSGTDD*****************************************************GIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPK**************SNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILAN**********KMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVA***************NQQLPMNSQM**********************************************

*****************************I**QQTLLSANQLDLPQLNQNQLRA*******************IPPSHPNQIPPISPY*S***********************************DSL******************************************************************IPFGFSTVMQSSSPLISPRFA*********************************************GEVVDDLFSAYMNLENIDAL************************************************************************************FMGKLNFG***************************************SGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQEMA******************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGGDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLNQNQLRARHFSQFATNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSSFFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSPFNRGNASRIGESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLDSRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYRSVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQLRDALNEALTAEVRRLKVATQEMASESDPSKGMANQQLPMNSQMFQVHQQQPSQLNIHQLQHQHQQSHSQVNFQQQQQNGGTATKPESNQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		597	2.2.26 [Sep-21-2011]
Q69IL4		380	Transcription factor RF2a	no	no	0.251	0.394	0.644	4e-44
Q6S4P4		329	Transcription factor RF2b	no	no	0.247	0.449	0.644	5e-44
Q04088		398	Probable transcription fa	no	no	0.266	0.399	0.619	2e-42
Q9MA75		341	Transcription factor VIP1	no	no	0.294	0.516	0.548	1e-39
Q9M7Q3		454	ABSCISIC ACID-INSENSITIVE	no	no	0.113	0.149	0.337	0.0003
P14233		242	TGACG-sequence-specific D	N/A	no	0.122	0.301	0.312	0.0003
O24646		168	Transcription factor HY5	no	no	0.090	0.321	0.444	0.0008

>sp\|Q69IL4\|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1	Back alignment and function desciption

 Score =  179 bits (455), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 112/152 (73%), Gaps = 2/152 (1%)

Query: 407 GNGEFSGAELKKIMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQT 466
           G    S AE KK ++  KLAE+AL DPKRAKRI ANRQSAARSKERKMRYI+ELE KVQT
Sbjct: 156 GTEGMSSAEAKKAVSAAKLAELALVDPKRAKRIWANRQSAARSKERKMRYIAELERKVQT 215

Query: 467 LQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVA 526
           LQTEATTLSAQL LLQRD+ GLT +N+ELK RLQ MEQQ  L+DALN+ L +EV+RLKVA
Sbjct: 216 LQTEATTLSAQLALLQRDTSGLTTENSELKLRLQTMEQQVHLQDALNDTLKSEVQRLKVA 275

Query: 527 TQEMASESDPSKGMAN--QQLPMNSQMFQVHQ 556
           T +MA+             Q   N QMFQ +Q
Sbjct: 276 TGQMANGGGMMMNFGGMPHQFGGNQQMFQNNQ 307

Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)

>sp\|Q6S4P4\|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1	Back alignment and function description

>sp\|Q04088\|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1	Back alignment and function description

>sp\|Q9MA75\|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1	Back alignment and function description

>sp\|Q9M7Q3\|AI5L6_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arabidopsis thaliana GN=ABF3 PE=1 SV=1	Back alignment and function description

>sp\|P14233\|TGA1B_TOBAC TGACG-sequence-specific DNA-binding protein TGA-1B (Fragment) OS=Nicotiana tabacum GN=TGA1B PE=2 SV=1	Back alignment and function description

>sp\|O24646\|HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana GN=HY5 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		597
225427794		589	PREDICTED: uncharacterized protein LOC10	0.978	0.991	0.767	0.0
255543893		574	DNA binding protein, putative [Ricinus c	0.889	0.925	0.786	0.0
224077964		507	predicted protein [Populus trichocarpa]	0.770	0.907	0.825	0.0
449461639		571	PREDICTED: uncharacterized protein LOC10	0.864	0.903	0.730	0.0
449526371		566	PREDICTED: uncharacterized protein LOC10	0.862	0.909	0.730	0.0
449461635		563	PREDICTED: uncharacterized protein LOC10	0.922	0.978	0.675	0.0
449529770		554	PREDICTED: uncharacterized LOC101215703,	0.814	0.877	0.723	0.0
356545029		538	PREDICTED: uncharacterized protein LOC78	0.815	0.905	0.718	0.0
351722269		525	bZIP transcription factor bZIP28 [Glycin	0.782	0.889	0.690	1e-179
30692108		547	basic leucine zipper transcription facto	0.877	0.957	0.617	1e-168

>gi\|225427794\|ref\|XP_002269363.1\| PREDICTED: uncharacterized protein LOC100255631 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/599 (76%), Positives = 512/599 (85%), Gaps = 15/599 (2%)

Query: 3   GDSNEGNGGNTDMMQRIQSSFGTSSSSIPKQQTLLSANQLDLPQLN-QNQLRARHFSQFA 61
           GD+ E N    DM+QR+QSSFGTSSSSI KQ   +S NQLD+PQLN  +Q+RA     F+
Sbjct: 2   GDTEEAN---IDMIQRLQSSFGTSSSSIQKQP--MSMNQLDIPQLNASSQIRAPMMRHFS 56

Query: 62  TNFGGDSSKRVGIPPSHPNQIPPISPYSSIPVSRPGNQQMGSQNYSPGPTHSRSLSQPSS 121
            NF GDSSKR G PPSHP+QIPPISPYS IPV RP NQQ+ SQN+SPGP+HSRSLSQPS 
Sbjct: 57  PNFSGDSSKRHGFPPSHPHQIPPISPYSQIPVPRPANQQLVSQNFSPGPSHSRSLSQPS- 115

Query: 122 FFSLDSLPPLSPSPFRDSPSTSMSDQVSTDVSMEDRDGNSHSLLPPSP--FNRGNASRIG 179
           FFSLDSLPPLSPSP+RDS STS+SD VS D+SMEDRD +SHS+LPPSP  F+RGN+ R+G
Sbjct: 116 FFSLDSLPPLSPSPYRDSSSTSISDAVSADISMEDRDASSHSVLPPSPSPFSRGNSMRVG 175

Query: 180 ESLPPRNKHRRSNSDIPFGFSTVMQSSSPLISPRFAGGLDKAVSGREN-PGVAKPAQLVK 238
           E+LPPR  HRRS+SDIPFGFS++MQSS PLI  R +G L++++SGR+N    AKP QLVK
Sbjct: 176 ENLPPRKAHRRSSSDIPFGFSSIMQSSPPLIPLRGSGALERSMSGRDNNMAAAKPVQLVK 235

Query: 239 KESSWERGGESNGEGMGERKSEGEVVDDLFSAYMNLENIDALNSSGTDDKNGNENREDLD 298
           +ESSWERGG+SN EGMGERKSEGEVVDDL SAYMNL+NIDALNS GT++KNG ENREDLD
Sbjct: 236 RESSWERGGDSNAEGMGERKSEGEVVDDLLSAYMNLDNIDALNSPGTEEKNGTENREDLD 295

Query: 299 SRASGTKTNGGDSSDNEAESSVNESGNSLQRAGMNSSAEKREGIKRTAGGDVASTTRHYR 358
           SRASGTKTNGGDSSDNEAESSVNESGNS+Q+ G +SSAEKREG+KR+AGGD+A TTRHYR
Sbjct: 296 SRASGTKTNGGDSSDNEAESSVNESGNSMQKLGTSSSAEKREGVKRSAGGDIAPTTRHYR 355

Query: 359 SVSMDSFMGKLNFGDESPKLPPSPGTRPGQLSPSNSIDANSPAFSLEFGNGEFSGAELKK 418
           SVSMDSFMGK+NFGDESPKL PSPGTRPGQLSPSNS+D NS  FSLEFGNGEFSGAELKK
Sbjct: 356 SVSMDSFMGKMNFGDESPKLLPSPGTRPGQLSPSNSMDGNSATFSLEFGNGEFSGAELKK 415

Query: 419 IMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQL 478
           IMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQL
Sbjct: 416 IMANEKLAEIALTDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQL 475

Query: 479 TLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQEMASESDPSK 538
           TLLQRDS GLT+QNNELKFRLQAMEQQAQLRDALNEALTAEV+RLK+AT E+  ES  SK
Sbjct: 476 TLLQRDSAGLTSQNNELKFRLQAMEQQAQLRDALNEALTAEVQRLKLATAELGGESQASK 535

Query: 539 GMANQQLPMNSQMFQVHQQQPSQLNIHQLQHQHQQSHSQVNFQQQQQNGGTATKPESNQ 597
            +   QL +N QMF +H QQP+Q       HQ QQ   Q + QQQQQNG T TK ESNQ
Sbjct: 536 CLV-PQLSVNPQMFHLHHQQPTQ----LNIHQLQQQQQQQHNQQQQQNGSTTTKHESNQ 589

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255543893\|ref\|XP_002513009.1\| DNA binding protein, putative [Ricinus communis] gi\|223548020\|gb\|EEF49512.1\| DNA binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224077964\|ref\|XP_002305468.1\| predicted protein [Populus trichocarpa] gi\|222848432\|gb\|EEE85979.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449461639\|ref\|XP_004148549.1\| PREDICTED: uncharacterized protein LOC101216189 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449526371\|ref\|XP_004170187.1\| PREDICTED: uncharacterized protein LOC101227308 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449461635\|ref\|XP_004148547.1\| PREDICTED: uncharacterized protein LOC101215703 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449529770\|ref\|XP_004171871.1\| PREDICTED: uncharacterized LOC101215703, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356545029\|ref\|XP_003540948.1\| PREDICTED: uncharacterized protein LOC780560 [Glycine max]	Back alignment and taxonomy information

>gi\|351722269\|ref\|NP_001237238.1\| bZIP transcription factor bZIP28 [Glycine max] gi\|113367236\|gb\|ABI34675.1\| bZIP transcription factor bZIP28 [Glycine max]	Back alignment and taxonomy information

>gi|30692108|ref|NP_849520.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|79326483|ref|NP_001031810.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|23297471|gb|AAN12977.1| unknown protein [Arabidopsis thaliana] gi|332661589|gb|AEE86989.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana] gi|332661590|gb|AEE86990.1| basic leucine zipper transcription factor-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		597
TAIR\|locus:2141826		553	AT4G38900 "AT4G38900" [Arabido	0.624	0.674	0.608	2.9e-110
TAIR\|locus:2047082		525	AT2G21230 "AT2G21230" [Arabido	0.639	0.727	0.496	5e-85
TAIR\|locus:2033123		337	bZIP52 "AT1G06850" [Arabidopsi	0.323	0.572	0.475	1.2e-37
TAIR\|locus:2198856		423	AT1G06070 "AT1G06070" [Arabido	0.340	0.479	0.419	5.3e-37
TAIR\|locus:2061908		367	AT2G40620 "AT2G40620" [Arabido	0.309	0.504	0.468	2.7e-36
TAIR\|locus:2061340		398	AT2G31370 [Arabidopsis thalian	0.413	0.620	0.383	6.2e-33
TAIR\|locus:2031123		341	VIP1 "VIRE2-interacting protei	0.340	0.595	0.439	1.4e-30
TAIR\|locus:2057300		294	UNE4 "unfertilized embryo sac	0.329	0.670	0.387	2.3e-28
TAIR\|locus:2056442		262	AT2G13150 [Arabidopsis thalian	0.308	0.702	0.373	6e-26
TAIR\|locus:2057030		264	AT2G12900 "AT2G12900" [Arabido	0.222	0.503	0.382	2.2e-20

TAIR\|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1089 (388.4 bits), Expect = 2.9e-110, P = 2.9e-110
 Identities = 258/424 (60%), Positives = 300/424 (70%)

Query:   151 DVSMEDRDG---NSHSLLPPSPFNRGNAS-----RIGESLPPRNKHRRSNSDIPFGFSTV 202
             DVSMEDRD    NS+  LPPSPF R N++     R+GESLPPR  HRRSNSDIP GF+  
Sbjct:   124 DVSMEDRDSGVFNSNHSLPPSPFTRCNSTSSSSLRVGESLPPRKSHRRSNSDIPSGFN-- 181

Query:   203 MQSSSPLISPRFAGGLDKAVSGRENPGVAKPAQLVKKESSWERGGESNGEGMGERKSEGE 262
                S PLI PR    L+++ SG E    +K    VKKESS ER      EG+GER    E
Sbjct:   182 ---SMPLIPPR---PLERSFSGGECADWSKSNPFVKKESSCER------EGVGER----E 225

Query:   263 VVDDLFSAYMNLENIDALNSSGTDD-KNGNENREDLDS-RASGTKTNGGDSSDNEAESS- 319
              +DDLFSAYMNLENID LNSS  DD KNGNENR+D++S RASGTKTNG   SD E ESS 
Sbjct:   226 AMDDLFSAYMNLENIDVLNSSEADDSKNGNENRDDMESSRASGTKTNG---SDTEGESSS 282

Query:   320 VNESGNSLQRAGMNSSAEKREGIKR-TAGGDVASTTRHYRSVSMDS-FMGKLNFGDESPK 377
             VNES N+     MNSS EKRE +KR  AGGD+A TTRHYRSVS+DS FM KL+FGDES K
Sbjct:   283 VNESANN----NMNSSGEKRESVKRRAAGGDIAPTTRHYRSVSVDSCFMEKLSFGDESLK 338

Query:   378 LPPSPGTRPGQLSPSNSIDANS-PAFSLEFGNGEFSGAELKKIMANEKLAEIALTDPKRA 436
              PPSPG+   ++SP+NS+D NS  AFS+EF NGEF+ AE+KKIMAN+KLAE+A++DPKR 
Sbjct:   339 PPPSPGSMSRKVSPTNSVDGNSGAAFSIEFNNGEFTAAEMKKIMANDKLAEMAMSDPKRV 398

Query:   437 KR------ILANRQSAARSKERKMRYISELEHKVXXXXXXXXXXXXXXXXXXRDSVGLTN 490
             KR      ILANRQSAARSKERKMRYI ELEHKV                  RD +GLTN
Sbjct:   399 KRNDPLFRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTN 458

Query:   491 QNNELKFRLQAMEQQAQLRDALNEALTAEVRRLKVATQEMA-SESDPSKGMANQQLPMNS 549
             QNNELKFRLQAMEQQA+LRDALNEAL  EV+RLK+A  E + +ES+ SK  +     +N+
Sbjct:   459 QNNELKFRLQAMEQQARLRDALNEALNGEVQRLKLAIGESSQNESERSKMQS-----LNA 513

Query:   550 QMFQ 553
             +MFQ
Sbjct:   514 EMFQ 517

GO:0003677 "DNA binding" evidence=ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA

GO:0043565 "sequence-specific DNA binding" evidence=IEA

GO:0046983 "protein dimerization activity" evidence=IEA

GO:0005829 "cytosol" evidence=IDA

GO:0009410 "response to xenobiotic stimulus" evidence=RCA

GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA

TAIR\|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057300 UNE4 "unfertilized embryo sac 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2056442 AT2G13150 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		597
smart00338		65	smart00338, BRLZ, basic region leucin zipper	2e-15
pfam00170		64	pfam00170, bZIP_1, bZIP transcription factor	1e-06
pfam07716		54	pfam07716, bZIP_2, Basic region leucine zipper	1e-05
cd12193		54	cd12193, B_zip1, basic leucine zipper DNA-binding	6e-04
pfam08614		194	pfam08614, ATG16, Autophagy protein 16 (ATG16)	0.002
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.002
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	0.003

>gnl\|CDD\|197664 smart00338, BRLZ, basic region leucin zipper	Back alignment and domain information

 Score = 70.7 bits (174), Expect = 2e-15
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 432 DPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQ 491
           D KR +R   NR++A RS+ERK   I ELE KV+ L+ E   L  ++  L+R+   L ++
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 492 NNE 494
             E
Sbjct: 63  LEE 65

Length = 65

>gnl\|CDD\|201054 pfam00170, bZIP_1, bZIP transcription factor	Back alignment and domain information

>gnl\|CDD\|203738 pfam07716, bZIP_2, Basic region leucine zipper	Back alignment and domain information

>gnl\|CDD\|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins	Back alignment and domain information

>gnl\|CDD\|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16)	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		597
smart00338		65	BRLZ basic region leucin zipper.	99.37
PF00170		64	bZIP_1: bZIP transcription factor cAMP response el	99.24
KOG4343		655	consensus bZIP transcription factor ATF6 [Transcri	99.02
PF07716		54	bZIP_2: Basic region leucine zipper; InterPro: IPR	99.02
KOG4005		292	consensus Transcription factor XBP-1 [Transcriptio	99.01
KOG3584		348	consensus cAMP response element binding protein an	98.8
KOG0709		472	consensus CREB/ATF family transcription factor [Tr	98.77
PF03131		92	bZIP_Maf: bZIP Maf transcription factor; InterPro:	98.02
KOG0837		279	consensus Transcriptional activator of the JUN fam	97.78
KOG4571		294	consensus Activating transcription factor 4 [Trans	97.3
KOG4196		135	consensus bZIP transcription factor MafK [Transcri	96.89
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	96.66
KOG3119		269	consensus Basic region leucine zipper transcriptio	96.62
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	95.95
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	95.78
PRK13169		110	DNA replication intiation control protein YabA; Re	95.63
KOG4005		292	consensus Transcription factor XBP-1 [Transcriptio	95.55
KOG3863		604	consensus bZIP transcription factor NRF1 [Transcri	95.39
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	95.21
PRK10884		206	SH3 domain-containing protein; Provisional	95.02
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	94.96
PRK15422		79	septal ring assembly protein ZapB; Provisional	94.65
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	94.58
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	94.49
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.45
PRK11637		428	AmiB activator; Provisional	94.12
PRK11637		428	AmiB activator; Provisional	93.98
PF10186		302	Atg14: UV radiation resistance protein and autopha	93.85
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	93.85
PF14662		193	CCDC155: Coiled-coil region of CCDC155	93.76
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	93.74
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	93.58
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	93.47
COG2433		652	Uncharacterized conserved protein [Function unknow	93.41
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.4
TIGR02449		65	conserved hypothetical protein TIGR02449. Members	93.37
PF14662		193	CCDC155: Coiled-coil region of CCDC155	93.27
PRK09039		343	hypothetical protein; Validated	93.21
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	92.72
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	92.64
TIGR02894		161	DNA_bind_RsfA transcription factor, RsfA family. I	92.61
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	92.58
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	92.57
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	92.55
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	92.5
PRK10884		206	SH3 domain-containing protein; Provisional	92.43
PF13747		89	DUF4164: Domain of unknown function (DUF4164)	92.42
PF10805		106	DUF2730: Protein of unknown function (DUF2730); In	92.37
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	92.33
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	92.3
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	92.2
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	92.02
COG4942		420	Membrane-bound metallopeptidase [Cell division and	91.99
PF07989		75	Microtub_assoc: Microtubule associated; InterPro:	91.8
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	91.63
PF04102		69	SlyX: SlyX; InterPro: IPR007236 The SlyX protein h	91.57
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	91.55
PF03962		188	Mnd1: Mnd1 family; InterPro: IPR005647 This family	91.53
PRK09039		343	hypothetical protein; Validated	91.5
COG4467		114	Regulator of replication initiation timing [Replic	91.43
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	91.38
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	91.37
PRK13729		475	conjugal transfer pilus assembly protein TraB; Pro	91.35
PF10224		80	DUF2205: Predicted coiled-coil protein (DUF2205);	91.24
PRK00295		68	hypothetical protein; Provisional	91.08
TIGR02449		65	conserved hypothetical protein TIGR02449. Members	91.05
PF12711		86	Kinesin-relat_1: Kinesin motor; InterPro: IPR02465	90.81
PRK00736		68	hypothetical protein; Provisional	90.68
PRK04325		74	hypothetical protein; Provisional	90.67
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	90.67
PRK02793		72	phi X174 lysis protein; Provisional	90.66
PF15030		277	DUF4527: Protein of unknown function (DUF4527)	90.58
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	90.49
PRK04863		1486	mukB cell division protein MukB; Provisional	90.45
PLN02678		448	seryl-tRNA synthetase	90.44
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	90.36
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	90.34
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	90.28
PRK05431		425	seryl-tRNA synthetase; Provisional	90.23
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	90.18
PRK02119		73	hypothetical protein; Provisional	89.99
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	89.79
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	89.78
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	89.71
PHA02562		562	46 endonuclease subunit; Provisional	89.71
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	89.66
PRK04406		75	hypothetical protein; Provisional	89.65
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	89.64
COG4026		290	Uncharacterized protein containing TOPRIM domain,	89.63
PRK15422		79	septal ring assembly protein ZapB; Provisional	89.58
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	89.45
PF08232		134	Striatin: Striatin family; InterPro: IPR013258 Thi	89.36
PF08172		248	CASP_C: CASP C terminal; InterPro: IPR012955 This	89.23
PF00038		312	Filament: Intermediate filament protein; InterPro:	89.19
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	89.01
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	89.01
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	89.0
PF10186		302	Atg14: UV radiation resistance protein and autopha	88.63
PF02183		45	HALZ: Homeobox associated leucine zipper; InterPro	88.5
PRK00846		77	hypothetical protein; Provisional	88.43
KOG0996		1293	consensus Structural maintenance of chromosome pro	88.1
KOG1414		395	consensus Transcriptional activator FOSB/c-Fos and	88.05
KOG0971		1243	consensus Microtubule-associated protein dynactin	87.92
PF05837		106	CENP-H: Centromere protein H (CENP-H); InterPro: I	87.91
PF02403		108	Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom	87.89
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	87.84
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	87.59
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	87.59
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	87.58
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	87.48
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	87.36
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	87.13
PF06428		100	Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP	87.12
KOG1962		216	consensus B-cell receptor-associated protein and r	86.94
PF05700		221	BCAS2: Breast carcinoma amplified sequence 2 (BCAS	86.93
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	86.81
COG2433		652	Uncharacterized conserved protein [Function unknow	86.69
KOG0288		459	consensus WD40 repeat protein TipD [General functi	86.23
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	86.23
PLN02320		502	seryl-tRNA synthetase	86.0
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	85.65
PRK02224		880	chromosome segregation protein; Provisional	85.61
PRK12704		520	phosphodiesterase; Provisional	85.61
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	85.32
PF10805		106	DUF2730: Protein of unknown function (DUF2730); In	85.26
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	85.19
PHA02562		562	46 endonuclease subunit; Provisional	85.14
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	85.12
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	84.98
KOG0971		1243	consensus Microtubule-associated protein dynactin	84.83
PF14817		632	HAUS5: HAUS augmin-like complex subunit 5	84.81
TIGR03495		135	phage_LysB phage lysis regulatory protein, LysB fa	84.77
PF04880		166	NUDE_C: NUDE protein, C-terminal conserved region;	84.72
KOG0933		1174	consensus Structural maintenance of chromosome pro	84.62
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	84.59
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	84.55
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	84.51
TIGR00414		418	serS seryl-tRNA synthetase. This model represents	84.4
PRK05431		425	seryl-tRNA synthetase; Provisional	84.37
PF00038		312	Filament: Intermediate filament protein; InterPro:	84.35
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	84.24
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	84.18
PRK13922		276	rod shape-determining protein MreC; Provisional	84.17
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	84.09
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	83.99
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	83.88
cd07596		218	BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So	83.84
KOG4807		593	consensus F-actin binding protein, regulates actin	83.78
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	83.64
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	83.62
cd07666		243	BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S	83.57
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	83.46
PF07200		150	Mod_r: Modifier of rudimentary (Mod(r)) protein; I	83.42
PRK10698		222	phage shock protein PspA; Provisional	83.37
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	83.33
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	83.24
COG4026		290	Uncharacterized protein containing TOPRIM domain,	82.84
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	82.49
PRK10803		263	tol-pal system protein YbgF; Provisional	82.27
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	82.21
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	81.94
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	81.93
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	81.81
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	81.58
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	81.28
PRK13922		276	rod shape-determining protein MreC; Provisional	81.22
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	81.05
PRK02224		880	chromosome segregation protein; Provisional	81.04
PF09325		236	Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp	80.9
KOG1414		395	consensus Transcriptional activator FOSB/c-Fos and	80.89
PF08172		248	CASP_C: CASP C terminal; InterPro: IPR012955 This	80.58
COG2919		117	Septum formation initiator [Cell division and chro	80.56
PF12329		74	TMF_DNA_bd: TATA element modulatory factor 1 DNA b	80.46
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	80.44
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	80.33
PF07851		330	TMPIT: TMPIT-like protein; InterPro: IPR012926 A n	80.21
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	80.18
COG2900		72	SlyX Uncharacterized protein conserved in bacteria	80.14

>smart00338 BRLZ basic region leucin zipper	Back alignment and domain information

Probab=99.37  E-value=3e-12  Score=103.02  Aligned_cols=63  Identities=38%  Similarity=0.500  Sum_probs=57.9

Q ss_pred             cChHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007579          431 TDPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNN  493 (597)
Q Consensus       431 ~DpKR~KRILaNRESAaRSReRKKqYIeELE~KVq~LQtEN~tLsaQLtlLqre~~~L~aEN~  493 (597)
                      .|+|+.+|+++||+||+++|+||+.|+.+||.+|+.|+.+|..|..++..|+.++..|..++.
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~~   64 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELE   64 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            478999999999999999999999999999999999999999999999998887777776653

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization

Back alignment and domain information

>KOG4343 consensus bZIP transcription factor ATF6 [Transcription]	Back alignment and domain information

>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization	Back alignment and domain information

>KOG4005 consensus Transcription factor XBP-1 [Transcription]	Back alignment and domain information

>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription]	Back alignment and domain information

>KOG0709 consensus CREB/ATF family transcription factor [Transcription]	Back alignment and domain information

>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell	Back alignment and domain information

>KOG0837 consensus Transcriptional activator of the JUN family [Transcription]	Back alignment and domain information

>KOG4571 consensus Activating transcription factor 4 [Transcription]	Back alignment and domain information

>KOG4196 consensus bZIP transcription factor MafK [Transcription]	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>PRK13169 DNA replication intiation control protein YabA; Reviewed	Back alignment and domain information

>KOG4005 consensus Transcription factor XBP-1 [Transcription]	Back alignment and domain information

>KOG3863 consensus bZIP transcription factor NRF1 [Transcription]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>TIGR02449 conserved hypothetical protein TIGR02449	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF13747 DUF4164: Domain of unknown function (DUF4164)	Back alignment and domain information

>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division []	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast)	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair]	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional	Back alignment and domain information

>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure	Back alignment and domain information

>PRK00295 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02449 conserved hypothetical protein TIGR02449	Back alignment and domain information

>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>PRK00736 hypothetical protein; Provisional	Back alignment and domain information

>PRK04325 hypothetical protein; Provisional	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK02793 phi X174 lysis protein; Provisional	Back alignment and domain information

>PF15030 DUF4527: Protein of unknown function (DUF4527)	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PLN02678 seryl-tRNA synthetase	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK05431 seryl-tRNA synthetase; Provisional	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PRK02119 hypothetical protein; Provisional	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PRK04406 hypothetical protein; Provisional	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin	Back alignment and domain information

>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []	Back alignment and domain information

>PRK00846 hypothetical protein; Provisional	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules	Back alignment and domain information

>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion []	Back alignment and domain information

>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms]	Back alignment and domain information

>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PLN02320 seryl-tRNA synthetase	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF14817 HAUS5: HAUS augmin-like complex subunit 5	Back alignment and domain information

>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family	Back alignment and domain information

>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>TIGR00414 serS seryl-tRNA synthetase	Back alignment and domain information

>PRK05431 seryl-tRNA synthetase; Provisional	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PRK13922 rod shape-determining protein MreC; Provisional	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK13922 rod shape-determining protein MreC; Provisional	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking	Back alignment and domain information

>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription]	Back alignment and domain information

>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins	Back alignment and domain information

>COG2919 Septum formation initiator [Cell division and chromosome partitioning]	Back alignment and domain information

>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		597
1dh3_A		55	Transcription factor CREB; protein-DNA complex, tr	2e-11
1t2k_D		61	Cyclic-AMP-dependent transcription factor ATF-2; p	4e-11
1jnm_A		62	Proto-oncogene C-JUN; BZIP, protein-DNA complex, t	9e-09
3a5t_A		107	Transcription factor MAFG; protein-DNA complex, BZ	2e-08
2wt7_A		63	Proto-oncogene protein C-FOS; transcription, trans	4e-08
2wt7_B		90	Transcription factor MAFB; transcription, transcri	5e-07
1gd2_E		70	Transcription factor PAP1; basic leucine zipper, p	4e-06
2dgc_A		63	Protein (GCN4); basic domain, leucine zipper, DNA	2e-05
1ci6_A		63	Transcription factor ATF-4; BZIP; 2.60A {Homo sapi	2e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-04
1hjb_A		87	Ccaat/enhancer binding protein beta; transcription	6e-04

>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55	Back alignment and structure

 Score = 58.2 bits (141), Expect = 2e-11
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 434 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQ 482
           KR  R++ NR++A  S+ +K  Y+  LE++V  L+ +  TL  +L  L+
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALK 49

PyMOL of 1dh3

>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61	Back alignment and structure

>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62	Back alignment and structure

>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107	Back alignment and structure

>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63	Back alignment and structure

>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90	Back alignment and structure

>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70	Back alignment and structure

>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63	Back alignment and structure

>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		597
1dh3_A		55	Transcription factor CREB; protein-DNA complex, tr	99.44
2wt7_A		63	Proto-oncogene protein C-FOS; transcription, trans	99.25
1t2k_D		61	Cyclic-AMP-dependent transcription factor ATF-2; p	99.22
1jnm_A		62	Proto-oncogene C-JUN; BZIP, protein-DNA complex, t	99.06
2dgc_A		63	Protein (GCN4); basic domain, leucine zipper, DNA	98.94
1ci6_A		63	Transcription factor ATF-4; BZIP; 2.60A {Homo sapi	98.81
1gd2_E		70	Transcription factor PAP1; basic leucine zipper, p	98.8
1gu4_A		78	CAAT/enhancer binding protein beta; transcription/	98.35
1hjb_A		87	Ccaat/enhancer binding protein beta; transcription	98.34
3a5t_A		107	Transcription factor MAFG; protein-DNA complex, BZ	97.99
2wt7_B		90	Transcription factor MAFB; transcription, transcri	97.97
2oqq_A		42	Transcription factor HY5; homodimer leucine zipper	97.09
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	96.46
1skn_P		92	DNA-binding domain of SKN-1; complex (transcriptio	95.58
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	95.29
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	95.22
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	94.57
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	94.33
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	94.06
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	93.78
2w6a_A		63	ARF GTPase-activating protein GIT1; PIX, zinc, sig	93.0
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	92.47
3cve_A		72	Homer protein homolog 1; coiled coil, alternative	92.35
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	92.35
3cvf_A		79	Homer-3, homer protein homolog 3; coiled coil, alt	92.2
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	92.11
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	92.09
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	91.9
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	91.86
3mq9_A		471	Bone marrow stromal antigen 2 fused to maltose-BI	91.85
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	91.72
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	91.11
1wle_A		501	Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo	91.07
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	90.7
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	90.46
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	90.25
1go4_E		100	MAD1 (mitotic arrest deficient)-like 1; mitotic sp	90.05
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	89.96
3qh9_A		81	Liprin-beta-2; coiled-coil, dimerization, structur	89.78
3a7p_A		152	Autophagy protein 16; coiled-coil, coiled coil, cy	89.7
3efg_A		78	Protein SLYX homolog; xanthomonas campestris PV. c	89.7
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	89.5
3s9g_A		104	Protein hexim1; cyclin T-binding domain (TBD), cyc	89.41
3qne_A		485	Seryl-tRNA synthetase, cytoplasmic; amino acid bio	88.92
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	88.88
2dq0_A		455	Seryl-tRNA synthetase; coiled-coil, homodimer, str	88.28
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	87.54
2oqq_A		42	Transcription factor HY5; homodimer leucine zipper	87.51
1ses_A		421	Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A	87.44
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	87.4
3cvf_A		79	Homer-3, homer protein homolog 3; coiled coil, alt	87.24
3m9b_A		251	Proteasome-associated ATPase; coil COIL with 5 bet	87.05
3swy_A		46	Cyclic nucleotide-gated cation channel alpha-3; co	86.97
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	86.61
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	86.57
2ve7_C		250	Kinetochore protein NUF2, kinetochore protein SPC;	85.71
3swf_A		74	CGMP-gated cation channel alpha-1; coiled-coil, as	85.54
1deb_A		54	APC protein, adenomatous polyposis coli protein; c	85.48
3tnu_B		129	Keratin, type II cytoskeletal 5; coiled-coil, stru	85.35
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	85.13
3jsv_C		94	NF-kappa-B essential modulator; ubiquitin, coiled-	85.06
3he5_A		49	Synzip1; heterodimeric coiled-coil, de novo protei	84.92
3bas_A		89	Myosin heavy chain, striated muscle/general contro	84.83
3swk_A		86	Vimentin; cytoskeleton, intermediate filament, alp	84.81
3mq7_A		121	Bone marrow stromal antigen 2; HIV, antiviral prot	83.93
1wle_A		501	Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo	83.78
3i00_A		120	HIP-I, huntingtin-interacting protein 1; transcrip	83.73
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	83.64
3bas_A		89	Myosin heavy chain, striated muscle/general contro	83.46
1hjb_A		87	Ccaat/enhancer binding protein beta; transcription	83.33
2oxj_A		34	Hybrid alpha/beta peptide based on the GCN4-P1 Se	83.22
4ath_A		83	MITF, microphthalmia-associated transcription fact	83.19
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	82.64
3tnu_A		131	Keratin, type I cytoskeletal 14; coiled-coil, stru	82.39
3m48_A		33	General control protein GCN4; leucine zipper, synt	82.33
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	82.29
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	82.27
2v4h_A		110	NF-kappa-B essential modulator; transcription, met	81.97
3cve_A		72	Homer protein homolog 1; coiled coil, alternative	81.91
2oto_A		155	M protein; helical coiled coil, fibrinogen-binding	81.76
1nkp_B		83	MAX protein, MYC proto-oncogene protein; transcrip	81.74
4etp_A		403	Kinesin-like protein KAR3; kinesin motor protein,	81.3
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	81.02
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	80.94
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	80.92
1gu4_A		78	CAAT/enhancer binding protein beta; transcription/	80.65
1go4_E		100	MAD1 (mitotic arrest deficient)-like 1; mitotic sp	80.32
1kd8_B		36	GABH BLL, GCN4 acid base heterodimer base-D12LA16L	80.21
2dq0_A		455	Seryl-tRNA synthetase; coiled-coil, homodimer, str	80.1

>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1	Back alignment and structure

Probab=99.44  E-value=1.2e-13  Score=108.93  Aligned_cols=52  Identities=33%  Similarity=0.526  Sum_probs=48.9

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 007579          434 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDS  485 (597)
Q Consensus       434 KR~KRILaNRESAaRSReRKKqYIeELE~KVq~LQtEN~tLsaQLtlLqre~  485 (597)
                      ||++|+++||+||++||+||++|+++||.+|..|+.||..|..++..|+..+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999999887654

PyMOL of 1dh3

>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D	Back alignment and structure

>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A	Back alignment and structure

>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D	Back alignment and structure

>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1	Back alignment and structure

>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A	Back alignment and structure

>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus}	Back alignment and structure

>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A	Back alignment and structure

>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus}	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens}	Back alignment and structure

>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A	Back alignment and structure

>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens}	Back alignment and structure

>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A	Back alignment and structure

>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens}	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D*	Back alignment and structure

>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus}	Back alignment and structure

>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1	Back alignment and structure

>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B	Back alignment and structure

>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene}	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens}	Back alignment and structure

>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A	Back alignment and structure

>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus}	Back alignment and structure

>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A*	Back alignment and structure

>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens}	Back alignment and structure

>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus}	Back alignment and structure

>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus}	Back alignment and structure

>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M	Back alignment and structure

>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B	Back alignment and structure

>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A	Back alignment and structure

>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1	Back alignment and structure

>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B	Back alignment and structure

>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		597
d1seta1		110	Seryl-tRNA synthetase (SerRS) {Thermus thermophilu	92.25
d1sknp_		74	Skn-1 {Caenorhabditis elegans [TaxId: 6239]}	80.08

>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}	Back information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=92.25  E-value=0.43  Score=38.95  Aligned_cols=98  Identities=13%  Similarity=0.160  Sum_probs=48.5

Q ss_pred             ChHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
Q 007579          432 DPKRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLT-NQNNELKFRLQAMEQQAQLRD  510 (597)
Q Consensus       432 DpKR~KRILaNRESAaRSReRKKqYIeELE~KVq~LQtEN~tLsaQLtlLqre~~~L~-aEN~ELK~RLqaLEqQaqLrd  510 (597)
                      ++..++..+++|-....     ...+.+|..+...|+.+...|.++...+.++...+. .+..+|+.++..|..+..-.+
T Consensus        10 n~e~v~~~l~~R~~~~~-----ld~i~~ld~~rr~l~~~~e~l~~~rN~~sk~i~k~~~~~~~~l~~~~k~lk~~i~~le   84 (110)
T d1seta1          10 EPEVFHRAIREKGVALD-----LEALLALDREVQELKKRLQEVQTERNQVAKRVPKAPPEEKEALIARGKALGEEAKRLE   84 (110)
T ss_dssp             CHHHHHHHHHHTTCCCC-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHcCCccC-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHHHHH
Confidence            44455555555543221     234455555555555555555555444444332211 122334444444444444444


Q ss_pred             HHHHHHHHHHHHHHHHhccccCCC
Q 007579          511 ALNEALTAEVRRLKVATQEMASES  534 (597)
Q Consensus       511 ALnEaLkeEVqrLK~a~gEi~~~~  534 (597)
                      .....+.+++..+...++.++.++
T Consensus        85 ~~~~~~~~~l~~~ll~iPNi~~~~  108 (110)
T d1seta1          85 EALREKEARLEALLLQVPLPPWPG  108 (110)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCTT
T ss_pred             HHHHHHHHHHHHHHHcCCCCCCcc
Confidence            445566677777777777776654

PyMOL of d1seta1

>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure