Citrus Sinensis ID: 007603
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 596 | ||||||
| 255583245 | 688 | nucleic acid binding protein, putative [ | 0.919 | 0.796 | 0.456 | 1e-128 | |
| 356496890 | 602 | PREDICTED: KH domain-containing protein | 0.726 | 0.719 | 0.448 | 4e-93 | |
| 225464083 | 648 | PREDICTED: KH domain-containing protein | 0.869 | 0.799 | 0.393 | 1e-92 | |
| 356529691 | 611 | PREDICTED: poly(rC)-binding protein 3-li | 0.706 | 0.689 | 0.443 | 5e-92 | |
| 297821485 | 633 | KH domain-containing protein [Arabidopsi | 0.744 | 0.701 | 0.430 | 4e-91 | |
| 4314357 | 649 | putative RNA-binding protein [Arabidopsi | 0.875 | 0.804 | 0.382 | 2e-87 | |
| 30681758 | 632 | RNA-binding KH domain-containing protein | 0.728 | 0.686 | 0.421 | 4e-87 | |
| 224097168 | 404 | predicted protein [Populus trichocarpa] | 0.644 | 0.950 | 0.460 | 1e-86 | |
| 357485457 | 596 | Poly(rC)-binding protein [Medicago trunc | 0.721 | 0.721 | 0.411 | 2e-83 | |
| 356546743 | 663 | PREDICTED: poly(rC)-binding protein 3-li | 0.692 | 0.622 | 0.4 | 1e-75 |
| >gi|255583245|ref|XP_002532387.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527911|gb|EEF29999.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 465 bits (1196), Expect = e-128, Method: Compositional matrix adjust.
Identities = 286/626 (45%), Positives = 367/626 (58%), Gaps = 78/626 (12%)
Query: 1 MMHHSNPYGYSSKRRGPLNLPDDVVSFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIHC 60
M HH + R P+ L V+FR+VC ++GGLIGRSGS IS IRRDT C +HC
Sbjct: 1 MQHHRDRRRRPRPTRPPVMLQPGQVAFRVVCHASIIGGLIGRSGSAISQIRRDTGCTVHC 60
Query: 61 EGGFPGSDHRVILVVGSGSIDRRIMF----CENDVVVEGGE---VSSTQEAVIRVFERMW 113
+ GSDHRVI +VG S +RI C + E E VS QEAVIRV ERMW
Sbjct: 61 DEQVQGSDHRVITIVGPASPGKRITLNSTTCHDHNGAEEEEKELVSVAQEAVIRVCERMW 120
Query: 114 EVEAEVEGDGDGDDVA--------YCGLLANTTKIGVVVGKGGRNVTRMRIESGAKIVML 165
EV+ + E G D+ + YCGLLA+TT+IG VVGKGG+NV RMR ESGA I L
Sbjct: 121 EVDGQRERRGGVDNNSNNSGLGEGYCGLLADTTQIGAVVGKGGKNVLRMRRESGADIRFL 180
Query: 166 PPPACAAIDDQLIQITGATLAVKKALVAVTTCLQHLSTMEKSPICFNRPIEKVFYSNSSD 225
PPP CA+ DDQLIQITG+ LAVKKALVAVT CL EK P RP+E+ + SSD
Sbjct: 181 PPPHCASKDDQLIQITGSILAVKKALVAVTDCLHDCPPYEKDPTLLMRPLERASHLASSD 240
Query: 226 PHREFFPHL-SLVPPLTGNPSDNASEFHSSSADADRDHPGLDKKGRKQEVALRMLFSGWT 284
PH EFFPHL SL+PPL+GN + H S+DA D P D + + EV+ R+L S
Sbjct: 241 PHAEFFPHLSSLLPPLSGNSGTS----HPLSSDAGED-PNQDAEAVRHEVSFRLLCSNGA 295
Query: 285 ASGIIGKRGAIVRSLQNASGALISFAAPLTKSGERVVTISALEYLDTRHSPVQNAAVLVF 344
A IIGK+G IVR+LQN +GA I FAAP++ SGERVVTISALE L++ HSP QNAA+LVF
Sbjct: 296 AGSIIGKKGTIVRTLQNETGASIMFAAPMSMSGERVVTISALENLESWHSPAQNAAILVF 355
Query: 345 ARSVEVEGQQGFSSGENKGDAVAVSILVGADFVGCLTGSGSSAV--SEMEDVTGTDIKLV 402
ARSVE + ++G SG +G V +LV +D V CL G + SEM +V+G DI+++
Sbjct: 356 ARSVEHDIEKGHPSGLIEGATVTARLLVASDAVCCLIEKGGTGNIDSEMIEVSGADIRIL 415
Query: 403 GGEQVLGCAAQNDVVIQISGEYKNVQNALSEVVGRLRHNLKSGEILNEARPRSPSGRVGG 462
GEQ++ CA+++DVVI+I+GEYKNVQNAL V G+LR
Sbjct: 416 DGEQIMACASEDDVVIEITGEYKNVQNALFMVTGKLR----------------------- 452
Query: 463 PALHKLHQSVALSPEFEQETIAVQGVDQFVL-------PLNRSQTLQTEGRRHATPTTDG 515
LSP+ +QET + ++Q L R Q+ Q R H T +
Sbjct: 453 ----------GLSPDSDQETSLTRAMNQLGFSSSFNNASLPRLQSAQKFQREHTTAIKNQ 502
Query: 516 KPGSRMFEGSLELEKSLVHLLPTDMVDEVGPRSCSDGMTTASG--------------EDN 561
+ + F G LE+SL LLP ++++EVG RS S G+ + +D
Sbjct: 503 ENSLQAFGGGSGLERSLHFLLPKEVLNEVGERSSSGGVRQTTSSGSHSSSGLAPGPIQDT 562
Query: 562 MLTEGVSQLGLSDNIIGPS-TLQLPK 586
LT G++Q LS+NI PS L +P+
Sbjct: 563 SLTRGINQPQLSNNIDFPSPALHMPQ 588
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356496890|ref|XP_003517298.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225464083|ref|XP_002269250.1| PREDICTED: KH domain-containing protein At4g18375-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356529691|ref|XP_003533422.1| PREDICTED: poly(rC)-binding protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297821485|ref|XP_002878625.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324464|gb|EFH54884.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|4314357|gb|AAD15568.1| putative RNA-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30681758|ref|NP_850026.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] gi|330252232|gb|AEC07326.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224097168|ref|XP_002310861.1| predicted protein [Populus trichocarpa] gi|222853764|gb|EEE91311.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357485457|ref|XP_003613016.1| Poly(rC)-binding protein [Medicago truncatula] gi|355514351|gb|AES95974.1| Poly(rC)-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356546743|ref|XP_003541782.1| PREDICTED: poly(rC)-binding protein 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 596 | ||||||
| TAIR|locus:2066020 | 632 | AT2G22600 "AT2G22600" [Arabido | 0.75 | 0.707 | 0.352 | 8.7e-65 | |
| TAIR|locus:2017612 | 621 | AT1G51580 "AT1G51580" [Arabido | 0.318 | 0.305 | 0.350 | 2.2e-23 | |
| TAIR|locus:2161413 | 644 | AT5G46190 "AT5G46190" [Arabido | 0.786 | 0.728 | 0.231 | 9e-20 | |
| TAIR|locus:2168367 | 652 | RCF3 "AT5G53060" [Arabidopsis | 0.491 | 0.449 | 0.241 | 1.4e-13 | |
| TAIR|locus:2035807 | 479 | AT1G14170 "AT1G14170" [Arabido | 0.375 | 0.467 | 0.251 | 8.3e-13 | |
| TAIR|locus:2150956 | 548 | AT5G15270 "AT5G15270" [Arabido | 0.332 | 0.361 | 0.268 | 1e-12 | |
| TAIR|locus:2084908 | 577 | FLK "AT3G04610" [Arabidopsis t | 0.342 | 0.353 | 0.248 | 2.8e-08 | |
| TAIR|locus:2120755 | 495 | PEP "AT4G26000" [Arabidopsis t | 0.283 | 0.341 | 0.239 | 3.4e-06 | |
| TAIR|locus:2831364 | 606 | AT4G18375 "AT4G18375" [Arabido | 0.244 | 0.240 | 0.254 | 2.7e-05 | |
| ZFIN|ZDB-GENE-050706-149 | 222 | zgc:110045 "zgc:110045" [Danio | 0.330 | 0.887 | 0.248 | 3.1e-05 |
| TAIR|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 629 (226.5 bits), Expect = 8.7e-65, Sum P(2) = 8.7e-65
Identities = 168/476 (35%), Positives = 239/476 (50%)
Query: 12 SKRRGPLNLPDDVVSFRLVCPTPVVXXXXXXXXXXXXXXXXDTKCRIHCEGGFPGSDHRV 71
SKRR +++ D + R+VC V+ +T +IHCE GSDH V
Sbjct: 12 SKRRPVIHVLPDETAIRVVCHASVIGGIIGSNGYVVSKLRRETGTKIHCESPVNGSDHWV 71
Query: 72 ILVVGSGSIDRRIMFCENDVVVEGGE--------VSSTQEAVIRVFERMWXXXXXXXXXX 123
+ +VGS ++++ I+ + GGE VS+ Q A+IRV ER W
Sbjct: 72 VFIVGSTAVNQSILLTDRVGEFSGGEHEDWVTCEVSAAQTALIRVLERSWVVLAAKDGGG 131
Query: 124 XXXXX---XYCGLLAXXXXXXXXXXXXXXXXXXMRIESGAKIVMLPPPACAAIDDQLIQI 180
YCG+LA MR SGA I +LPPP C +D+LIQI
Sbjct: 132 VVDGEDEEAYCGILADRNQIGAVLGLGGKNVEWMRRNSGAMIRVLPPPICGTKNDELIQI 191
Query: 181 TGXXXXXXXXXXXXXXCLQHLSTMEKSPICFN-RPIEKVFYS-NSSDPHREFFPHLSLVP 238
TG +Q+ + + P + + E + NS DPH EFFP+L
Sbjct: 192 TGDVLAVKKALVMVSSYIQNNAPLNGYPPPLSIKGYESLSTDGNSEDPHSEFFPNLR--- 248
Query: 239 PLTGNPSDNASEFHSSSADADRDHPGLDKKGRKQEVALRMLFSGWTASGIIGKRGAIVRS 298
+ NA+E +S+ D G + RK V +++F+ A GIIGK+G I+R+
Sbjct: 249 ---SSSLSNATEIVASNRHLPYD--GGNSTERK--VVFKIIFTSVVAGGIIGKQGTIIRA 301
Query: 299 LQNASGALISFAAPLTKSGERVVTISALEYLDTRHSPVQNAAVLVFARSVEVEGQQGFSS 358
LQN +GA IS APL SGERVVT+SA E L++R+S QNA LVFARSVE++ ++G
Sbjct: 302 LQNETGASISVGAPLKVSGERVVTVSARENLESRYSHAQNALALVFARSVEIDVEKGLRP 361
Query: 359 GENKGDAVAVSILVGADFVGCLTGSGSSAVSEMEDVTGTDIKLVGGEQVLGCAAQNDVVI 418
G + G V +LV + F G+G+ E TG D+ + G QVL ++N+VVI
Sbjct: 362 GLHNGAIVKTKLLVPSHFANSFNGNGNR---EAIIATGADVHISVGNQVLEWISENEVVI 418
Query: 419 QISGEYKNVQNALSEVVGRLRHNLKSGEILNEARPR--SPSGRVGGPA-LHKLHQS 471
+I GEY +VQ AL+ V +LR NL ++L E R R +P GG + ++ L S
Sbjct: 419 EIKGEYSHVQKALTHVSSKLRENLLPKKVLGEMRARVSNPYESAGGRSQIYNLQPS 474
|
|
| TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050706-149 zgc:110045 "zgc:110045" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 596 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 3e-12 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 2e-08 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-08 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 2e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-07 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 4e-07 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-06 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 8e-06 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 1e-05 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-05 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 2e-05 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 2e-05 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 3e-05 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 7e-05 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-04 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 6e-04 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 0.003 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 61.3 bits (150), Expect = 3e-12
Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
Query: 26 SFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIHCEGGF-PGSDHRVILVVGS 77
+ RL+ P+ G +IG+ GS I IR +T +I PGS RV+ + G
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGSTERVVTISGK 53
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 596 | |||
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 100.0 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 100.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 100.0 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 100.0 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.96 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.96 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.94 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.9 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.85 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.61 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.45 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.43 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.43 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.38 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.31 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.31 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.26 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.21 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.18 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.13 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.11 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.05 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 99.03 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.01 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.01 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 98.94 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.93 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.83 | |
| PF13014 | 43 | KH_3: KH domain | 98.8 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.77 | |
| PF13014 | 43 | KH_3: KH domain | 98.76 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.63 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.52 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.47 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.11 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.0 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.8 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.67 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 97.59 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 97.57 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.54 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.52 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.32 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.13 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.06 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.01 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 96.94 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.67 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 96.53 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.51 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 96.51 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.48 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.46 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 96.39 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 96.38 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.38 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.36 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.32 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 96.27 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.14 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.08 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.97 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.94 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.87 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 95.83 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 95.77 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 95.48 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 95.44 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 95.38 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 95.27 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 95.21 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.02 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 94.72 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 94.69 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 94.38 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 94.28 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 94.17 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 94.07 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.07 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 94.02 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.98 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 93.9 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 93.89 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 93.76 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 93.72 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 93.46 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 93.39 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 93.33 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 93.22 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 93.21 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 93.18 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 93.05 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 92.88 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 92.74 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 92.69 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 90.21 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 90.07 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 89.49 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 89.26 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 88.36 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 86.88 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 86.77 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 86.47 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 85.94 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 85.86 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 84.54 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 84.38 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 81.96 | |
| PRK13764 | 602 | ATPase; Provisional | 80.56 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 80.5 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 80.23 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 80.16 |
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-43 Score=381.14 Aligned_cols=370 Identities=28% Similarity=0.447 Sum_probs=294.4
Q ss_pred CCCCCcEEEEEEeccCccceeecCCChHHHHHHHHhCceEEEeCCCCCCCceEEEEccCcchhhhhhhccccccccCCCc
Q 007603 19 NLPDDVVSFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIHCEGGFPGSDHRVILVVGSGSIDRRIMFCENDVVVEGGEV 98 (596)
Q Consensus 19 ~~~~~~~~~rilvP~~~vg~IIGk~G~~Ik~Ir~eTga~I~V~~~~~g~~eRvi~I~G~~e~~~~a~~~~~~~~~e~~~~ 98 (596)
..++...+|||||+.+.+|.||||+|.+|++||++|.++|+|.+..+++.|||++|+|...+ ...
T Consensus 37 ~~p~~t~~~RlL~~~kevG~IIGk~G~~vkkir~~t~s~i~i~~~~~~c~eRIiti~g~~~~---------------~~~ 101 (485)
T KOG2190|consen 37 TGPDETLTYRLLCHVKEVGSIIGKKGDIVKKIRKETESKIRVNESLPGCPERIITITGNRVE---------------LNL 101 (485)
T ss_pred CCCCCcceEEEEeccccceeEEccCcHHHHHHhhcccccceeecCCCCCCcceEEEeccccc---------------ccC
Confidence 34444556999999999999999999999999999999999999999999999999997322 257
Q ss_pred cHHHHHHHHHHHHHHhhhhccC-----CC-CCCCCceEEEEEeccceeeeeeecCchhhhhhccccccEEEecCCCCCCC
Q 007603 99 SSTQEAVIRVFERMWEVEAEVE-----GD-GDGDDVAYCGLLANTTKIGVVVGKGGRNVTRMRIESGAKIVMLPPPACAA 172 (596)
Q Consensus 99 ~~A~~Al~~i~~~i~~~~~~~~-----~~-~~~~~~vt~rllVp~~~vG~IIGKgG~~Ik~I~~esGa~I~I~~~p~~~~ 172 (596)
+++++|++++++.+.....+++ .. ......+++|||||..++|+||||+|+.||+|+++|||+|+|.++ ..|.
T Consensus 102 ~~~~~al~ka~~~iv~~~~~d~~~~~d~~~~~~~~~v~~RLlVp~sq~GslIGK~G~~Ik~Ire~TgA~I~v~~~-~lP~ 180 (485)
T KOG2190|consen 102 SPATDALFKAFDMIVFKLEEDDEAAEDNGEDASGPEVTCRLLVPSSQVGSLIGKGGSLIKEIREETGAKIRVSSD-MLPN 180 (485)
T ss_pred CchHHHHHHHHHHHhhcccccccccccCCccccCCceEEEEEechhheeeeeccCcHHHHHHHHhcCceEEecCC-CCCc
Confidence 8899999999999887533221 11 112226899999999999999999999999999999999999996 7788
Q ss_pred CCCcEEEEeecHHHHHHHHHHHHHHHhccCCCCC---CCcccCCCccccccCCCCCCCCCcCCCcCCCCCCCCCCCCCCC
Q 007603 173 IDDQLIQITGATLAVKKALVAVTTCLQHLSTMEK---SPICFNRPIEKVFYSNSSDPHREFFPHLSLVPPLTGNPSDNAS 249 (596)
Q Consensus 173 ~~dRiV~I~G~~e~V~~A~~~I~~~L~e~~~~~~---~~~~~~~P~~~~~~~~~~~~~~~~~p~~~~~p~~~~~~~~ya~ 249 (596)
+++|.|+|.|.+++|.+|+..|..+|++++.+.- ....+|+|... .+...+|.......+++
T Consensus 181 ster~V~IsG~~~av~~al~~Is~~L~~~~~~~~~~~~st~~y~P~~~--------------~~~~~~~s~~~~~~~~~- 245 (485)
T KOG2190|consen 181 STERAVTISGEPDAVKKALVQISSRLLENPPRSPPPLVSTIPYRPSAS--------------QGGPVLPSTAQTSPDAH- 245 (485)
T ss_pred ccceeEEEcCchHHHHHHHHHHHHHHHhcCCcCCCCCCCcccCCCccc--------------ccCccccccccCCcccc-
Confidence 8999999999999999999999999999754311 11123333100 00011111111000000
Q ss_pred cccCCCCCCCCCCCCCCccCCCcceEEEEEeccccccccccccchhhhhhhhccCeeEEEeCCCCCCCccEEEEEecCCC
Q 007603 250 EFHSSSADADRDHPGLDKKGRKQEVALRMLFSGWTASGIIGKRGAIVRSLQNASGALISFAAPLTKSGERVVTISALEYL 329 (596)
Q Consensus 250 ~~~p~~~~~~r~~p~~~~~~~~~~~~~~l~VP~~~vg~IIGk~G~~Ik~I~~~tGa~I~i~~~~~~~~er~v~IsG~e~p 329 (596)
..+ ....+.+..+++.+|...++.|||++|..|+.++.++|+.|.+.....+ ++|+++..+.|
T Consensus 246 --------~~~------~~~~~~e~~~~~~~p~~~~~~v~g~~~~~i~~l~~~~~~~i~v~~~~~~---~~i~~s~~e~~ 308 (485)
T KOG2190|consen 246 --------PFG------GIVPEEELVFKLICPSDKVGSVIGKGGLVIRALRNETGASISVGDSRTD---RIVTISARENP 308 (485)
T ss_pred --------ccc------ccccchhhhhhhcCchhhceeeecCCCccchhhhhhcCCceEeccccCc---ceeeeccccCc
Confidence 000 0223466788999999999999999999999999999999999977554 89999999999
Q ss_pred CCCCchHHHHHHHHHhhhhhccccCCCCCCCCCCCceEEEEEeccccccccccCCCchhHHHHHHhCCeEEEeCCCcccc
Q 007603 330 DTRHSPVQNAAVLVFARSVEVEGQQGFSSGENKGDAVAVSILVGADFVGCLTGSGSSAVSEMEDVTGTDIKLVGGEQVLG 409 (596)
Q Consensus 330 ~~~~~~a~~Av~~i~~~i~e~~~~~g~~~g~~~~~~~t~~l~VP~~~vG~IIGkgG~~Ik~I~~~TGa~I~I~~~~~~P~ 409 (596)
++..+++++|+++++.++.+..... . ...++.+|+||++++||||||+|++|.+|++.|||.|+|...++.
T Consensus 309 ~~~~s~a~~a~~~~~~~~~~~~~~~------~-~~~v~~~l~vps~~igciiGk~G~~iseir~~tgA~I~I~~~~~~-- 379 (485)
T KOG2190|consen 309 EDRYSMAQEALLLVQPRISENAGDD------L-TQTVTQRLLVPSDLIGCIIGKGGAKISEIRQRTGASISILNKEEV-- 379 (485)
T ss_pred ccccccchhhhhhcccccccccccc------c-cceeeeeeccCccccceeecccccchHHHHHhcCCceEEcccccc--
Confidence 9999999999999999986643211 1 466899999999999999999999999999999999999998763
Q ss_pred cCCCCCcEEEEcCCHHHHHHHHHHHHHHHhhcccccc
Q 007603 410 CAAQNDVVIQISGEYKNVQNALSEVVGRLRHNLKSGE 446 (596)
Q Consensus 410 ~~~~~er~V~I~G~~~~V~~A~~~I~~~Lr~~~~~~~ 446 (596)
...+++.++|+|...+...|++++..++...-....
T Consensus 380 -~~~~e~~~~I~~~~~~~~~~~~~~~~~~~~~~~~~~ 415 (485)
T KOG2190|consen 380 -SGVREALVQITGMLREDLLAQYLIRARLSAPKSSMG 415 (485)
T ss_pred -CCcceeEEEecchhHHHHhhhhhcccccccCccCCC
Confidence 257799999999999999999999888776554433
|
|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 596 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-27 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 3e-20 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 9e-13 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-07 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 6e-04 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-25 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-21 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 7e-07 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 1e-24 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-23 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 1e-08 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 5e-06 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-23 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 9e-21 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 8e-14 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-07 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-21 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-16 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-09 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-07 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-06 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 9e-11 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 6e-07 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 1e-06 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-10 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 5e-07 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-06 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-09 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 4e-08 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 1e-06 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 7e-04 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 6e-09 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 5e-07 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 9e-07 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 3e-08 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 4e-07 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 4e-06 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 8e-08 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-06 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 2e-04 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 9e-08 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 8e-06 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 5e-05 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-04 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 1e-07 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 4e-06 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 5e-05 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-07 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 5e-07 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-04 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-07 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 9e-06 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 5e-05 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 4e-07 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 3e-06 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 2e-04 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 7e-04 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-06 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 5e-05 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 6e-06 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 3e-05 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 3e-05 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 7e-05 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 2e-04 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
Score = 108 bits (271), Expect = 1e-27
Identities = 31/182 (17%), Positives = 75/182 (41%), Gaps = 12/182 (6%)
Query: 21 PDDVVSFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIH---CEGGFPGSDHRVILVVGS 77
+++ P+ G +IG+ G I ++++T I + +PG+ RV L+ G+
Sbjct: 2 LGSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGT 61
Query: 78 GSIDRRIMFCENDVVVEGGEVSSTQEAVIRVFERMWEVEAEVEGDGDGDDVAYCGLLANT 137
+ + + E + + E + + + D ++
Sbjct: 62 IEALNAVHGFIAEKIREMPQNVAKTEP---------VSILQPQTTVNPDRANQVKIIVPN 112
Query: 138 TKIGVVVGKGGRNVTRMRIESGAKIVMLPPPACAAIDDQLIQITGATLAVKKALVAVTTC 197
+ G+++GKGG V + +SGA + + P + ++++ ++G +KA+ +
Sbjct: 113 STAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQNRVVTVSGEPEQNRKAVELIIQK 172
Query: 198 LQ 199
+Q
Sbjct: 173 IQ 174
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 596 | |||
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.92 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.91 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.91 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.9 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.89 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.89 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.89 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.89 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.88 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.88 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.88 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.8 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.71 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.67 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.54 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.5 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.47 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.45 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.45 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.45 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.44 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.43 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.4 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.4 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.4 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.4 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.4 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.39 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.39 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.38 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.36 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.35 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.35 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.33 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.33 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.33 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.32 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.31 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.31 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.3 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.3 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.3 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.29 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.28 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.28 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.28 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.24 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.24 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.23 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.21 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.16 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.13 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.12 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.1 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.07 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.06 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 98.99 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 98.98 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 98.95 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.83 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.76 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.52 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.44 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.28 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.26 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.18 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.87 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.79 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.64 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.58 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.57 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.48 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 96.89 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 96.87 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 96.82 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 96.69 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 95.51 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 95.43 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 94.32 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 93.82 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 93.49 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 92.89 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 92.86 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 92.06 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 91.05 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 90.46 |
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
Probab=99.92 E-value=3.6e-25 Score=211.90 Aligned_cols=161 Identities=20% Similarity=0.385 Sum_probs=126.6
Q ss_pred CCcEEEEEEeccCccceeecCCChHHHHHHHHhCceEEEeCC---CCCCCceEEEEccCcchhhhhhhccccccccCCCc
Q 007603 22 DDVVSFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIHCEGG---FPGSDHRVILVVGSGSIDRRIMFCENDVVVEGGEV 98 (596)
Q Consensus 22 ~~~~~~rilvP~~~vg~IIGk~G~~Ik~Ir~eTga~I~V~~~---~~g~~eRvi~I~G~~e~~~~a~~~~~~~~~e~~~~ 98 (596)
+++++++|+||.+++|.||||+|++|++|+++|||+|+|.+. .+++.+|+|+|+|+.+++.+|.
T Consensus 3 ~~~~~~~i~vp~~~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~------------- 69 (178)
T 2anr_A 3 GSQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVH------------- 69 (178)
T ss_dssp CCCEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHH-------------
T ss_pred CCCEEEEEEEChhHeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHH-------------
Confidence 678999999999999999999999999999999999999753 4678899999999877644332
Q ss_pred cHHHHHHHHHHHHHHhhhhcc-----------CCCCCCCCceEEEEEeccceeeeeeecCchhhhhhccccccEEEecCC
Q 007603 99 SSTQEAVIRVFERMWEVEAEV-----------EGDGDGDDVAYCGLLANTTKIGVVVGKGGRNVTRMRIESGAKIVMLPP 167 (596)
Q Consensus 99 ~~A~~Al~~i~~~i~~~~~~~-----------~~~~~~~~~vt~rllVp~~~vG~IIGKgG~~Ik~I~~esGa~I~I~~~ 167 (596)
..+.+.+.+..... ......+...+++|+||..++|+||||+|++|++|+++|||+|+|.+.
T Consensus 70 -------~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~ 142 (178)
T 2anr_A 70 -------GFIAEKIREMPQNVAKTEPVSILQPQTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQK 142 (178)
T ss_dssp -------HHHHHHHTCCCCC-----------------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCC
T ss_pred -------HHHHHHHhccCCccccCCcccccCCccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCC
Confidence 22222222111000 000112335789999999999999999999999999999999999885
Q ss_pred CCCCCCCCcEEEEeecHHHHHHHHHHHHHHHhccC
Q 007603 168 PACAAIDDQLIQITGATLAVKKALVAVTTCLQHLS 202 (596)
Q Consensus 168 p~~~~~~dRiV~I~G~~e~V~~A~~~I~~~L~e~~ 202 (596)
+.++...+|+|+|+|+.++|.+|+.+|.++|++++
T Consensus 143 ~~~~~~~~~~v~I~G~~~~v~~A~~~I~~~i~e~p 177 (178)
T 2anr_A 143 PDGINLQNRVVTVSGEPEQNRKAVELIIQKIQEDP 177 (178)
T ss_dssp C----CCEEEEEEESSHHHHHHHHHHHHHHHHSCC
T ss_pred CCCCCCCceEEEEEcCHHHHHHHHHHHHHHHHhCC
Confidence 44566788999999999999999999999998854
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 596 | ||||
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 2e-09 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 5e-07 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 1e-04 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 2e-04 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 4e-09 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 7e-08 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-05 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 8e-05 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-08 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 8e-08 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 1e-05 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 2e-05 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 1e-08 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 1e-06 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-04 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-04 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 2e-08 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 2e-06 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-04 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 4e-08 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 2e-06 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 3e-05 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 7e-04 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 9e-08 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 8e-07 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 2e-06 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 0.002 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 1e-07 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 4e-07 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 6e-05 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 0.004 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 4e-07 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 7e-06 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 9e-06 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 8e-06 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 2e-04 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-05 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 5e-05 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 0.001 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 0.001 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 3e-05 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 4e-04 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 8e-04 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 0.001 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 1e-04 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 0.003 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 0.004 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 4e-04 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 0.001 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 0.002 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 0.002 |
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.8 bits (124), Expect = 2e-09
Identities = 16/53 (30%), Positives = 27/53 (50%)
Query: 25 VSFRLVCPTPVVGGLIGRSGSIISSIRRDTKCRIHCEGGFPGSDHRVILVVGS 77
+ L P ++G +IGR G+ I+ IR+ + +I GS R + + GS
Sbjct: 2 TTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGS 54
|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 596 | |||
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.52 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.51 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.5 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.5 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.5 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.49 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.48 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.46 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.45 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.45 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.44 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.44 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.42 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.42 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.38 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.34 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.12 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.12 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.12 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.95 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 98.93 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.8 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.7 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.63 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.49 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.47 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.4 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.34 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.33 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.23 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.2 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 97.78 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 97.71 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.2 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.11 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.35 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 94.2 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.12 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 93.94 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 83.1 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 81.1 |
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: HnRNP K, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55 E-value=4.8e-15 Score=119.29 Aligned_cols=73 Identities=19% Similarity=0.398 Sum_probs=66.6
Q ss_pred CceEEEEEeccccccccccCCCchhHHHHHHhCCeEEEeCCCcccccCCCCCcEEEEcCCHHHHHHHHHHHHHHHhhc
Q 007603 364 DAVAVSILVGADFVGCLTGSGSSAVSEMEDVTGTDIKLVGGEQVLGCAAQNDVVIQISGEYKNVQNALSEVVGRLRHN 441 (596)
Q Consensus 364 ~~~t~~l~VP~~~vG~IIGkgG~~Ik~I~~~TGa~I~I~~~~~~P~~~~~~er~V~I~G~~~~V~~A~~~I~~~Lr~~ 441 (596)
..+|.+|.||.+++|+|||++|++|++|+++|||+|+|.+..+ ..+++.|+|+|++++|+.|+.+|.++|++|
T Consensus 2 p~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~~~-----~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~ 74 (75)
T d1zzka1 2 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLE-----GSEDRIITITGTQDQIQNAQYLLQNSVKQY 74 (75)
T ss_dssp CCEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCTTS-----CSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred CcEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccCCC-----CCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence 3578999999999999999999999999999999999976432 467899999999999999999999999986
|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|