Citrus Sinensis ID: 007651
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 594 | ||||||
| 225428300 | 750 | PREDICTED: uncharacterized protein LOC10 | 0.914 | 0.724 | 0.571 | 1e-164 | |
| 255559820 | 767 | bromodomain-containing protein [Ricinus | 0.919 | 0.711 | 0.569 | 1e-159 | |
| 224102791 | 758 | bromodomain protein [Populus trichocarpa | 0.888 | 0.696 | 0.540 | 1e-153 | |
| 449454289 | 776 | PREDICTED: uncharacterized protein LOC10 | 0.912 | 0.698 | 0.501 | 1e-129 | |
| 449528661 | 622 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.912 | 0.871 | 0.5 | 1e-128 | |
| 359491912 | 691 | PREDICTED: uncharacterized protein LOC10 | 0.816 | 0.701 | 0.45 | 1e-108 | |
| 147814821 | 688 | hypothetical protein VITISV_012026 [Viti | 0.816 | 0.704 | 0.446 | 1e-108 | |
| 224132440 | 546 | bromodomain protein [Populus trichocarpa | 0.449 | 0.489 | 0.649 | 2e-99 | |
| 297745559 | 634 | unnamed protein product [Vitis vinifera] | 0.722 | 0.676 | 0.426 | 1e-96 | |
| 297744477 | 4608 | unnamed protein product [Vitis vinifera] | 0.570 | 0.073 | 0.564 | 3e-93 |
| >gi|225428300|ref|XP_002279830.1| PREDICTED: uncharacterized protein LOC100245230 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 585 bits (1507), Expect = e-164, Method: Compositional matrix adjust.
Identities = 334/584 (57%), Positives = 399/584 (68%), Gaps = 41/584 (7%)
Query: 31 RLYQIKSYCCSSSIDFKMDPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFL 90
RL + SY S +DP+ELPDY EVIEHPMDFGTVR LA GAYA+LEQFEKDVFL
Sbjct: 188 RLQKKDSYGVFSE---PVDPKELPDYHEVIEHPMDFGTVRKNLAGGAYASLEQFEKDVFL 244
Query: 91 ICSNAMQYNAPDTIYFRQARSIHELAKKNFENLRQDSDDNEPETKVVRRGRPPTKNFKKP 150
ICSNAMQYNAPDTIYF+QARSI ELAKKNFENLRQDSDDNEPE K RRGRPPTKN KKP
Sbjct: 245 ICSNAMQYNAPDTIYFKQARSIQELAKKNFENLRQDSDDNEPEPK--RRGRPPTKNIKKP 302
Query: 151 LGRPSLERARSDFSSDVTLASGAENTALTNRDLGNGTPHLEKSGFTDS-SRRFSGS-WND 208
LGRPSLER S+FSSD TLA+G ENT +N DL G +KSG DS R G+ ++D
Sbjct: 303 LGRPSLERPGSEFSSDATLATGGENTMWSNHDLRKGALISDKSGPADSFGRSLHGTRYSD 362
Query: 209 LYTGCLAENKLERNDEV--SLSKGYSMKHGKKQVVLDENRRNTYKQFHQSL--RESSVLT 264
TG A+ KLER+DE S+ KG S+KH KK VLDENRRNTYKQ RE SVLT
Sbjct: 363 GNTGWSADQKLERHDEFTGSILKGISLKHAKKPFVLDENRRNTYKQSSSIAVGREPSVLT 422
Query: 265 TFDADKKQLMTVGLHSEHGYTRSLARFAANLGPVAWKIAARRIERCLPAGVRFGPGWVVE 324
TFD +KKQLM VGL++E+GY RSLARFA+NLGPVAWKIAA++IE+ LP GV+FGPGWV E
Sbjct: 423 TFDGEKKQLMPVGLNAEYGYARSLARFASNLGPVAWKIAAKKIEKSLPPGVKFGPGWVGE 482
Query: 325 NDLAPQRPLLLSSATVGLPSSSQPS-LIPENLSSASTHSTIELKGDKLTERPEAEDSSEK 383
ND+ P +PL + S+T P SS P IP ++ S + + G L ER
Sbjct: 483 NDVIPPKPLFVPSST---PLSSLPGDSIPCSMDSQEDKPSQKTGGIGLPERNVL------ 533
Query: 384 PGPSTQSSLDGHFKKPNTSS------LLVVNRFSEPAKEKAEIIEGLKSQ--LNLVNSSM 435
S +++L H K +S + N+ S P+ E GL +Q +++NSS
Sbjct: 534 ---SARAALANHPGKSLLTSAAASPLINTANKASGPSSGSTEASIGLNAQSGFSILNSSA 590
Query: 436 GAINTRPPFQIHQN-SVIRPGMNGFNGTYGFNMPSQMGKLIGAAGPAGFSFQSPQMVDRI 494
GA+ RPPFQIHQ + + PGMNGFNG YGFN+P+QMGK +GAA P GF+ Q+PQM+D I
Sbjct: 591 GAVRPRPPFQIHQGPTALHPGMNGFNGAYGFNIPTQMGKPMGAARPTGFNLQAPQMLDAI 650
Query: 495 SRTDTNFVQPVTASSLNSDDPKLDCSRSLQNLESLGSAPSLP---GNHQPTWQVSPHPKP 551
SRT NF P ++L +DPK + N S+P LP G +V PHP+P
Sbjct: 651 SRTTPNFGHPGMGNNLTPEDPKFLEKSTTTN----SSSPLLPHPGGEAAAAPRVGPHPQP 706
Query: 552 DL-GLTPQQKPDAVPPDLNVRFRSPGSPNSSRVDSTQPDLALQL 594
GL PQQ+ D+VPPDLNVRF+SPGSP+SS+VDSTQPDLALQL
Sbjct: 707 SWPGLPPQQRQDSVPPDLNVRFQSPGSPSSSKVDSTQPDLALQL 750
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255559820|ref|XP_002520929.1| bromodomain-containing protein [Ricinus communis] gi|223539895|gb|EEF41474.1| bromodomain-containing protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224102791|ref|XP_002312802.1| bromodomain protein [Populus trichocarpa] gi|222849210|gb|EEE86757.1| bromodomain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449454289|ref|XP_004144888.1| PREDICTED: uncharacterized protein LOC101218234 [Cucumis sativus] gi|449473925|ref|XP_004154023.1| PREDICTED: uncharacterized protein LOC101210731 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449528661|ref|XP_004171322.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101210731, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359491912|ref|XP_002272566.2| PREDICTED: uncharacterized protein LOC100244510 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147814821|emb|CAN74748.1| hypothetical protein VITISV_012026 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224132440|ref|XP_002328271.1| bromodomain protein [Populus trichocarpa] gi|222837786|gb|EEE76151.1| bromodomain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297745559|emb|CBI40724.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744477|emb|CBI37739.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 594 | ||||||
| TAIR|locus:2151948 | 916 | AT5G55040 "AT5G55040" [Arabido | 0.538 | 0.349 | 0.444 | 2e-75 | |
| TAIR|locus:2030422 | 652 | AT1G20670 "AT1G20670" [Arabido | 0.577 | 0.526 | 0.435 | 2.5e-75 | |
| TAIR|locus:2014594 | 580 | AT1G76380 "AT1G76380" [Arabido | 0.469 | 0.481 | 0.493 | 5.3e-73 | |
| UNIPROTKB|F1N3J5 | 596 | BRD9 "Uncharacterized protein" | 0.202 | 0.201 | 0.356 | 8.1e-11 | |
| MGI|MGI:2145317 | 596 | Brd9 "bromodomain containing 9 | 0.163 | 0.162 | 0.396 | 1.3e-10 | |
| MGI|MGI:1888520 | 1400 | Brd4 "bromodomain containing 4 | 0.183 | 0.077 | 0.350 | 1.3e-10 | |
| RGD|1307359 | 597 | Brd9 "bromodomain containing 9 | 0.163 | 0.162 | 0.392 | 1.7e-10 | |
| UNIPROTKB|Q9H8M2 | 597 | BRD9 "Bromodomain-containing p | 0.163 | 0.162 | 0.382 | 2.1e-10 | |
| UNIPROTKB|E9PSF3 | 821 | BRPF3 "Bromodomain and PHD fin | 0.138 | 0.099 | 0.440 | 4.7e-10 | |
| UNIPROTKB|B7ZLN5 | 871 | BRPF3 "Bromodomain and PHD fin | 0.138 | 0.094 | 0.440 | 5.1e-10 |
| TAIR|locus:2151948 AT5G55040 "AT5G55040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 650 (233.9 bits), Expect = 2.0e-75, Sum P(3) = 2.0e-75
Identities = 152/342 (44%), Positives = 205/342 (59%)
Query: 48 MDPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFLICSNAMQYNAPDTIYFR 107
+DPEELPDY ++IEHPMDF TVR KLANG+Y+TLE+ E DV LICSNAMQYN+ DT+Y++
Sbjct: 211 VDPEELPDYHDMIEHPMDFSTVRKKLANGSYSTLEELESDVLLICSNAMQYNSSDTVYYK 270
Query: 108 QARSIHELAKKNFENLRQDSDDNEPETKVVRRGRPPT---KNFKKPLGRPSLERARSDFS 164
QAR+I E+ K+ FE R E E K + +P + K ++P R LE SDFS
Sbjct: 271 QARTIQEMGKRKFEKARLKIKRAEKELKTDEKVKPDSSVKKQVRQPFSRNGLEAVGSDFS 330
Query: 165 SDVTLASG-AENTALTNRDLGNGTPHLEKSGFTDSSRRFSGSWNDLYTGCLAENKLERND 223
S LASG A + +G H EK +TD F G+ + L ++ LE+ +
Sbjct: 331 SGANLASGGASQNEPVSTQIGG---H-EKHSYTDVL--FEGNTS------LVDS-LEKAE 377
Query: 224 EVSLSKGYSMKHGKKQVVLDENRRNTYKQF-HQSLRESSVLTTFDADKKQLMTVGLHSEH 282
++S KG K G+K V++E+RR TY+ Q R S+ TTF+++ KQ + VGLH+EH
Sbjct: 378 DLSSGKGLFGKCGRKLSVVEEDRRATYEDSDQQGDRSESIFTTFESEIKQFVAVGLHAEH 437
Query: 283 GYTRSLARFAANLGPVAWKIAARRIERCLPAGVRFGPGWVVENDLAPQRPLLLSSATVGL 342
Y RSLARFAA LGPVAWKIA++RIE+ LPA +FG GWV E + P LL + T
Sbjct: 438 AYGRSLARFAATLGPVAWKIASQRIEQALPADFKFGRGWVGEYEPLPTPVLLFETCTPKE 497
Query: 343 PSSSQPSLIPENLSSASTHSTIELKGDKLTERPEAEDSSEKP 384
P + S+ + S+A+T + L L P E +P
Sbjct: 498 PPK-KASVFSKRKSNAATKTNETLFKTPL---PAKEQQGSRP 535
|
|
| TAIR|locus:2030422 AT1G20670 "AT1G20670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014594 AT1G76380 "AT1G76380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N3J5 BRD9 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2145317 Brd9 "bromodomain containing 9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1888520 Brd4 "bromodomain containing 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307359 Brd9 "bromodomain containing 9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H8M2 BRD9 "Bromodomain-containing protein 9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSF3 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZLN5 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 594 | |||
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 5e-27 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 4e-24 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 2e-22 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 6e-22 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 6e-20 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 2e-19 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 9e-18 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 4e-17 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 1e-16 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 4e-16 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 2e-14 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 1e-13 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 1e-13 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 6e-13 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 2e-12 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 4e-12 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 9e-12 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 3e-11 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 5e-11 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 1e-10 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 2e-10 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 3e-10 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 1e-09 | |
| cd05501 | 102 | cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li | 1e-09 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 7e-09 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 1e-08 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 2e-08 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 2e-08 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-07 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 2e-07 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 3e-07 | |
| cd05508 | 99 | cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf | 3e-07 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 5e-07 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 2e-06 | |
| cd05492 | 109 | cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like | 3e-04 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 0.004 |
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
Score = 104 bits (262), Expect = 5e-27
Identities = 39/89 (43%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
Query: 32 LYQIKSYCCSSSIDFKM--DPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVF 89
L +K S F DP+E PDY EVI++PMD T++ KL NG Y +LE+FE DV
Sbjct: 9 LDALKKLKRDLSEPFLEPVDPKEAPDYYEVIKNPMDLSTIKKKLKNGEYKSLEEFEADVR 68
Query: 90 LICSNAMQYNAPDTIYFRQARSIHELAKK 118
LI SNA YN P + ++ A+ + +L +K
Sbjct: 69 LIFSNAKTYNGPGSPIYKDAKKLEKLFEK 97
|
Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine. Length = 99 |
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.92 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.92 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.91 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.91 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.91 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.91 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.91 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.91 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.91 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.9 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.9 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.9 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.9 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 99.9 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.9 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.9 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.89 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.89 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.89 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.89 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.89 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.88 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.87 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.87 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.86 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.86 | |
| smart00297 | 107 | BROMO bromo domain. | 99.86 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.86 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.85 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.84 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.84 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.84 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 99.84 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.83 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.82 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.81 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.8 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.66 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.65 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 99.62 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 99.39 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.19 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.95 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.89 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 98.74 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 98.69 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 98.62 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.53 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 98.46 | |
| PF12024 | 245 | DUF3512: Domain of unknown function (DUF3512); Int | 98.33 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 98.27 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 98.17 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 96.86 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 95.86 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 90.06 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 85.87 |
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
Probab=99.92 E-value=2e-25 Score=196.17 Aligned_cols=95 Identities=25% Similarity=0.349 Sum_probs=91.7
Q ss_pred ccchHHHHHHHHhCCCCCCCcCCCCCCCCCCcccccCCccCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHhhhhcCCCCH
Q 007651 25 WNWDPQRLYQIKSYCCSSSIDFKMDPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFLICSNAMQYNAPDTI 104 (594)
Q Consensus 25 ~~wc~qIL~kLk~~~~A~~F~ePVD~~e~PDY~dIIK~PMDLsTIkkKL~~g~Y~SieEF~~DVrLIf~NA~~YN~pdS~ 104 (594)
+.+|.+||.+|++++.+++|.+|||+..+|||+++|++||||+||++||+++.|.++++|.+||+|||.||+.||++++.
T Consensus 2 ~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~iIk~PmDL~tI~~kl~~~~Y~s~~ef~~D~~li~~Na~~yN~~~s~ 81 (97)
T cd05505 2 LQKCEEILSKILKYRFSWPFREPVTADEAEDYKKVITNPMDLQTMQTKCSCGSYSSVQEFLDDMKLVFSNAEKYYENGSY 81 (97)
T ss_pred HHHHHHHHHHHHhCCCcccccCCCChhhcccHHHHcCCcCCHHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHCCCCCH
Confidence 35789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHH
Q 007651 105 YFRQARSIHELAKKN 119 (594)
Q Consensus 105 i~k~Ak~Le~lfek~ 119 (594)
++++|.+|++.|...
T Consensus 82 i~~~a~~le~~f~~~ 96 (97)
T cd05505 82 VLSCMRKTEQCCVNL 96 (97)
T ss_pred HHHHHHHHHHHHHHh
Confidence 999999999999765
|
The Williams-Beuren syndrome deletion transcript 9 is a putative transcriptional regulator. WSTF was found to play a role in vitamin D-mediated transcription as part of two chromatin remodeling complexes, WINAC and WICH. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. |
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PF12024 DUF3512: Domain of unknown function (DUF3512); InterPro: IPR021900 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 594 | ||||
| 3hme_A | 123 | Crystal Structure Of Human Bromodomain Containing 9 | 3e-12 | ||
| 3rcw_A | 135 | Crystal Structure Of The Bromodomain Of Human Brd1 | 8e-12 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 1e-10 | ||
| 2d9e_A | 121 | Solution Structure Of The Bromodomain Of Peregrin L | 3e-10 | ||
| 2i8n_A | 114 | Solution Structure Of The Second Bromodomain Of Brd | 2e-09 | ||
| 3jvl_A | 120 | Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le | 4e-09 | ||
| 3dai_A | 130 | Crystal Structure Of The Bromodomain Of The Human A | 7e-09 | ||
| 3lxj_A | 136 | Crystal Structure Of The Bromodomain Of Human Aaa D | 1e-08 | ||
| 2grc_A | 129 | 1.5 A Structure Of Bromodomain From Human Brg1 Prot | 3e-08 | ||
| 2lsp_B | 128 | Solution Structures Of Brd4 Second Bromodomain With | 3e-08 | ||
| 2ouo_A | 130 | Crystal Structure Of The Bromo Domain 2 In Human Br | 3e-08 | ||
| 3uvd_A | 124 | Crystal Structure Of The Bromodomain Of Human Trans | 7e-08 | ||
| 2h60_A | 128 | Solution Structure Of Human Brg1 Bromodomain Length | 8e-08 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 1e-07 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 1e-07 | ||
| 2g4a_A | 116 | Solution Structure Of A Bromodomain From Ring3 Prot | 1e-07 | ||
| 2e7n_A | 117 | Solution Structure Of The Second Bromodomain From H | 1e-07 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 1e-07 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-07 | ||
| 2dvv_A | 112 | Crystal Structure Of The Second Bromodomain Of The | 2e-07 | ||
| 3oni_A | 114 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-07 | ||
| 2dww_A | 114 | Crystal Structure Of Bromodomain-Containing Protein | 2e-07 | ||
| 2oo1_A | 113 | Crystal Structure Of The Bromo Domain 2 Of Human Br | 2e-07 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-07 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-07 | ||
| 2dat_A | 123 | Solution Structure Of The Bromodomain Of Human SwiS | 2e-07 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 3e-07 | ||
| 2dkw_A | 131 | Solution Structure Of The Bromodomain Of Human Prot | 7e-07 | ||
| 2e7o_A | 112 | Solution Structure Of The Bromodomain From Human Br | 1e-06 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-06 | ||
| 3q2e_A | 123 | Crystal Structure Of The Second Bromodomain Of Huma | 1e-06 | ||
| 3g0l_A | 117 | Crystal Structure Of Human Bromodomain Adjacent To | 1e-06 | ||
| 3d7c_A | 112 | Crystal Structure Of The Bromodomain Of Human Gcn5, | 1e-06 | ||
| 3dwy_A | 119 | Crystal Structure Of The Bromodomain Of Human Crebb | 2e-06 | ||
| 1jsp_B | 121 | Nmr Structure Of Cbp Bromodomain In Complex With P5 | 2e-06 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 2e-06 | ||
| 2wp1_A | 126 | Structure Of Brdt Bromodomain 2 Bound To An Acetyla | 2e-06 | ||
| 1f68_A | 103 | Nmr Solution Structure Of The Bromodomain From Huma | 3e-06 | ||
| 3i3j_A | 124 | Crystal Structure Of The Bromodomain Of Human Ep300 | 3e-06 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 8e-06 | ||
| 3k2j_A | 130 | Crystal Structure Of The 3rd Bromodomain Of Human P | 9e-06 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 1e-05 | ||
| 3mb3_A | 135 | Crystal Structure Of The Second Bromodomain Of Plec | 2e-05 | ||
| 3g0j_A | 124 | Crystal Structure Of The Fifth Bromodomain Of Human | 2e-05 | ||
| 2yqd_A | 120 | Solution Structure Of The Fifth Bromodomain From Mo | 2e-05 | ||
| 3fkm_X | 166 | Plasmodium Falciparum Bromodomain-Containing Protei | 4e-05 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 4e-05 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 4e-05 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 4e-05 | ||
| 3qzv_A | 174 | Crystal Structure Of Bptf Phd-Linker-Bromo In Compl | 7e-05 | ||
| 2ri7_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 8e-05 | ||
| 3qzs_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 1e-04 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 1e-04 | ||
| 2yyn_A | 135 | Crystal Sturcture Of Human Bromodomain Protein Leng | 1e-04 | ||
| 3qzt_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 1e-04 | ||
| 2r0y_A | 311 | Structure Of The Rsc4 Tandem Bromodomain In Complex | 2e-04 | ||
| 2r0s_A | 285 | Crystal Structure Of The Rsc4 Tandem Bromodomain Le | 2e-04 | ||
| 3uv2_A | 126 | Crystal Structure Of The Bromodomain Of Human Nucle | 2e-04 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 4e-04 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 4e-04 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 5e-04 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 5e-04 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 6e-04 | ||
| 3nxb_A | 116 | Crystal Structure Of The Bromodomain Of Human Cecr2 | 7e-04 | ||
| 3tlp_A | 150 | Crystal Structure Of The Fourth Bromodomain Of Huma | 8e-04 |
| >pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 | Back alignment and structure |
|
| >pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 | Back alignment and structure |
| >pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 | Back alignment and structure |
| >pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 | Back alignment and structure |
| >pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 | Back alignment and structure |
| >pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 | Back alignment and structure |
| >pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 | Back alignment and structure |
| >pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 | Back alignment and structure |
| >pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 | Back alignment and structure |
| >pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 | Back alignment and structure |
| >pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 | Back alignment and structure |
| >pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 | Back alignment and structure |
| >pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 | Back alignment and structure |
| >pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 | Back alignment and structure |
| >pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 | Back alignment and structure |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 | Back alignment and structure |
| >pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 | Back alignment and structure |
| >pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 | Back alignment and structure |
| >pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 | Back alignment and structure |
| >pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 | Back alignment and structure |
| >pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 | Back alignment and structure |
| >pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 | Back alignment and structure |
| >pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
| >pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 | Back alignment and structure |
| >pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 | Back alignment and structure |
| >pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 | Back alignment and structure |
| >pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 | Back alignment and structure |
| >pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 | Back alignment and structure |
| >pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 | Back alignment and structure |
| >pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 | Back alignment and structure |
| >pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 | Back alignment and structure |
| >pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 | Back alignment and structure |
| >pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 | Back alignment and structure |
| >pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 594 | |||
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 2e-34 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 5e-34 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 1e-33 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 9e-33 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 8e-31 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 1e-30 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 4e-30 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 4e-30 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 5e-29 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 1e-28 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 4e-22 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 6e-28 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 9e-22 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-28 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-28 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 1e-27 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 6e-27 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 1e-26 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 2e-26 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 3e-26 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 4e-26 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 8e-26 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 3e-25 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 5e-25 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 8e-25 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 8e-25 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-24 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 2e-24 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 3e-24 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 8e-23 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 1e-18 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-22 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 2e-22 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 4e-22 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 4e-22 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 2e-16 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-21 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 1e-21 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 4e-21 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 4e-16 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 6e-11 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 8e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 |
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
Score = 125 bits (317), Expect = 2e-34
Identities = 29/85 (34%), Positives = 44/85 (51%)
Query: 49 DPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFLICSNAMQYNAPDTIYFRQ 108
E+PDY + I+ PMDF T++ L Y + FE+D LI SN ++YNA DTI++R
Sbjct: 33 PLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRA 92
Query: 109 ARSIHELAKKNFENLRQDSDDNEPE 133
A + E R+ ++
Sbjct: 93 AVRLREQGGAVLRQARRQAEKMGSG 117
|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.93 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.93 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.93 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.93 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.93 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.92 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.92 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.92 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.92 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.92 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.92 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.92 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.92 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.92 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.92 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.92 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.91 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.91 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.91 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.91 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.91 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.9 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.9 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.9 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.9 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.89 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.89 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.88 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.86 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.86 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.85 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.85 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.84 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.83 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.83 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.82 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.81 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.75 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.74 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.64 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.38 |
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
Probab=99.93 E-value=3.9e-26 Score=203.77 Aligned_cols=102 Identities=25% Similarity=0.399 Sum_probs=98.3
Q ss_pred cccchHHHHHHHHhCCCCCCCcCCCCCCCCCCcccccCCccCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHhhhhcCCCC
Q 007651 24 SWNWDPQRLYQIKSYCCSSSIDFKMDPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFLICSNAMQYNAPDT 103 (594)
Q Consensus 24 s~~wc~qIL~kLk~~~~A~~F~ePVD~~e~PDY~dIIK~PMDLsTIkkKL~~g~Y~SieEF~~DVrLIf~NA~~YN~pdS 103 (594)
.+.+|..||..|.+++.+++|.+|||++.+||||++|++||||+||++||+++.|.++++|..||+|||.||+.||++++
T Consensus 14 ~~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~~~s 93 (117)
T 3g0l_A 14 DLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDS 93 (117)
T ss_dssp HHHHHHHHHHHHHTSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCSSS
T ss_pred HHHHHHHHHHHHHhCCCchhhcCcCChhhcCChHHHcCCCCCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Confidence 45678999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHhhhc
Q 007651 104 IYFRQARSIHELAKKNFENLRQ 125 (594)
Q Consensus 104 ~i~k~Ak~Le~lfek~~~~L~~ 125 (594)
.++++|..|++.|++.|+++-.
T Consensus 94 ~~~~~A~~L~~~f~~~~~~~~~ 115 (117)
T 3g0l_A 94 DIGRAGHNMRKYFEKKWTDTFK 115 (117)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHHHHHHc
Confidence 9999999999999999998754
|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 594 | ||||
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 1e-22 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 1e-22 | |
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 2e-21 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 2e-21 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 2e-20 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 4e-20 |
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: TAFII250 double bromodomain module species: Human (Homo sapiens) [TaxId: 9606]
Score = 91.6 bits (227), Expect = 1e-22
Identities = 28/118 (23%), Positives = 55/118 (46%)
Query: 21 KGLSWNWDPQRLYQIKSYCCSSSIDFKMDPEELPDYCEVIEHPMDFGTVRNKLANGAYAT 80
S+ D ++ + S ++ + +PDY +VI +PMD T+R ++ Y +
Sbjct: 8 VAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQS 67
Query: 81 LEQFEKDVFLICSNAMQYNAPDTIYFRQARSIHELAKKNFENLRQDSDDNEPETKVVR 138
E F DV LI +N+++YN P++ Y + A+ I + + + E + +
Sbjct: 68 RESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAK 125
|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 594 | |||
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.93 | |
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.91 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.91 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.9 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.9 |
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.93 E-value=4.5e-26 Score=200.12 Aligned_cols=101 Identities=24% Similarity=0.421 Sum_probs=97.4
Q ss_pred cchHHHHHHHHhCCCCCCCcCCCCCCCCCCcccccCCccCHHHHHHHHhCCCCCCHHHHHHHHHHHHHHhhhhcCCCCHH
Q 007651 26 NWDPQRLYQIKSYCCSSSIDFKMDPEELPDYCEVIEHPMDFGTVRNKLANGAYATLEQFEKDVFLICSNAMQYNAPDTIY 105 (594)
Q Consensus 26 ~wc~qIL~kLk~~~~A~~F~ePVD~~e~PDY~dIIK~PMDLsTIkkKL~~g~Y~SieEF~~DVrLIf~NA~~YN~pdS~i 105 (594)
++|..||.+|++++.+++|.+|||++.+|+|+++|++||||+||++||+++.|.++++|..||+|||.||+.||++++.+
T Consensus 6 ~~l~~il~~l~~~~~a~pF~~pvd~~~~pdY~~vI~~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~~s~i 85 (111)
T d1e6ia_ 6 AAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSY 85 (111)
T ss_dssp HHHHHHHHHHHHSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHSCTTSHH
T ss_pred HHHHHHHHHHHhCCCChhhcCCCCchhCcCHHHHcCCchhHHHHHHHHHccccchHHHHHHHHHHHHHHHHHHCCCCCHH
Confidence 56789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhhhcC
Q 007651 106 FRQARSIHELAKKNFENLRQD 126 (594)
Q Consensus 106 ~k~Ak~Le~lfek~~~~L~~d 126 (594)
+++|..|++.|++.++++++-
T Consensus 86 ~~~A~~l~~~f~~~~~~ipe~ 106 (111)
T d1e6ia_ 86 YKYANRLEKFFNNKVKEIPEY 106 (111)
T ss_dssp HHHHHHHHHHHHHHHHTSGGG
T ss_pred HHHHHHHHHHHHHHHHHhhcc
Confidence 999999999999999988653
|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|