Citrus Sinensis ID: 007656

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----

MCSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEATQIAFRSCFQPMGVLSGGRKI

cccEEEEccHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccccccEEcHHHHHHHHHHHHHccccEEEEcccccccccccccHHcccccccccccccccccccccccccHHHHHcccccccccHHHHcccccccEEEccccccccccccccccccccccHHHcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccccEEccccccccccccccccccccccHHHHHHccccccccEEEEcccHHHHHHHHHcHHHHHcccEEEEEEcccccccccccHHccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccEEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHccccccccccccccccccccEEEEEccccccc

cccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHEHHHEccccccccccccccccccEccHHHHHHHHHHHHHHccccEEcccccccccHHEEHHHHHcHHHHccccccEEEEcccccccEEEEEccccccccccHHHHHHcccEEEEEccccccHHHHccHHHHHHHEEEEEEccccccHHHccHHHHHHHHHHEEEccccccHccccHHHHHHHHccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHcHcEEEEccHHHHHHHHccHHHHHHHHHEEHcccccccccccccHHHcHHHHHEEEcccccccEEEEEccccccccccccccccccEEEEEcccccccccHHHHHcccccEEEEccHHHHHHHHccccccccccccccccccHHcEEEEEcccHHHHHHcccccccccccEEEEcccccHcccccccccccccEEEEEccHHHHHHcccccHHHHHHccccccEEEEccccccc

mcsffqitcdgalFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLcvggycskncrssyKFGKQVARKLRDVETLIAEGVFEAVatevvperapepvadkrpieptiVGLQSQLEQVWRCLVEESVGIIglygmggvgkTTLLTHINnkflesptnfdcviwvptcphlhtlflasnnslqRITDGFFQLMPslkvlkmsncwnftLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGwfnfleapedsvlfgGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYlhltgdtasIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKrrepfvfrslhcvrieqchklkdvtflifapnlksldlsyCSSMEEVIsvgkfaetpemmghispfenlqslhlsqlpalksiywkplpfthlkeISVGYCrnlkklpldsnsakeRKFVIRGEEDWWNRLQWEDEATQIAFRSCfqpmgvlsggrki

MCSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGnliakkndvmrrVVDAErqqmrrldgvqvwVSRVDAFKTGAdelitdgseeiGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVfeavatevvperapepvadkrpiePTIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNlkklpldsnsakerkFVIRGEEDWWNRLQWEDEATQIAFrscfqpmgvlsggrki

MCSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESvgiiglygmggvgKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEElkllvnlkclnlRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQellglkylevleltlGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEATQIAFRSCFQPMGVLSGGRKI

**SFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVP************IEPTIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLP***********LLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEATQIAFRSCFQPMGV*******

*CSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVA********************TIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGK************PFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPL***********IRGEEDWWNRLQWEDEATQIAFRSCFQPMGVLSG****

*CSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKF*******GHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEATQIAFRSCFQPMGVLSG****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MCSFFQITCDGALFNRCLDCFLGKAAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVDAERQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEATQIAFRSCFQPMGVLSGGRKI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		594	2.2.26 [Sep-21-2011]
Q8L3R3		885	Disease resistance protei	yes	no	0.351	0.236	0.439	3e-42
O82484		892	Putative disease resistan	no	no	0.360	0.239	0.409	7e-42
O64789		925	Probable disease resistan	no	no	0.350	0.224	0.423	2e-41
Q8RXS5		888	Probable disease resistan	no	no	0.404	0.270	0.367	2e-41
Q9LMP6		851	Probable disease resistan	no	no	0.452	0.316	0.368	6e-41
Q9FLB4		874	Putative disease resistan	no	no	0.351	0.239	0.4	1e-40
Q940K0		889	Probable disease resistan	no	no	0.351	0.235	0.421	3e-40
P60839		884	Probable disease resistan	no	no	0.351	0.236	0.404	5e-40
Q9C8T9		898	Putative disease resistan	no	no	0.314	0.208	0.424	1e-39
O22727		967	Probable disease resistan	no	no	0.351	0.216	0.414	7e-39

>sp\|Q8L3R3\|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2	Back alignment and function desciption

 Score =  173 bits (439), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/216 (43%), Positives = 137/216 (63%), Gaps = 7/216 (3%)

Query: 2   CSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAE- 60
           C    ++CD  + N+         +YI+NL +NL +L+  +G L AK++DV  R+   E 
Sbjct: 4   CVSVSLSCDREV-NQFSQWLCVSGSYIQNLSENLASLQKAMGVLNAKRDDVQGRINREEF 62

Query: 61  RQQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVAR 120
               RRL  VQVW++R+   +   ++L++  + EI +LC+ G+CSKN + SY +GK+V  
Sbjct: 63  TGHRRRLAQVQVWLTRIQTIENQFNDLLSTCNAEIQRLCLCGFCSKNVKMSYLYGKRVIV 122

Query: 121 KLRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESVG 180
            LR+VE L ++GVF+     +V E AP    ++ PI+ TIVG  S L++VW CL+E+ V 
Sbjct: 123 LLREVEGLSSQGVFD-----IVTEAAPIAEVEELPIQSTIVGQDSMLDKVWNCLMEDKVW 177

Query: 181 IIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWV 216
           I+GLYGMGGVGKTTLLT INNKF +    FD VIWV
Sbjct: 178 IVGLYGMGGVGKTTLLTQINNKFSKLGGGFDVVIWV 213

Disease resistance (R) protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|O82484\|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1	Back alignment and function description

>sp\|O64789\|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q9LMP6\|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2	Back alignment and function description

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|P60839\|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1	Back alignment and function description

>sp\|Q9C8T9\|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1	Back alignment and function description

>sp\|O22727\|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
24461863		889	NBS-LRR type disease resistance protein	0.612	0.409	0.770	1e-149
24461866		890	NBS-LRR type disease resistance protein	0.661	0.441	0.533	1e-103
24461865		892	NBS-LRR type disease resistance protein	0.604	0.402	0.562	1e-100
24461864		899	NBS-LRR type disease resistance protein	0.606	0.400	0.522	2e-91
24461861		890	NBS-LRR type disease resistance protein	0.348	0.232	0.764	7e-90
359482672		905	PREDICTED: probable disease resistance p	0.609	0.4	0.45	5e-67
225442867		893	PREDICTED: probable disease resistance p	0.590	0.393	0.440	7e-67
359482674		991	PREDICTED: probable disease resistance p	0.575	0.345	0.447	5e-66
147852651		882	hypothetical protein VITISV_017542 [Viti	0.567	0.382	0.428	5e-65
225443158		903	PREDICTED: probable disease resistance p	0.648	0.426	0.424	5e-64

>gi\|24461863\|gb\|AAN62350.1\|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

 Score =  536 bits (1381), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 285/370 (77%), Positives = 303/370 (81%), Gaps = 6/370 (1%)

Query: 216 VPTCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNF-TLKLPLAMSELGSSLE 274
           VPTCP LHTLFLASNN+LQRITDGFF+ MPSLKVLKMS+C +   LKLPL MS LGS LE
Sbjct: 523 VPTCPDLHTLFLASNNNLQRITDGFFKFMPSLKVLKMSHCGDLKVLKLPLGMSMLGS-LE 581

Query: 275 LLDISYASITELPEELKLLVNLKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNF 334
           LLDIS  SI ELPEELKLLVNLKCLNLRW   L+KIPRQLIS  S L VLRM  TG  + 
Sbjct: 582 LLDISQTSIGELPEELKLLVNLKCLNLRWATWLSKIPRQLISNSSRLHVLRMFATG-CSH 640

Query: 335 LEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLT 394
            EA EDSVLFGGGEVLIQELLGLKYLEVLELTL S HALQ+  SSNKLKSCIRSL L   
Sbjct: 641 SEASEDSVLFGGGEVLIQELLGLKYLEVLELTLRSSHALQLFFSSNKLKSCIRSLLLDEV 700

Query: 395 GDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPFVFRSLHCVRIEQC 454
             T SIIDAT FADLN LN+L ID   E+EELKIDYTEIVRKRREPFVF SLH V + QC
Sbjct: 701 RGTKSIIDATAFADLNHLNELRIDSVAEVEELKIDYTEIVRKRREPFVFGSLHRVTLGQC 760

Query: 455 HKLKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLP 514
            KLKD+TFL+FAPNLKSL L  C +MEE+ISVGKFAE PE+MGHISPFENLQ LHL  LP
Sbjct: 761 LKLKDLTFLVFAPNLKSLQLLNCRAMEEIISVGKFAEVPEVMGHISPFENLQRLHLFDLP 820

Query: 515 ALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGEEDWWNRLQWEDEAT 574
            LKSIYWKPLPFTHLKE+ V  C  LKKLPLDSNSA   KFVIRGE + WNRLQWED+AT
Sbjct: 821 RLKSIYWKPLPFTHLKEMRVHGCNQLKKLPLDSNSA---KFVIRGEAEGWNRLQWEDDAT 877

Query: 575 QIAFRSCFQP 584
           QIAFRSCFQP
Sbjct: 878 QIAFRSCFQP 887

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|24461866\|gb\|AAN62353.1\|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461865\|gb\|AAN62352.1\|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461864\|gb\|AAN62351.1\|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|24461861\|gb\|AAN62348.1\|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata]	Back alignment and taxonomy information

>gi\|359482672\|ref\|XP_003632805.1\| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225442867\|ref\|XP_002281592.1\| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482674\|ref\|XP_002281708.2\| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147852651\|emb\|CAN80649.1\| hypothetical protein VITISV_017542 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225443158\|ref\|XP_002263674.1\| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.351	0.236	0.362	7.1e-68
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.367	0.243	0.343	1.1e-62
TAIR\|locus:2031366		898	AT1G63350 "AT1G63350" [Arabido	0.314	0.208	0.367	1.2e-61
TAIR\|locus:2153474		874	AT5G05400 [Arabidopsis thalian	0.351	0.239	0.353	1.4e-59
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.457	0.307	0.336	4.7e-59
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.351	0.232	0.370	1.1e-56
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.345	0.230	0.377	3.9e-56
TAIR\|locus:2166320		888	AT5G63020 [Arabidopsis thalian	0.452	0.302	0.308	6.6e-55
TAIR\|locus:2203881		893	AT1G62630 [Arabidopsis thalian	0.314	0.209	0.383	4.4e-54
TAIR\|locus:2132741		892	AT4G10780 [Arabidopsis thalian	0.461	0.307	0.322	4.5e-54

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 351 (128.6 bits), Expect = 7.1e-68, Sum P(3) = 7.1e-68
 Identities = 78/215 (36%), Positives = 126/215 (58%)

Query:     2 CSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAER 61
             C   Q++CD  L N    CF  K  YI+N+++NL +LE  + +L A ++D++R+V  AE 
Sbjct:     4 CVSVQVSCD-QLLNHLGRCFCRKLYYIQNIKENLTSLEEAMEDLKALRDDLLRKVQTAEE 62

Query:    62 QQMRRLDGVQVWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARK 121
               ++RL  ++VW+ RV   ++  ++L +  + E+ +LC  G  S+N R SY +G++V   
Sbjct:    63 GGLQRLHQIKVWLKRVKTIESQFNDLDSSRTVELQRLCCCGVGSRNLRLSYDYGRRVFLM 122

Query:   122 LRDVETLIAEGVFEAVATEVVPERAPEPVADKRPIEPTIVGLQSQLEQVWRCLVEESXXX 181
             L  VE L ++G+FE VA    P  A   V ++RP++PTIVG ++ LE+ W  L+++    
Sbjct:   123 LNIVEDLKSKGIFEEVAH---P--ATRAVGEERPLQPTIVGQETILEKAWDHLMDDGTKI 177

Query:   182 XXXXXXXXXXKTTLLTHINNKFLESPTNFDCVIWV 216
                       KTTLLT INN+F ++    + VIWV
Sbjct:   178 MGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWV 212

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0006499 "N-terminal protein myristoylation" evidence=RCA

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00034579001	SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (884 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		594
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	9e-10
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score = 59.6 bits (145), Expect = 9e-10
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 164 QSQLEQVWRCLVEES--VGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWV 216
           +  +E +   L+E S  +G++G+ GMGGVGKTTL   I N       +FD V WV
Sbjct: 2   EDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-SVGGHFDSVAWV 55

Length = 285

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		594
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.97
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.88
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.87
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.87
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.75
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.75
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.73
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.65
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.62
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.61
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.55
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.52
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.49
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.44
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.44
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.4
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.31
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.28
KOG4341		483	consensus F-box protein containing LRR [General fu	99.24
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.22
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.15
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.04
KOG4341		483	consensus F-box protein containing LRR [General fu	99.01
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.88
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.88
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.85
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.8
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.78
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.76
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.72
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.69
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.68
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.59
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.59
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.58
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.54
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.53
PLN03150		623	hypothetical protein; Provisional	98.46
PLN03150		623	hypothetical protein; Provisional	98.38
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.37
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.34
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.32
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.29
PRK15386		426	type III secretion protein GogB; Provisional	98.25
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.24
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.21
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.07
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.06
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.99
PRK15386		426	type III secretion protein GogB; Provisional	97.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.89
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.87
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.83
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.8
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.61
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.58
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.4
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.23
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.16
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.07
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.99
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.91
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.77
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.56
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.21
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.19
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	95.73
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	95.7
PTZ00202		550	tuzin; Provisional	95.68
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.57
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.5
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	95.39
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.22
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.79
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	94.54
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	94.49
PRK09376		416	rho transcription termination factor Rho; Provisio	94.45
cd01128		249	rho_factor Transcription termination factor rho is	94.28
PRK08118		167	topology modulation protein; Reviewed	94.28
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.14
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	93.86
PF12061		402	DUF3542: Protein of unknown function (DUF3542); In	93.77
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	93.75
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.24
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	93.16
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.11
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	92.99
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	92.86
PRK00411		394	cdc6 cell division control protein 6; Reviewed	92.83
PRK06696		223	uridine kinase; Validated	92.76
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	92.59
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	92.42
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.23
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	91.92
PRK13342		413	recombination factor protein RarA; Reviewed	91.72
PRK07261		171	topology modulation protein; Provisional	91.72
smart00370		26	LRR Leucine-rich repeats, outliers.	91.5
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	91.5
PRK06547		172	hypothetical protein; Provisional	90.62
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	90.12
PRK07667		193	uridine kinase; Provisional	90.07
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	89.96
PRK12402		337	replication factor C small subunit 2; Reviewed	89.81
PRK00440		319	rfc replication factor C small subunit; Reviewed	89.67
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	89.65
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	89.52
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.24
smart00370		26	LRR Leucine-rich repeats, outliers.	89.24
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	89.1
PHA00729		226	NTP-binding motif containing protein	88.62
PRK05480		209	uridine/cytidine kinase; Provisional	88.37
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	88.32
CHL00095		821	clpC Clp protease ATP binding subunit	88.31
PLN03025		319	replication factor C subunit; Provisional	88.26
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	88.23
COG3074		79	Uncharacterized protein conserved in bacteria [Fun	88.1
PRK13341		725	recombination factor protein RarA/unknown domain f	88.05
PHA02544		316	44 clamp loader, small subunit; Provisional	87.89
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	87.77
COG2256		436	MGS1 ATPase related to the helicase subunit of the	87.71
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	87.65
TIGR00767		415	rho transcription termination factor Rho. Members	87.6
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	87.46
PRK15455		644	PrkA family serine protein kinase; Provisional	87.45
TIGR00235		207	udk uridine kinase. Model contains a number of lon	87.41
PRK08233		182	hypothetical protein; Provisional	87.21
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	87.14
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	86.56
PRK04195		482	replication factor C large subunit; Provisional	86.49
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	86.47
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	86.45
PTZ00301		210	uridine kinase; Provisional	86.42
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	86.41
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	86.37
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	86.34
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	86.09
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	85.74
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	85.53
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	85.52
KOG2028		554	consensus ATPase related to the helicase subunit o	85.45
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	85.41
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	85.34
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	85.31
PRK06762		166	hypothetical protein; Provisional	85.29
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	85.28
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	84.83
PRK13236		296	nitrogenase reductase; Reviewed	84.64
PRK03992		389	proteasome-activating nucleotidase; Provisional	84.55
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	84.48
PRK10865		857	protein disaggregation chaperone; Provisional	84.42
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	84.38
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	84.25
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	83.98
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	83.83
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	83.77
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	83.75
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	83.71
PF05729		166	NACHT: NACHT domain	83.67
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	83.56
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	83.56
PRK05541		176	adenylylsulfate kinase; Provisional	83.48
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	83.38
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	83.36
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	83.22
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	83.18
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	83.16
PRK05564		313	DNA polymerase III subunit delta'; Validated	83.03
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	82.98
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	82.88
PRK04040		188	adenylate kinase; Provisional	82.88
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	82.68
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	82.56
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	82.5
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	82.26
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	82.19
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	81.89
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	81.86
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	81.85
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	81.81
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	81.71
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	81.57
PRK06851		367	hypothetical protein; Provisional	81.48
PF13173		128	AAA_14: AAA domain	81.32
PRK06835		329	DNA replication protein DnaC; Validated	81.23
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	80.89
PRK03839		180	putative kinase; Provisional	80.85
COG3899		849	Predicted ATPase [General function prediction only	80.84
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	80.8
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	80.59
PTZ00112		1164	origin recognition complex 1 protein; Provisional	80.29
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	80.23
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	80.2
PRK10865		857	protein disaggregation chaperone; Provisional	80.19
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	80.17
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	80.02

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=5.7e-42  Score=374.66  Aligned_cols=535  Identities=36%  Similarity=0.546  Sum_probs=415.3

Q ss_pred             CCcccccccchhhhhhHHHHhhhhhhHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhchhhHHHHHHHHHHH
Q 007656            1 MCSFFQITCDGALFNRCLDCFLGKAAYIRNLQDNLDALETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQVWVSRVDAF   80 (594)
Q Consensus         1 m~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~ae~~~~~~~~~v~~Wl~~~~~~   80 (594)
                      |+++++..     ++++.+.+.+++..+.+.+.++..|++++..|+.++.|       |+.++.. ...+..|.+.++++
T Consensus         1 ~~~~~s~~-----~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d-------~~a~~~~-~~~~~~~~e~~~~~   67 (889)
T KOG4658|consen    1 MGACVSFG-----VEKLDQLLNRESECLDGKDNYILELKENLKALQSALED-------LDAKRDD-LERRVNWEEDVGDL   67 (889)
T ss_pred             CCeEEEEe-----hhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHH-------HHhhcch-HHHHHHHHHHHHHH
Confidence            44555444     46678889999999999999999999999999999987       6666663 47788999999999


Q ss_pred             HHHHHHHHhhhhhhcccc----------------cccCcccccchhhhHHHHHHHHHHHHHHHHHHcCccceeccccccC
Q 007656           81 KTGADELITDGSEEIGKL----------------CVGGYCSKNCRSSYKFGKQVARKLRDVETLIAEGVFEAVATEVVPE  144 (594)
Q Consensus        81 ~y~aed~ld~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (594)
                      +|++||.++.|.......                |..++|...+...+++++++..+.+.++.+..++.+...+..    
T Consensus        68 ~~~~e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~----  143 (889)
T KOG4658|consen   68 VYLAEDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGES----  143 (889)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccc----
Confidence            999999999987654432                334666677778888889999999999998888777666521    


Q ss_pred             CCCCCccccCCCCCce-echhHHHHHHHHHHhcCCceEEEEEecCCCchhHHHHHHHHhhccCCCCCceEEEee------
Q 007656          145 RAPEPVADKRPIEPTI-VGLQSQLEQVWRCLVEESVGIIGLYGMGGVGKTTLLTHINNKFLESPTNFDCVIWVP------  217 (594)
Q Consensus       145 ~~~~~~~~~~~~~~~~-vG~~~~~~~i~~~L~~~~~~~i~i~G~gG~gKttl~~~~~~~~~~~~~~f~~~~w~p------  217 (594)
                      ..+.....+.+..+.. ||.+..++++++.|.+++..++||+||||+||||||+.++|+...+..+||..+|+.      
T Consensus       144 ~~~~~~~e~~~~~~~~~VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~  223 (889)
T KOG4658|consen  144 LDPREKVETRPIQSESDVGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFT  223 (889)
T ss_pred             ccchhhcccCCCCccccccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEccccc
Confidence            1122233333333333 999999999999999998899999999999999999999999944899999999990      


Q ss_pred             --------------------------------------------------------------------------------
Q 007656          218 --------------------------------------------------------------------------------  217 (594)
Q Consensus       218 --------------------------------------------------------------------------------  217 (594)
                                                                                                      
T Consensus       224 ~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~  303 (889)
T KOG4658|consen  224 TRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCG  303 (889)
T ss_pred             HHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhh
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 007656          218 --------------------------------------------------------------------------------  217 (594)
Q Consensus       218 --------------------------------------------------------------------------------  217 (594)
                                                                                                      
T Consensus       304 ~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~  383 (889)
T KOG4658|consen  304 RAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLK  383 (889)
T ss_pred             ccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccc
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 007656          218 --------------------------------------------------------------------------------  217 (594)
Q Consensus       218 --------------------------------------------------------------------------------  217 (594)
                                                                                                      
T Consensus       384 s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  384 SSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             ccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence                                                                                            


Q ss_pred             -------------------------------------------------------------------------------C
Q 007656          218 -------------------------------------------------------------------------------T  218 (594)
Q Consensus       218 -------------------------------------------------------------------------------~  218 (594)
                                                                                                     .
T Consensus       464 V~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~  543 (889)
T KOG4658|consen  464 VRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSE  543 (889)
T ss_pred             HHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCC
Confidence                                                                                           7


Q ss_pred             CCCccccccccccc-ccccCchhhcCCCcccEEEccCCcCcccccCchHHhhhhcCcEEEccCCcccccchhhhccCcCc
Q 007656          219 CPHLHTLFLASNNS-LQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLK  297 (594)
Q Consensus       219 ~~~L~~L~L~~~~~-l~~l~~~~~~~l~~L~~L~L~~~~~l~~~lp~~i~~l~~~L~~L~ls~~~l~~lp~~i~~L~~L~  297 (594)
                      ++.|++|-+..+.. +..++..+|..++.|++|||++|..+ +++|.+|+.|. +||||+++++.+..+|.++++|.+|.
T Consensus       544 ~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l-~~LP~~I~~Li-~LryL~L~~t~I~~LP~~l~~Lk~L~  621 (889)
T KOG4658|consen  544 NPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSL-SKLPSSIGELV-HLRYLDLSDTGISHLPSGLGNLKKLI  621 (889)
T ss_pred             CCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCcc-CcCChHHhhhh-hhhcccccCCCccccchHHHHHHhhh
Confidence            78899999955553 78899999999999999999999888 99999999999 99999999999999999999999999


Q ss_pred             EEecCCCCCCCCcchhhhcCCCCCcEEEecCCCCCccccCCCCccccCCcccchHHhcCCCCCcEEEEEEcchhhHHHHh
Q 007656          298 CLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQILL  377 (594)
Q Consensus       298 ~L~L~~~~~l~~lp~~~~~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~L~l~~~~~~~~~~~~  377 (594)
                      +|++..+..+..+|. +...|++|++|.+.......             +.....++.+|.+|+.+.++......+..+.
T Consensus       622 ~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~~-------------~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~  687 (889)
T KOG4658|consen  622 YLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALSN-------------DKLLLKELENLEHLENLSITISSVLLLEDLL  687 (889)
T ss_pred             eeccccccccccccc-hhhhcccccEEEeecccccc-------------chhhHHhhhcccchhhheeecchhHhHhhhh
Confidence            999999977777755 47779999999998765222             4457788899999998888766554445555


Q ss_pred             cCchhhhcceeEEEEeCCCcccccccccccCccCCceEEecccCCceeeeecccccccccCCCc-cCCCcceEeEecCCC
Q 007656          378 SSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREPF-VFRSLHCVRIEQCHK  456 (594)
Q Consensus       378 ~~~~~~~~L~~L~L~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~l~~~~~~~~~~~~~~~-~~~~L~~L~L~~c~~  456 (594)
                      ......+..+.+.+.+.....   ....+..+.+|+.|.+.+|...+. ...+....    ... .++++..+.+.+|..
T Consensus       688 ~~~~L~~~~~~l~~~~~~~~~---~~~~~~~l~~L~~L~i~~~~~~e~-~~~~~~~~----~~~~~f~~l~~~~~~~~~~  759 (889)
T KOG4658|consen  688 GMTRLRSLLQSLSIEGCSKRT---LISSLGSLGNLEELSILDCGISEI-VIEWEESL----IVLLCFPNLSKVSILNCHM  759 (889)
T ss_pred             hhHHHHHHhHhhhhcccccce---eecccccccCcceEEEEcCCCchh-hccccccc----chhhhHHHHHHHHhhcccc
Confidence            555444555556552222222   345788899999999999988652 22332210    001 277899999999999


Q ss_pred             CccccccccCCCCceEeEccCccchhhhccCccCCCCcccCCCcccccccee-cccccccccccCCCCccCCCccEEeec
Q 007656          457 LKDVTFLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSL-HLSQLPALKSIYWKPLPFTHLKEISVG  535 (594)
Q Consensus       457 l~~l~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~L~~L-~L~~~~~L~~l~~~~~~l~~L~~L~i~  535 (594)
                      ...+.|....|+|+.|.+..|..++++++..+....  .......|+++..+ .+.+.+.++++.+....+++|+.+.+.
T Consensus       760 ~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~--l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve  837 (889)
T KOG4658|consen  760 LRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLE--LKELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVE  837 (889)
T ss_pred             ccccchhhccCcccEEEEecccccccCCCHHHHhhh--cccEEecccccccceeeecCCCCceeEecccCccchhheehh
Confidence            999999999999999999999998888653322211  00124567777777 588888888888888888999999999


Q ss_pred             ccCCCCCCCCCCcC--CcC-cceEEEccHhhhhhcccCchhhhccc
Q 007656          536 YCRNLKKLPLDSNS--AKE-RKFVIRGEEDWWNRLQWEDEATQIAF  578 (594)
Q Consensus       536 ~C~~L~~lp~~~~~--~~L-~~l~I~~~~~~~~~l~w~~~~~~~~~  578 (594)
                      .||+++.+|.....  ... ..+...-+.+|.+.++|.+++.+..+
T Consensus       838 ~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  838 ECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             cCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            99999999987655  332 22333344556778889888777665

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG3074 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13236 nitrogenase reductase; Reviewed	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		594
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-20
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-16
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-14
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-14
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-10
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-11
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	8e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-11
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-11
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-05
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	8e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	3e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	8e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-05
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	7e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	7e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-06
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-05
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-05
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	4e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	8e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	8e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	9e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 96.1 bits (238), Expect = 1e-20
 Identities = 100/636 (15%), Positives = 190/636 (29%), Gaps = 213/636 (33%)

Query: 14  FNRCLDCFLGKAAYIRNLQDNLDAL--ETELGNLIAKKNDVMRRVVDAERQQMRRLDGVQ 71
           F    DC        +++QD   ++  + E+ ++I  K+ V             RL    
Sbjct: 29  FVDNFDC--------KDVQDMPKSILSKEEIDHIIMSKDAV---------SGTLRL---- 67

Query: 72  VWVSRVDAFKTGADELITDGSEEIGKLCVGGYCSKNCRSSYKFGKQVARKLRDVETLIAE 131
            W              +    EE+ +  V      N    YKF   +   ++  E     
Sbjct: 68  FW-------------TLLSKQEEMVQKFVEEVLRIN----YKF---LMSPIKT-EQRQPS 106

Query: 132 GVFEAVATEVVPERAPEPVADKRPI--EPTIVGLQSQLEQVWRCLVEESVGIIGLYGMGG 189
            +      +         V  K  +      + L+  L ++           + + G+ G
Sbjct: 107 MMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL------RPAKNVLIDGVLG 160

Query: 190 VGKTTL-LTHINNKFLESPTNFDCVIWV----PTCPH-----LHTLFLASNNSLQRITDG 239
            GKT + L    +  ++   +F  + W+       P      L  L    + +    +D 
Sbjct: 161 SGKTWVALDVCLSYKVQCKMDFK-IFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDH 219

Query: 240 -----------------FFQLMP---SLKVLKMSNCWN------FTLK------------ 261
                              +  P    L VL   N  N      F L             
Sbjct: 220 SSNIKLRIHSIQAELRRLLKSKPYENCLLVL--LNVQNAKAWNAFNLSCKILLTTRFKQV 277

Query: 262 -----------LPLAMSELG----SSLELLDISYA--SITELPEELK----LLVNL---- 296
                      + L    +         LL + Y      +LP E+       +++    
Sbjct: 278 TDFLSAATTTHISLDHHSMTLTPDEVKSLL-LKYLDCRPQDLPREVLTTNPRRLSIIAES 336

Query: 297 -KCLNLRW-------TDTLNKI---------P---RQLISILSWLR--------VLRMLG 328
            +     W        D L  I         P   R++   LS           +L ++ 
Sbjct: 337 IRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLI- 395

Query: 329 TGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLE--VLELTLGSYHALQILLSSNKLKSCI 386
             WF+ ++   D        V++ +L     +E    E T+ S  ++ + L         
Sbjct: 396 --WFDVIK--SDV------MVVVNKLHKYSLVEKQPKESTI-SIPSIYLEL----KVKLE 440

Query: 387 RSLYLHLTGDTASIIDATVFA---DLNQLNQLWIDE------GIELEELKIDYTEIVRKR 437
               LH      SI+D        D + L   ++D+      G  L+   I++ E +   
Sbjct: 441 NEYALH-----RSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLK--NIEHPERMTLF 493

Query: 438 REPFV-FRSLHCVRIEQCHKLKDVTFLIFAPN--LKSL-DLSY--------CSSMEEVI- 484
           R  F+ FR      +EQ  K++  +    A    L +L  L +            E ++ 
Sbjct: 494 RMVFLDFRF-----LEQ--KIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVN 546

Query: 485 SVGKFAETPEMMGHISPFENLQSLHLSQLPALKSIY 520
           ++  F    E     S + +L  L ++ +   ++I+
Sbjct: 547 AILDFLPKIEENLICSKYTDL--LRIALMAEDEAIF 580

PyMOL of 1vt4

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		594
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.93
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.93
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.92
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.92
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.92
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.91
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.91
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.9
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.89
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.89
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.89
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.89
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.89
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.89
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.89
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.88
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.88
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.88
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.88
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.87
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.87
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.87
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.87
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.87
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.87
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.85
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.85
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.85
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.85
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.85
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.84
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.84
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.84
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.83
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.83
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.83
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.82
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.81
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.81
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.81
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.8
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.8
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.79
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.79
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.79
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.78
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.77
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.77
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.75
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.74
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.74
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.72
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.72
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.72
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.72
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.72
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.71
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.71
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.71
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.71
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.71
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.7
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.69
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.69
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.68
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.66
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.65
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.65
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.64
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.63
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	99.62
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.61
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.6
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.59
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.58
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.57
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.57
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.56
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.55
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.52
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.52
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.51
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.49
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.49
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.48
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.47
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.46
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.46
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.45
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.45
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.44
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.43
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.43
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.42
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.41
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.4
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.38
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.37
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.36
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.32
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.29
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.28
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.26
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.25
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.24
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.24
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.23
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.22
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.22
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.22
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.21
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.21
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.21
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.17
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.17
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.12
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.08
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.06
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.89
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.68
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.67
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.61
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.58
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	98.56
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.43
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.4
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.35
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.33
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.33
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.3
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.13
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.09
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.07
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.01
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.98
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	97.96
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.95
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.82
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	97.78
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	97.63
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.46
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.01
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	95.88
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	95.65
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.53
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	95.52
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	95.49
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	95.06
2fna_A		357	Conserved hypothetical protein; structural genomic	94.98
2chg_A		226	Replication factor C small subunit; DNA-binding pr	94.88
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	94.51
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	94.18
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.14
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	93.69
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	93.64
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	93.51
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	93.43
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	91.92
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	91.78
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	91.24
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	90.59
2chq_A		319	Replication factor C small subunit; DNA-binding pr	90.52
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	90.12
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	89.89
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	89.79
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	89.58
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	89.53
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	89.44
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	89.42
3pvs_A		447	Replication-associated recombination protein A; ma	89.4
2ga8_A		359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	89.39
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	89.14
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	88.97
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	88.95
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	88.85
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	88.71
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	88.71
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	88.27
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	87.82
2hf9_A		226	Probable hydrogenase nickel incorporation protein	87.76
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	87.74
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	87.42
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	87.32
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	87.25
3bos_A		242	Putative DNA replication factor; P-loop containing	87.19
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	86.94
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	86.61
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	86.54
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	86.25
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	85.8
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	85.47
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	85.32
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	85.31
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	84.88
3fwy_A		314	Light-independent protochlorophyllide reductase I	84.84
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	84.58
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	84.44
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	83.69
3co5_A		143	Putative two-component system transcriptional RES	83.55
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	83.49
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	83.28
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	83.25
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	83.19
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	83.04
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	82.91
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	82.87
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	82.28
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	82.27
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	82.18
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	82.02
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	81.89
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	81.81
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	81.78
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	81.48
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	81.38
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	81.01
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	80.52
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	80.37
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	80.34
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	80.34
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	80.33

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

Probab=99.93  E-value=1.5e-25  Score=231.07  Aligned_cols=288  Identities=14%  Similarity=0.159  Sum_probs=201.4

Q ss_pred             CCCCcccccccccccccccCchhhcCCCcccEEEccCCcCcccccC-chHHhhhhcCcEEEccCCcccccch-hhhccCc
Q 007656          218 TCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLP-LAMSELGSSLELLDISYASITELPE-ELKLLVN  295 (594)
Q Consensus       218 ~~~~L~~L~L~~~~~l~~l~~~~~~~l~~L~~L~L~~~~~l~~~lp-~~i~~l~~~L~~L~ls~~~l~~lp~-~i~~L~~  295 (594)
                      .+++++.|++ .++.++.+|..+|..+++|++|++++| .+ ..+| ..+..+. +|++|++++|.++.+|. .++++++
T Consensus        43 ~l~~l~~l~l-~~~~l~~l~~~~~~~l~~L~~L~L~~n-~i-~~~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~l~~  118 (390)
T 3o6n_A           43 TLNNQKIVTF-KNSTMRKLPAALLDSFRQVELLNLNDL-QI-EEIDTYAFAYAH-TIQKLYMGFNAIRYLPPHVFQNVPL  118 (390)
T ss_dssp             GGCCCSEEEE-ESCEESEECTHHHHHCCCCSEEECTTS-CC-CEECTTTTTTCT-TCCEEECCSSCCCCCCTTTTTTCTT
T ss_pred             ccCCceEEEe-cCCchhhCChhHhcccccCcEEECCCC-cc-cccChhhccCCC-CcCEEECCCCCCCcCCHHHhcCCCC
Confidence            4578888888 777788888887888888888888888 88 6664 4788888 88888888888888765 5788888


Q ss_pred             CcEEecCCCCCCCCcchhhhcCCCCCcEEEecCCCCCccccCCCCccccCCcccchHHhcCCCCCcEEEEEEcchhhHHH
Q 007656          296 LKCLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPEDSVLFGGGEVLIQELLGLKYLEVLELTLGSYHALQI  375 (594)
Q Consensus       296 L~~L~L~~~~~l~~lp~~~~~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~L~l~~~~~~~~~~  375 (594)
                      |++|++++| .+..+|.+.+.++++|++|++++|.+...               .+..+..+++|+.|+++.+....+. 
T Consensus       119 L~~L~L~~n-~l~~l~~~~~~~l~~L~~L~L~~n~l~~~---------------~~~~~~~l~~L~~L~l~~n~l~~~~-  181 (390)
T 3o6n_A          119 LTVLVLERN-DLSSLPRGIFHNTPKLTTLSMSNNNLERI---------------EDDTFQATTSLQNLQLSSNRLTHVD-  181 (390)
T ss_dssp             CCEEECCSS-CCCCCCTTTTTTCTTCCEEECCSSCCCBC---------------CTTTTSSCTTCCEEECCSSCCSBCC-
T ss_pred             CCEEECCCC-ccCcCCHHHhcCCCCCcEEECCCCccCcc---------------ChhhccCCCCCCEEECCCCcCCccc-
Confidence            888888888 78888877668888888888888877652               2333677788888888776654331 


Q ss_pred             HhcCchhhhcceeEEEEeCCCcccccccc---------------cccCccCCceEEecccCCceeeeecccccccccCCC
Q 007656          376 LLSSNKLKSCIRSLYLHLTGDTASIIDAT---------------VFADLNQLNQLWIDEGIELEELKIDYTEIVRKRREP  440 (594)
Q Consensus       376 ~~~~~~~~~~L~~L~L~~~~~~~~~~~~~---------------~l~~~~~L~~L~l~~~~~~~~l~~~~~~~~~~~~~~  440 (594)
                          ...+++|+.|+++.+.... ++...               .....++|+.|++++|....   ..++         
T Consensus       182 ----~~~l~~L~~L~l~~n~l~~-~~~~~~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~---~~~l---------  244 (390)
T 3o6n_A          182 ----LSLIPSLFHANVSYNLLST-LAIPIAVEELDASHNSINVVRGPVNVELTILKLQHNNLTD---TAWL---------  244 (390)
T ss_dssp             ----GGGCTTCSEEECCSSCCSE-EECCSSCSEEECCSSCCCEEECCCCSSCCEEECCSSCCCC---CGGG---------
T ss_pred             ----cccccccceeecccccccc-cCCCCcceEEECCCCeeeeccccccccccEEECCCCCCcc---cHHH---------
Confidence                1223355555553333222 10000               11123466666666654433   1232         


Q ss_pred             ccCCCcceEeEecCCCCccc-c-ccccCCCCceEeEccCccchhhhccCccCCCCcccCCCccccccceecccccccccc
Q 007656          441 FVFRSLHCVRIEQCHKLKDV-T-FLIFAPNLKSLDLSYCSSMEEVISVGKFAETPEMMGHISPFENLQSLHLSQLPALKS  518 (594)
Q Consensus       441 ~~~~~L~~L~L~~c~~l~~l-~-~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~L~~  518 (594)
                      ..+++|+.|++++| .+..+ | .+..+++|++|+|++| .++.++.            ....+|+|+.|++++| .+..
T Consensus       245 ~~l~~L~~L~Ls~n-~l~~~~~~~~~~l~~L~~L~L~~n-~l~~~~~------------~~~~l~~L~~L~L~~n-~l~~  309 (390)
T 3o6n_A          245 LNYPGLVEVDLSYN-ELEKIMYHPFVKMQRLERLYISNN-RLVALNL------------YGQPIPTLKVLDLSHN-HLLH  309 (390)
T ss_dssp             GGCTTCSEEECCSS-CCCEEESGGGTTCSSCCEEECCSS-CCCEEEC------------SSSCCTTCCEEECCSS-CCCC
T ss_pred             cCCCCccEEECCCC-cCCCcChhHccccccCCEEECCCC-cCcccCc------------ccCCCCCCCEEECCCC-ccee
Confidence            36778888888885 44443 3 5777888888888887 4554432            4567899999999998 6778


Q ss_pred             cCCCCccCCCccEEeecccCCCCCCCCCCcCCcCcceEEEcc
Q 007656          519 IYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRGE  560 (594)
Q Consensus       519 l~~~~~~l~~L~~L~i~~C~~L~~lp~~~~~~~L~~l~I~~~  560 (594)
                      ++.....+++|+.|++++|+ ++.+|.. ..++|+.++++++
T Consensus       310 ~~~~~~~l~~L~~L~L~~N~-i~~~~~~-~~~~L~~L~l~~N  349 (390)
T 3o6n_A          310 VERNQPQFDRLENLYLDHNS-IVTLKLS-THHTLKNLTLSHN  349 (390)
T ss_dssp             CGGGHHHHTTCSEEECCSSC-CCCCCCC-TTCCCSEEECCSS
T ss_pred             cCccccccCcCCEEECCCCc-cceeCch-hhccCCEEEcCCC
Confidence            77766678999999999875 7888743 4478999999854

PyMOL of 3o6n

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		594
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	4e-10
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	0.002

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 58.7 bits (141), Expect = 4e-10
 Identities = 18/99 (18%), Positives = 39/99 (39%), Gaps = 6/99 (6%)

Query: 155 PIEPTIVGLQSQLEQVWRCLVE---ESVGIIGLYGMGGVGKTTLLTHI-NNKFLESPTNF 210
           P + T    +  +++V + L E        + L+G  G GK+ + +   +        N+
Sbjct: 17  PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINY 76

Query: 211 DCVIWVPTC--PHLHTLFLASNNSLQRITDGFFQLMPSL 247
           D ++W+         T  L ++  L   ++      PS+
Sbjct: 77  DSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSV 115

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		594
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.82
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.8
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.79
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.79
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.78
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.7
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.7
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.69
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.67
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.64
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.59
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.59
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.58
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.57
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.56
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.54
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.53
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.53
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.47
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.38
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.38
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.37
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.27
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.26
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.22
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.19
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.98
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	98.89
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.85
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.85
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.82
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.71
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.7
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.08
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.95
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.29
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.11
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.47
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.36
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	95.65
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	95.32
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	95.06
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	95.03
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	94.91
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	94.54
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	94.47
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	94.47
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	94.08
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	93.86
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	93.11
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	92.9
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	92.24
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	91.95
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	91.44
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	90.87
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	90.61
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	90.38
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	90.27
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	89.99
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	89.72
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	88.89
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	88.43
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	88.15
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	87.89
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	87.71
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	87.15
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	86.63
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	86.56
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	86.37
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	86.14
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	85.85
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	85.76
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	85.36
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	85.21
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	85.0
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	84.8
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	84.75
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	84.7
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	84.51
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	84.28
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	84.05
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	83.69
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	82.95
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	82.72
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	82.17
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	81.84
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	81.71
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	80.98
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	80.72
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	80.46

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=8.2e-20  Score=185.03  Aligned_cols=293  Identities=17%  Similarity=0.177  Sum_probs=177.5

Q ss_pred             CCCCcccccccccccccccCchhhcCCCcccEEEccCCcCcccccCchHHhhhhcCcEEEccCCcccccchhhhccCcCc
Q 007656          218 TCPHLHTLFLASNNSLQRITDGFFQLMPSLKVLKMSNCWNFTLKLPLAMSELGSSLELLDISYASITELPEELKLLVNLK  297 (594)
Q Consensus       218 ~~~~L~~L~L~~~~~l~~l~~~~~~~l~~L~~L~L~~~~~l~~~lp~~i~~l~~~L~~L~ls~~~l~~lp~~i~~L~~L~  297 (594)
                      .+.+|++|++ .++.++.+..  ++.+++|++|++++| .+ +.+|+ ++.+. +|++|++++|.+..++ .++++++|+
T Consensus        42 ~l~~l~~L~l-~~~~I~~l~g--l~~L~nL~~L~Ls~N-~l-~~l~~-l~~L~-~L~~L~L~~n~i~~i~-~l~~l~~L~  113 (384)
T d2omza2          42 DLDQVTTLQA-DRLGIKSIDG--VEYLNNLTQINFSNN-QL-TDITP-LKNLT-KLVDILMNNNQIADIT-PLANLTNLT  113 (384)
T ss_dssp             HHTTCCEEEC-CSSCCCCCTT--GGGCTTCCEEECCSS-CC-CCCGG-GTTCT-TCCEEECCSSCCCCCG-GGTTCTTCC
T ss_pred             HhCCCCEEEC-CCCCCCCccc--cccCCCCCEEeCcCC-cC-CCCcc-ccCCc-cccccccccccccccc-ccccccccc
Confidence            4678999999 7778888753  788999999999999 99 88875 88998 9999999999999887 488999999


Q ss_pred             EEecCCCCCCCCcchhhhcCCCCCcEEEecCCCCCccccCCCC--------------------------ccccCCcccch
Q 007656          298 CLNLRWTDTLNKIPRQLISILSWLRVLRMLGTGWFNFLEAPED--------------------------SVLFGGGEVLI  351 (594)
Q Consensus       298 ~L~L~~~~~l~~lp~~~~~~L~~L~~L~l~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~  351 (594)
                      .|+++++ .+..++.  ......+..+....+.+.........                          ...........
T Consensus       114 ~L~~~~~-~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (384)
T d2omza2         114 GLTLFNN-QITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI  190 (384)
T ss_dssp             EEECCSS-CCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCC
T ss_pred             ccccccc-ccccccc--ccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccc
Confidence            9999888 5666665  44455555555544332211000000                          00111122233


Q ss_pred             HHhcCCCCCcEEEEEEcchhhHHHHhcCchhhhcceeEEEEeCCCcccccccccccCccCCceEEecccCCceeeeeccc
Q 007656          352 QELLGLKYLEVLELTLGSYHALQILLSSNKLKSCIRSLYLHLTGDTASIIDATVFADLNQLNQLWIDEGIELEELKIDYT  431 (594)
Q Consensus       352 ~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~l~~~~~  431 (594)
                      .....+++++.+.++.+....+...    ....+|+.|+++.+.+.. +   ..+..+++|+.|++++|.... + +.. 
T Consensus       191 ~~~~~l~~~~~l~l~~n~i~~~~~~----~~~~~L~~L~l~~n~l~~-~---~~l~~l~~L~~L~l~~n~l~~-~-~~~-  259 (384)
T d2omza2         191 SVLAKLTNLESLIATNNQISDITPL----GILTNLDELSLNGNQLKD-I---GTLASLTNLTDLDLANNQISN-L-APL-  259 (384)
T ss_dssp             GGGGGCTTCSEEECCSSCCCCCGGG----GGCTTCCEEECCSSCCCC-C---GGGGGCTTCSEEECCSSCCCC-C-GGG-
T ss_pred             cccccccccceeeccCCccCCCCcc----cccCCCCEEECCCCCCCC-c---chhhcccccchhccccCccCC-C-Ccc-
Confidence            4566677777777776654443222    223467777774444443 2   245566777777777764332 1 111 


Q ss_pred             ccccccCCCccCCCcceEeEecCCCCccccccccCC----------------------CCceEeEccCccchhhhccCcc
Q 007656          432 EIVRKRREPFVFRSLHCVRIEQCHKLKDVTFLIFAP----------------------NLKSLDLSYCSSMEEVISVGKF  489 (594)
Q Consensus       432 ~~~~~~~~~~~~~~L~~L~L~~c~~l~~l~~l~~l~----------------------~L~~L~L~~~~~l~~~~~~~~~  489 (594)
                               ..+++|+.|+++++ .+..++++..++                      +++.|++++| .++++      
T Consensus       260 ---------~~~~~L~~L~l~~~-~l~~~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n-~l~~l------  322 (384)
T d2omza2         260 ---------SGLTKLTELKLGAN-QISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFN-NISDI------  322 (384)
T ss_dssp             ---------TTCTTCSEEECCSS-CCCCCGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSS-CCSCC------
T ss_pred             ---------cccccCCEeeccCc-ccCCCCccccccccccccccccccccccccchhcccCeEECCCC-CCCCC------
Confidence                     24556666666553 344444444444                      4444444444 23222      


Q ss_pred             CCCCcccCCCccccccceecccccccccccCCCCccCCCccEEeecccCCCCCCCCCCcCCcCcceEEEc
Q 007656          490 AETPEMMGHISPFENLQSLHLSQLPALKSIYWKPLPFTHLKEISVGYCRNLKKLPLDSNSAKERKFVIRG  559 (594)
Q Consensus       490 ~~~~~~~~~~~~l~~L~~L~L~~~~~L~~l~~~~~~l~~L~~L~i~~C~~L~~lp~~~~~~~L~~l~I~~  559 (594)
                             ..+..+|+|+.|++++| .++.++ ....+++|+.|++++| +++.++.-...++|+.++|++
T Consensus       323 -------~~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~l~~l~~L~~L~L~~  382 (384)
T d2omza2         323 -------SPVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLTPLANLTRITQLGLND  382 (384)
T ss_dssp             -------GGGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCGGGTTCTTCSEEECCC
T ss_pred             -------cccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCChhhccCCCCCEeeCCC
Confidence                   13556777777777776 566655 2345677777777654 566665433336677666653

PyMOL of d2omza2

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure