Citrus Sinensis ID: 007661

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS
ccccccccccccEEEEEEcccccccccccEEEEcHHHHHHcccccccEEEEEEEccEEEEEEEcccccccccEEEcHHHHHccccccccEEEEEEEcccccccEEEEEEEEHHHHcccccccccHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEEEEEEcccccccccccEEEcccccEEEEEccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEccccccccHHccccccccEEEEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHccc
cccccccccccccEEEEEEccccccccEEEEEEcHHHHHHccccccEEEEEcccccEEEEEEcccccccccEEEEccHEHHccEEEcccEEEEEEccccccccEEEEEccHHHcccccccccccHHHHHHHHHHHHccccEEEcEEEEEEccccEEEEEEccEcccEEEEcccccEEEEccccEEEEEcccccHHHHHccccccHccEEEEccccccHcccccHHHHHHHHHHHHHHcccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHcccHHHHHHHHHHHHHHccccccccccEEEEEccHHHHccccccccccccHHHHHHHHHHHHHccHHccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHccccHHHHHcccccHHHHHHHHHccccccccEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHcccccHHHHHHHHHHHHHHHHHcc
mtsrfgsqssgvttmnvintpsadlaltnlaycspadllnfrvpnsnlflASVAGDSFVLSlashpsvnkgqiALNSVQRRhakvstgdhvslnrfippedfNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFeyhgnnyiftvngaavegqeksNALERGIITNETYFVFEAsndsgikivnqregansnifrhkefnlqslgigglsaEFADIFRRAFasrvfpphvtsklgikhvkgmllygppgtgktLMARQIGKMlngmepkivngpevlsKFVGETEKNIRDLFAdaendqrtrgdqsdlHVIIFDEIDAICksrgstrdgtgvHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLdeallrpgrleVQVEislpdengrLQILQIHTNkmkensflapdvNLQELAARTknysgaeleGVAKSAVSFALNRqlsmddltkpvdeesIKVTMDDFLHALYEIVpafgastddlERSRlngmvdcgdRHKHIYQRAMLLVEQVKvskgsplvtcllegpsgsgktalaatagidsdfpfvKIISAEsmiglhestkcAQIVKVsecqfsgs
mtsrfgsqssgvtTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFAsrvfpphvtsklgikhvkgMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFadaendqrtrgdqsdlhvIIFDEIDAICKSrgstrdgtgvHDSIVNQLltkidgveSLNNVLLIGMTNRKDMLDEALLRPGRLEVQVeislpdengRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS
**************MNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLF**************DLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQL***********ESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSE******
******************NTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVK******QVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASN***********************NLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAI****************IVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNR**************SIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFS**
***********VTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNS**********GDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS
**********GVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRG****GTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query594 2.2.26 [Sep-21-2011]
Q9M0Y8 742 Vesicle-fusing ATPase OS= yes no 0.983 0.787 0.809 0.0
P46459 744 Vesicle-fusing ATPase OS= yes no 0.951 0.759 0.457 1e-143
Q5R410 744 Vesicle-fusing ATPase OS= yes no 0.951 0.759 0.457 1e-143
P46460 744 Vesicle-fusing ATPase OS= yes no 0.947 0.756 0.456 1e-143
P18708 744 Vesicle-fusing ATPase OS= yes no 0.947 0.756 0.454 1e-143
Q9QUL6 744 Vesicle-fusing ATPase OS= yes no 0.947 0.756 0.454 1e-142
Q9P7Q4 792 Vesicular-fusion protein yes no 0.951 0.713 0.455 1e-139
Q75JI3 738 Vesicle-fusing ATPase OS= yes no 0.942 0.758 0.460 1e-135
P54351 752 Vesicle-fusing ATPase 2 O yes no 0.944 0.746 0.456 1e-135
P18759 758 Vesicular-fusion protein yes no 0.934 0.732 0.447 1e-132
>sp|Q9M0Y8|NSF_ARATH Vesicle-fusing ATPase OS=Arabidopsis thaliana GN=NSF PE=2 SV=2 Back     alignment and function desciption
 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/588 (80%), Positives = 530/588 (90%), Gaps = 4/588 (0%)

Query: 1   MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
           M  R+GSQ   V TM V NTPSADLA TNLAYCS +DL  F VP S+LFLA+VA DSF+L
Sbjct: 1   MAGRYGSQ---VMTMTVTNTPSADLAFTNLAYCSSSDLRQFSVPGSDLFLANVA-DSFIL 56

Query: 61  SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
           SL  H S+  G IALN++QRRHA+VSTGD VS++RF+PPE+F+LA+LT+ELEFVKKG+K+
Sbjct: 57  SLCGHGSIRDGNIALNAIQRRHARVSTGDMVSVSRFVPPENFDLAMLTLELEFVKKGTKS 116

Query: 121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
           EQVDA LL+ QL++++ NQV+T GQ+  FEYHG NYI TVN A VEGQ+ +N +ERG+++
Sbjct: 117 EQVDAALLSTQLKRKYTNQVLTVGQKATFEYHGTNYILTVNRADVEGQDHTNGIERGLLS 176

Query: 181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
            +TY VFEASN SGIKIVNQRE A+SNIF+HKEFNL+SLGIGGL AEFADIFRRAFASRV
Sbjct: 177 KDTYIVFEASNASGIKIVNQREAASSNIFKHKEFNLESLGIGGLGAEFADIFRRAFASRV 236

Query: 241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
           FPPHVTS+LGIKHVKGMLL+GPPGTGKTLMARQIGKMLNG +PKIVNGPEVLSKFVGETE
Sbjct: 237 FPPHVTSRLGIKHVKGMLLFGPPGTGKTLMARQIGKMLNGKDPKIVNGPEVLSKFVGETE 296

Query: 301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
           KN+RDLFADAE DQRT GD S+LHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct: 297 KNVRDLFADAEQDQRTLGDASELHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 356

Query: 361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
           GVE+LNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDE GRLQILQIHTNKMKENSF
Sbjct: 357 GVEALNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDEAGRLQILQIHTNKMKENSF 416

Query: 421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
           L  D+NLQELAARTKNYSGAELEGV KSA S+ALNRQLSMDDLTKPV+EE+IK+TM+DFL
Sbjct: 417 LGTDINLQELAARTKNYSGAELEGVVKSATSYALNRQLSMDDLTKPVEEENIKITMEDFL 476

Query: 481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
           HA+YE+ PAFGASTDDLER RLNGMVDCG RH HIY+RAMLLVEQVKVS  SPLVTCLLE
Sbjct: 477 HAIYEVQPAFGASTDDLERCRLNGMVDCGHRHNHIYKRAMLLVEQVKVSTRSPLVTCLLE 536

Query: 541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSE 588
           GPSGSGKTALAAT GIDSDFP+VKI+SAE+MIGL ESTKCA IVKV E
Sbjct: 537 GPSGSGKTALAATIGIDSDFPYVKIVSAETMIGLSESTKCAHIVKVFE 584
Involved in vesicle-mediated transport. The ATPase activity of NSF serves to disassemble the SNARE complex, freeing the components for subsequent pairing and fusion events.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 6
>sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3 Back     alignment and function description
>sp|Q5R410|NSF_PONAB Vesicle-fusing ATPase OS=Pongo abelii GN=NSF PE=2 SV=1 Back     alignment and function description
>sp|P46460|NSF_MOUSE Vesicle-fusing ATPase OS=Mus musculus GN=Nsf PE=1 SV=2 Back     alignment and function description
>sp|P18708|NSF_CRIGR Vesicle-fusing ATPase OS=Cricetulus griseus GN=NSF PE=1 SV=1 Back     alignment and function description
>sp|Q9QUL6|NSF_RAT Vesicle-fusing ATPase OS=Rattus norvegicus GN=Nsf PE=1 SV=1 Back     alignment and function description
>sp|Q9P7Q4|SEC18_SCHPO Vesicular-fusion protein sec18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec18 PE=1 SV=1 Back     alignment and function description
>sp|Q75JI3|NSF_DICDI Vesicle-fusing ATPase OS=Dictyostelium discoideum GN=nsfA PE=1 SV=1 Back     alignment and function description
>sp|P54351|NSF2_DROME Vesicle-fusing ATPase 2 OS=Drosophila melanogaster GN=Nsf2 PE=2 SV=2 Back     alignment and function description
>sp|P18759|SEC18_YEAST Vesicular-fusion protein SEC18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC18 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
224079215 738 predicted protein [Populus trichocarpa] 0.979 0.788 0.875 0.0
224125340 750 predicted protein [Populus trichocarpa] 0.983 0.778 0.862 0.0
255556069 701 vesicular-fusion protein nsf, putative [ 0.979 0.830 0.862 0.0
356521353 746 PREDICTED: vesicle-fusing ATPase-like [G 0.988 0.786 0.852 0.0
449443540 743 PREDICTED: vesicle-fusing ATPase-like [C 0.988 0.790 0.838 0.0
225461445 739 PREDICTED: vesicle-fusing ATPase-like [V 0.981 0.788 0.848 0.0
356546235 742 PREDICTED: vesicle-fusing ATPase-like [G 0.964 0.772 0.853 0.0
302143010 739 unnamed protein product [Vitis vinifera] 0.981 0.788 0.843 0.0
1449179 739 N-ethylmaleimide sensitive fusion protei 0.981 0.788 0.828 0.0
147828765 754 hypothetical protein VITISV_011590 [Viti 0.981 0.773 0.824 0.0
>gi|224079215|ref|XP_002305796.1| predicted protein [Populus trichocarpa] gi|222848760|gb|EEE86307.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1063 bits (2749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/588 (87%), Positives = 547/588 (93%), Gaps = 6/588 (1%)

Query: 1   MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
           M SRFG QS   TTM V NTP+ADLALTNLAYCSP+DL NF VP + LFLA VA  S   
Sbjct: 1   MASRFGFQS---TTMIVTNTPAADLALTNLAYCSPSDLHNFAVPGTKLFLALVADSS--- 54

Query: 61  SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
           ++  H ++  GQIALN++QRRHAKVS+GD VS++RFIPPEDFNLALLT+ELEFVKKG++N
Sbjct: 55  AITPHENIRTGQIALNAIQRRHAKVSSGDTVSVSRFIPPEDFNLALLTLELEFVKKGTRN 114

Query: 121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
           EQ+DAV+LANQLRKRF NQVMT+GQR  FEYHGNNYIFTV  A VEG+E SN +ERG+I+
Sbjct: 115 EQIDAVILANQLRKRFANQVMTSGQRATFEYHGNNYIFTVTQATVEGREDSNDVERGMIS 174

Query: 181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
           ++TY VFEASN SGIKIVNQRE A+SNIFRHKEFNLQSLGIGGL AEFADIFRRAFASRV
Sbjct: 175 SDTYIVFEASNSSGIKIVNQREAASSNIFRHKEFNLQSLGIGGLGAEFADIFRRAFASRV 234

Query: 241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
           FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNG EPKIVNGPEVLSKFVGETE
Sbjct: 235 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGREPKIVNGPEVLSKFVGETE 294

Query: 301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
           KN+RDLFADAENDQRT GDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct: 295 KNVRDLFADAENDQRTNGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 354

Query: 361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
           GVESLNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF
Sbjct: 355 GVESLNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 414

Query: 421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
           LAPDVNLQELAARTKNYSGAELEGV KSAVSFALNRQLS+DDLTKPVDEESIKVTMDDFL
Sbjct: 415 LAPDVNLQELAARTKNYSGAELEGVVKSAVSFALNRQLSLDDLTKPVDEESIKVTMDDFL 474

Query: 481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
           HAL+EIVPAFGASTDDLER RLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSP+VTCLLE
Sbjct: 475 HALHEIVPAFGASTDDLERCRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPMVTCLLE 534

Query: 541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSE 588
           GPSGSGKTALAAT GIDSDFP+VKIISAE+MIGLHESTKCAQIVKV E
Sbjct: 535 GPSGSGKTALAATVGIDSDFPYVKIISAETMIGLHESTKCAQIVKVFE 582

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125340|ref|XP_002329781.1| predicted protein [Populus trichocarpa] gi|222870843|gb|EEF07974.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556069|ref|XP_002519069.1| vesicular-fusion protein nsf, putative [Ricinus communis] gi|223541732|gb|EEF43280.1| vesicular-fusion protein nsf, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356521353|ref|XP_003529321.1| PREDICTED: vesicle-fusing ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|449443540|ref|XP_004139535.1| PREDICTED: vesicle-fusing ATPase-like [Cucumis sativus] gi|449513613|ref|XP_004164372.1| PREDICTED: vesicle-fusing ATPase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225461445|ref|XP_002284987.1| PREDICTED: vesicle-fusing ATPase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546235|ref|XP_003541535.1| PREDICTED: vesicle-fusing ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|302143010|emb|CBI20305.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|1449179|dbj|BAA13101.1| N-ethylmaleimide sensitive fusion protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147828765|emb|CAN70797.1| hypothetical protein VITISV_011590 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query594
TAIR|locus:2135378 742 NSF "N-ethylmaleimide sensitiv 0.983 0.787 0.809 6.6e-255
UNIPROTKB|F1P6Z3 745 NSF "Uncharacterized protein" 0.956 0.762 0.463 9.1e-132
UNIPROTKB|E2RFV4 811 NSF "Uncharacterized protein" 0.954 0.699 0.464 1.2e-131
UNIPROTKB|E1BQU4 745 NSF "Uncharacterized protein" 0.951 0.758 0.455 1.7e-130
UNIPROTKB|E1C646 744 NSF "Uncharacterized protein" 0.951 0.759 0.455 1.7e-130
UNIPROTKB|E1C649 747 NSF "Uncharacterized protein" 0.951 0.756 0.455 1.7e-130
UNIPROTKB|F1MZU2 746 NSF "Uncharacterized protein" 0.954 0.760 0.459 2.2e-130
UNIPROTKB|F1LQ81 744 Nsf "Vesicle-fusing ATPase" [R 0.959 0.766 0.456 2.2e-130
ZFIN|ZDB-GENE-030616-37 744 nsfa "N-ethylmaleimide-sensiti 0.954 0.762 0.462 2.8e-130
UNIPROTKB|P46459 744 NSF "Vesicle-fusing ATPase" [H 0.954 0.762 0.459 3.5e-130
TAIR|locus:2135378 NSF "N-ethylmaleimide sensitive factor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2454 (868.9 bits), Expect = 6.6e-255, P = 6.6e-255
 Identities = 476/588 (80%), Positives = 530/588 (90%)

Query:     1 MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
             M  R+GSQ   V TM V NTPSADLA TNLAYCS +DL  F VP S+LFLA+VA DSF+L
Sbjct:     1 MAGRYGSQ---VMTMTVTNTPSADLAFTNLAYCSSSDLRQFSVPGSDLFLANVA-DSFIL 56

Query:    61 SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
             SL  H S+  G IALN++QRRHA+VSTGD VS++RF+PPE+F+LA+LT+ELEFVKKG+K+
Sbjct:    57 SLCGHGSIRDGNIALNAIQRRHARVSTGDMVSVSRFVPPENFDLAMLTLELEFVKKGTKS 116

Query:   121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
             EQVDA LL+ QL++++ NQV+T GQ+  FEYHG NYI TVN A VEGQ+ +N +ERG+++
Sbjct:   117 EQVDAALLSTQLKRKYTNQVLTVGQKATFEYHGTNYILTVNRADVEGQDHTNGIERGLLS 176

Query:   181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
              +TY VFEASN SGIKIVNQRE A+SNIF+HKEFNL+SLGIGGL AEFADIFRRAFASRV
Sbjct:   177 KDTYIVFEASNASGIKIVNQREAASSNIFKHKEFNLESLGIGGLGAEFADIFRRAFASRV 236

Query:   241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
             FPPHVTS+LGIKHVKGMLL+GPPGTGKTLMARQIGKMLNG +PKIVNGPEVLSKFVGETE
Sbjct:   237 FPPHVTSRLGIKHVKGMLLFGPPGTGKTLMARQIGKMLNGKDPKIVNGPEVLSKFVGETE 296

Query:   301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
             KN+RDLFADAE DQRT GD S+LHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct:   297 KNVRDLFADAEQDQRTLGDASELHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 356

Query:   361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
             GVE+LNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDE GRLQILQIHTNKMKENSF
Sbjct:   357 GVEALNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDEAGRLQILQIHTNKMKENSF 416

Query:   421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
             L  D+NLQELAARTKNYSGAELEGV KSA S+ALNRQLSMDDLTKPV+EE+IK+TM+DFL
Sbjct:   417 LGTDINLQELAARTKNYSGAELEGVVKSATSYALNRQLSMDDLTKPVEEENIKITMEDFL 476

Query:   481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
             HA+YE+ PAFGASTDDLER RLNGMVDCG RH HIY+RAMLLVEQVKVS  SPLVTCLLE
Sbjct:   477 HAIYEVQPAFGASTDDLERCRLNGMVDCGHRHNHIYKRAMLLVEQVKVSTRSPLVTCLLE 536

Query:   541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSE 588
             GPSGSGKTALAAT GIDSDFP+VKI+SAE+MIGL ESTKCA IVKV E
Sbjct:   537 GPSGSGKTALAATIGIDSDFPYVKIVSAETMIGLSESTKCAHIVKVFE 584
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
UNIPROTKB|F1P6Z3 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFV4 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQU4 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C646 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C649 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZU2 NSF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ81 Nsf "Vesicle-fusing ATPase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-37 nsfa "N-ethylmaleimide-sensitive factor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P46459 NSF "Vesicle-fusing ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M0Y8NSF_ARATH3, ., 6, ., 4, ., 60.80950.98310.7870yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.976
3rd Layer3.6.4.60.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_IV0185
hypothetical protein (738 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.VI.2308.1
hypothetical protein (550 aa)
  •     0.479
gw1.XVI.1402.1
hypothetical protein (482 aa)
  •     0.477
gw1.IX.605.1
hypothetical protein (992 aa)
  •     0.473
gw1.IX.593.1
hypothetical protein (991 aa)
  •     0.472
gw1.21787.2.1
hypothetical protein (78 aa)
  •     0.470
gw1.120.71.1
hypothetical protein (874 aa)
  •     0.446
estExt_fgenesh4_pg.C_LG_XII0050
hypothetical protein (1332 aa)
  •     0.435
eugene3.00111078
hypothetical protein (224 aa)
  •     0.418
gw1.V.3551.1
hypothetical protein (184 aa)
  •     0.406
eugene3.00111080
hypothetical protein (235 aa)
  •     0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-62
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-61
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 4e-59
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-57
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-56
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 3e-55
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-54
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 8e-46
pfam00004131 pfam00004, AAA, ATPase family associated with vari 3e-42
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 4e-42
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-40
CHL00176638 CHL00176, ftsH, cell division protein; Validated 5e-39
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-37
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 5e-34
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 1e-33
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 6e-31
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-20
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-12
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-11
smart0107382 smart01073, CDC48_N, Cell division protein 48 (CDC 4e-07
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 4e-07
pfam0293361 pfam02933, CDC48_2, Cell division protein 48 (CDC4 3e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 4e-05
PRK13342413 PRK13342, PRK13342, recombination factor protein R 7e-05
pfam13401124 pfam13401, AAA_22, AAA domain 1e-04
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 2e-04
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 3e-04
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 4e-04
pfam0235984 pfam02359, CDC48_N, Cell division protein 48 (CDC4 7e-04
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 0.001
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 0.001
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.001
smart0107264 smart01072, CDC48_2, Cell division protein 48 (CDC 0.001
pfam09848348 pfam09848, DUF2075, Uncharacterized conserved prot 0.004
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  219 bits (560), Expect = 1e-62
 Identities = 122/286 (42%), Positives = 167/286 (58%), Gaps = 22/286 (7%)

Query: 221 IGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNG 280
           IGGL  E     R A    +  P +  K+GI+  KG+LL+GPPGTGKTL+A+ +    +G
Sbjct: 455 IGGLE-EVKQELREAVEWPLKHPEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATE-SG 512

Query: 281 MEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGS 340
                V GPE+LSK+VGE+EK IR++F  A         Q+   +I FDEIDAI  +RG 
Sbjct: 513 ANFIAVRGPEILSKWVGESEKAIREIFRKAR--------QAAPAIIFFDEIDAIAPARG- 563

Query: 341 TRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPD 400
            R  T V D IVNQLLT++DG++ L+NV++I  TNR D+LD ALLRPGR +  + +  PD
Sbjct: 564 ARFDTSVTDRIVNQLLTEMDGIQELSNVVVIAATNRPDILDPALLRPGRFDRLILVPPPD 623

Query: 401 ENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSM 460
           E  R +I +IHT  M     LA DV+L+ELA  T+ Y+GA++E V + A   AL   +  
Sbjct: 624 EEARKEIFKIHTRSMP----LAEDVDLEELAEMTEGYTGADIEAVCREAAMAALRESIGS 679

Query: 461 DDLTKPVDEES-----IKVTMDDFLHALYEIVPAFGASTDDLERSR 501
               K    E      +KV M  FL AL ++ P+   S +D+ R  
Sbjct: 680 PAKEKLEVGEEEFLKDLKVEMRHFLEALKKVKPSV--SKEDMLRYE 723

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2 Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2 Back     alignment and domain information
>gnl|CDD|220440 pfam09848, DUF2075, Uncharacterized conserved protein (DUF2075) Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 594
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 100.0
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.98
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.96
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.95
CHL00095 821 clpC Clp protease ATP binding subunit 99.93
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.93
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.91
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.9
PRK10865 857 protein disaggregation chaperone; Provisional 99.9
CHL00181287 cbbX CbbX; Provisional 99.89
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.88
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.87
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.86
PF00004132 AAA: ATPase family associated with various cellula 99.84
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.83
CHL00195 489 ycf46 Ycf46; Provisional 99.83
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.8
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.75
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.75
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.69
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.68
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.67
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.67
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.62
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.62
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.61
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.6
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.6
PRK00149450 dnaA chromosomal replication initiation protein; R 99.59
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 99.58
PRK06893229 DNA replication initiation factor; Validated 99.57
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.57
PTZ001121164 origin recognition complex 1 protein; Provisional 99.56
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.55
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.55
PRK14088440 dnaA chromosomal replication initiation protein; P 99.54
PRK14086617 dnaA chromosomal replication initiation protein; P 99.54
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.53
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.53
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.53
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.52
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.51
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.51
PRK12422445 chromosomal replication initiation protein; Provis 99.51
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.51
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.51
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK08084235 DNA replication initiation factor; Provisional 99.49
PRK07940394 DNA polymerase III subunit delta'; Validated 99.48
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.48
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.48
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.47
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.47
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.47
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.47
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.46
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.46
PRK12402337 replication factor C small subunit 2; Reviewed 99.46
PRK05642234 DNA replication initiation factor; Validated 99.46
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.46
PRK08727233 hypothetical protein; Validated 99.46
PRK14087450 dnaA chromosomal replication initiation protein; P 99.46
PRK04195 482 replication factor C large subunit; Provisional 99.45
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.45
PRK13342413 recombination factor protein RarA; Reviewed 99.44
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.44
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.44
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.43
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.43
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.43
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.43
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.42
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.42
KOG2028554 consensus ATPase related to the helicase subunit o 99.41
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.41
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.4
PRK13341 725 recombination factor protein RarA/unknown domain f 99.4
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.4
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.4
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.39
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.39
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.38
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.37
PRK06620214 hypothetical protein; Validated 99.37
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.37
PLN03025319 replication factor C subunit; Provisional 99.36
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.36
COG0593408 DnaA ATPase involved in DNA replication initiation 99.36
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.36
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.36
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.36
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.35
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.34
PHA02544316 44 clamp loader, small subunit; Provisional 99.33
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.33
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.32
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.32
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.31
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.31
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.3
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.3
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.29
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.28
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.28
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.28
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.28
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.27
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.26
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.25
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.24
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.23
PRK09087226 hypothetical protein; Validated 99.23
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.23
PRK00440319 rfc replication factor C small subunit; Reviewed 99.22
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.21
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.2
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.2
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.19
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.19
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.19
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.18
CHL00206 2281 ycf2 Ycf2; Provisional 99.17
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.17
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.13
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.12
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.12
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.11
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.1
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.1
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.09
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.09
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.09
PHA02244383 ATPase-like protein 99.07
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.07
CHL00176 638 ftsH cell division protein; Validated 99.05
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.04
smart00382148 AAA ATPases associated with a variety of cellular 99.04
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.02
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.01
PRK09112351 DNA polymerase III subunit delta'; Validated 99.0
PRK05564313 DNA polymerase III subunit delta'; Validated 99.0
PRK10865857 protein disaggregation chaperone; Provisional 98.99
PF00004132 AAA: ATPase family associated with various cellula 98.99
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.99
CHL00095821 clpC Clp protease ATP binding subunit 98.98
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.98
PRK07471365 DNA polymerase III subunit delta'; Validated 98.98
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.97
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.96
PRK07399314 DNA polymerase III subunit delta'; Validated 98.96
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.94
smart00350509 MCM minichromosome maintenance proteins. 98.94
PRK05707328 DNA polymerase III subunit delta'; Validated 98.94
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.93
COG0714329 MoxR-like ATPases [General function prediction onl 98.93
PRK11608326 pspF phage shock protein operon transcriptional ac 98.93
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.93
COG1221403 PspF Transcriptional regulators containing an AAA- 98.91
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.91
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.89
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.89
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.89
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.88
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.88
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.88
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 98.88
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.87
PRK13531 498 regulatory ATPase RavA; Provisional 98.87
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.86
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.85
PRK08058329 DNA polymerase III subunit delta'; Validated 98.84
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.83
PRK15424538 propionate catabolism operon regulatory protein Pr 98.83
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.83
PRK04132846 replication factor C small subunit; Provisional 98.82
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.82
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.81
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 98.81
PRK08116268 hypothetical protein; Validated 98.81
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.79
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.79
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.79
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.78
PRK06964342 DNA polymerase III subunit delta'; Validated 98.76
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.75
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.74
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 98.73
COG2204464 AtoC Response regulator containing CheY-like recei 98.73
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.72
CHL00181 287 cbbX CbbX; Provisional 98.71
PRK06871325 DNA polymerase III subunit delta'; Validated 98.71
PF07726131 AAA_3: ATPase family associated with various cellu 98.7
PRK09862506 putative ATP-dependent protease; Provisional 98.7
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.69
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.67
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.67
PRK08769319 DNA polymerase III subunit delta'; Validated 98.67
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.67
PRK07993334 DNA polymerase III subunit delta'; Validated 98.65
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.64
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.64
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.63
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.61
PRK08181269 transposase; Validated 98.59
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.59
PRK12377248 putative replication protein; Provisional 98.57
PRK08699325 DNA polymerase III subunit delta'; Validated 98.56
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.55
PRK06526254 transposase; Provisional 98.54
PRK07952244 DNA replication protein DnaC; Validated 98.54
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.53
PF13173128 AAA_14: AAA domain 98.5
PRK06090319 DNA polymerase III subunit delta'; Validated 98.5
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.5
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.49
COG2256 436 MGS1 ATPase related to the helicase subunit of the 98.48
PRK13765 637 ATP-dependent protease Lon; Provisional 98.45
PRK09183259 transposase/IS protein; Provisional 98.45
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 98.44
PRK08939306 primosomal protein DnaI; Reviewed 98.44
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.42
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.41
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 98.41
PRK06921266 hypothetical protein; Provisional 98.4
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.36
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.36
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 98.36
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.36
PRK06835329 DNA replication protein DnaC; Validated 98.36
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 98.34
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 98.34
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.34
PF05729166 NACHT: NACHT domain 98.33
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.33
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 98.33
PRK15115444 response regulator GlrR; Provisional 98.32
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.3
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 98.3
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.29
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 98.29
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 98.29
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.28
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.26
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.25
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.25
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.24
PRK06851367 hypothetical protein; Provisional 98.23
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.23
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.19
PF07724 171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.17
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.14
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.14
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.11
PF0293364 CDC48_2: Cell division protein 48 (CDC48), domain 98.11
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 98.1
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.09
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.08
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.07
KOG2028 554 consensus ATPase related to the helicase subunit o 98.07
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.06
KOG1942 456 consensus DNA helicase, TBP-interacting protein [R 98.06
PF07726131 AAA_3: ATPase family associated with various cellu 98.05
COG1485367 Predicted ATPase [General function prediction only 98.05
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.04
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.03
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.03
PRK09302 509 circadian clock protein KaiC; Reviewed 98.03
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.01
PHA00729226 NTP-binding motif containing protein 98.0
smart00382148 AAA ATPases associated with a variety of cellular 97.99
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.98
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 97.97
PRK05917290 DNA polymerase III subunit delta'; Validated 97.95
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.95
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 97.95
PRK04195 482 replication factor C large subunit; Provisional 97.95
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.94
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.94
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.91
KOG2383467 consensus Predicted ATPase [General function predi 97.91
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.86
PRK05818261 DNA polymerase III subunit delta'; Validated 97.86
PRK13342 413 recombination factor protein RarA; Reviewed 97.85
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.85
COG4619223 ABC-type uncharacterized transport system, ATPase 97.85
PHA02244 383 ATPase-like protein 97.83
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.81
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 97.8
PRK00131 175 aroK shikimate kinase; Reviewed 97.79
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.77
TIGR02012321 tigrfam_recA protein RecA. This model describes or 97.76
PRK09361225 radB DNA repair and recombination protein RadB; Pr 97.73
PRK12377248 putative replication protein; Provisional 97.72
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.72
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.71
PRK07132299 DNA polymerase III subunit delta'; Validated 97.71
COG1123 539 ATPase components of various ABC-type transport sy 97.7
PRK08118 167 topology modulation protein; Reviewed 97.69
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.69
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.67
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.67
PRK07276290 DNA polymerase III subunit delta'; Validated 97.66
PRK08116268 hypothetical protein; Validated 97.66
cd01394218 radB RadB. The archaeal protein radB shares simila 97.65
cd01128249 rho_factor Transcription termination factor rho is 97.64
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.62
PRK11823446 DNA repair protein RadA; Provisional 97.62
PF14516331 AAA_35: AAA-like domain 97.61
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.61
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.6
cd00983325 recA RecA is a bacterial enzyme which has roles in 97.6
COG0714 329 MoxR-like ATPases [General function prediction onl 97.6
PRK00625 173 shikimate kinase; Provisional 97.58
PRK03839 180 putative kinase; Provisional 97.58
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.58
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 97.58
PRK06835329 DNA replication protein DnaC; Validated 97.57
PRK06921266 hypothetical protein; Provisional 97.56
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 97.56
PRK08939306 primosomal protein DnaI; Reviewed 97.54
PRK14532 188 adenylate kinase; Provisional 97.54
PRK06620 214 hypothetical protein; Validated 97.54
KOG0478804 consensus DNA replication licensing factor, MCM4 c 97.54
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.53
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.52
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 97.52
PRK08181269 transposase; Validated 97.52
PRK13947 171 shikimate kinase; Provisional 97.51
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.51
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 97.51
TIGR02688449 conserved hypothetical protein TIGR02688. Members 97.5
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.5
PLN03025 319 replication factor C subunit; Provisional 97.5
PRK14532188 adenylate kinase; Provisional 97.5
PRK13949 169 shikimate kinase; Provisional 97.5
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.5
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.49
PRK13341 725 recombination factor protein RarA/unknown domain f 97.49
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.48
PRK14531 183 adenylate kinase; Provisional 97.48
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.48
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 97.48
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 97.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.48
COG1102 179 Cmk Cytidylate kinase [Nucleotide transport and me 97.48
PRK06067234 flagellar accessory protein FlaH; Validated 97.46
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.46
KOG2680 454 consensus DNA helicase TIP49, TBP-interacting prot 97.45
PTZ00088 229 adenylate kinase 1; Provisional 97.45
COG1241682 MCM2 Predicted ATPase involved in replication cont 97.43
KOG3347 176 consensus Predicted nucleotide kinase/nuclear prot 97.43
PRK00771437 signal recognition particle protein Srp54; Provisi 97.43
PRK07952244 DNA replication protein DnaC; Validated 97.43
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.42
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.42
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 97.41
PRK07261 171 topology modulation protein; Provisional 97.41
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.41
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.41
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.4
PRK14974336 cell division protein FtsY; Provisional 97.39
PRK06217 183 hypothetical protein; Validated 97.39
PRK09376416 rho transcription termination factor Rho; Provisio 97.37
PHA02544 316 44 clamp loader, small subunit; Provisional 97.37
PRK08903 227 DnaA regulatory inactivator Hda; Validated 97.37
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.36
PLN02674 244 adenylate kinase 97.35
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.35
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.34
PRK14530 215 adenylate kinase; Provisional 97.34
PRK09354349 recA recombinase A; Provisional 97.34
PRK13948 182 shikimate kinase; Provisional 97.33
PRK06893 229 DNA replication initiation factor; Validated 97.32
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 97.32
PRK12402 337 replication factor C small subunit 2; Reviewed 97.32
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 97.32
COG4088261 Predicted nucleotide kinase [Nucleotide transport 97.31
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.31
PRK15455 644 PrkA family serine protein kinase; Provisional 97.3
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.3
KOG3928461 consensus Mitochondrial ribosome small subunit com 97.29
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.29
PLN02200 234 adenylate kinase family protein 97.29
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.29
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.28
PRK08118167 topology modulation protein; Reviewed 97.26
PRK06547172 hypothetical protein; Provisional 97.25
COG0703 172 AroK Shikimate kinase [Amino acid transport and me 97.25
PRK00149 450 dnaA chromosomal replication initiation protein; R 97.24
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.24
PHA02774613 E1; Provisional 97.24
TIGR01313 163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.23
PRK00131175 aroK shikimate kinase; Reviewed 97.22
PRK02496 184 adk adenylate kinase; Provisional 97.22
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.22
PRK03731 171 aroL shikimate kinase II; Reviewed 97.2
PHA00729 226 NTP-binding motif containing protein 97.2
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 97.2
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.19
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.19
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.19
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.19
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.18
PRK10536262 hypothetical protein; Provisional 97.18
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.18
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.18
PRK14528 186 adenylate kinase; Provisional 97.18
PRK05057 172 aroK shikimate kinase I; Reviewed 97.18
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.17
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.17
PF12780 268 AAA_8: P-loop containing dynein motor region D4; I 97.17
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.17
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.17
PRK04040 188 adenylate kinase; Provisional 97.16
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 97.15
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 97.15
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.15
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.14
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.14
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.14
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.14
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.14
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 97.14
PRK13531 498 regulatory ATPase RavA; Provisional 97.14
COG0703172 AroK Shikimate kinase [Amino acid transport and me 97.14
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 97.14
PRK09183259 transposase/IS protein; Provisional 97.13
cd00227 175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.13
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 97.13
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 97.12
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 97.11
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.1
PRK08084 235 DNA replication initiation factor; Provisional 97.1
PRK06526254 transposase; Provisional 97.1
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.09
PTZ00035337 Rad51 protein; Provisional 97.09
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.09
PRK13946 184 shikimate kinase; Provisional 97.09
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.08
PRK00279 215 adk adenylate kinase; Reviewed 97.08
COG0488 530 Uup ATPase components of ABC transporters with dup 97.08
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.08
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.07
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.07
PRK13695174 putative NTPase; Provisional 97.07
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.07
PRK04296190 thymidine kinase; Provisional 97.06
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.06
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.05
PHA02624 647 large T antigen; Provisional 97.05
PLN02674244 adenylate kinase 97.05
PRK14526 211 adenylate kinase; Provisional 97.05
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-116  Score=893.51  Aligned_cols=579  Identities=54%  Similarity=0.852  Sum_probs=539.2

Q ss_pred             CCCceeEEEeecCCcccccccEEEeChhhhcccCCCCCCceEEEEeCCcEEEEEeeCCCCCCCceeeCHhhhhccCccCC
Q 007661            9 SSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTG   88 (594)
Q Consensus         9 ~~~~~~l~v~~~p~~~~~~tn~a~vsp~~~~~l~~~g~~~~~v~v~g~~~v~~~~~~~~~~~~~i~~~~~~r~~~~~~~~   88 (594)
                      ++..+.++|.+||++++++|||+||||.||++.       .++.+.+-+|+|+...++++++|.|+++..||+|+++++|
T Consensus         5 ~~~~~~~~v~k~ps~e~altn~a~v~~~DF~~~-------~~~~vd~~~~~Fs~~~~~~i~~g~i~fs~~qR~wa~~Sl~   77 (744)
T KOG0741|consen    5 VSNIKAFQVTKCPSNELALTNCAYVSPSDFRQF-------QVIIVDNFHYVFSTEFTPSIPPGNIGFSLPQRKWAGWSLG   77 (744)
T ss_pred             cccceeeeeecCCchhhhccCcceeCccccccc-------eeeEEeeeeEEEEeeccCCCCCceeccchhhhhhhhcccC
Confidence            455789999999999999999999999999863       3444533479999999999999999999999999999999


Q ss_pred             CeEEEEEeCCC-CcceeEeEEEEeeeeecCC-ccccccHHHHHHHHHHHhccCcccCCcEEEEEEcC-eeEEEEEEEeee
Q 007661           89 DHVSLNRFIPP-EDFNLALLTVELEFVKKGS-KNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHG-NNYIFTVNGAAV  165 (594)
Q Consensus        89 ~~v~v~~~~~~-~~~~~~~~~~~i~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~-~~~~~~v~~~~~  165 (594)
                      |.|.|+||.++ ...+++++++++||.+++. +..++|.++++..|+.+|.+|++++||.+++.|.+ ..+.++|++++.
T Consensus        78 qev~V~~~~~~~~~~~l~~m~le~dF~~k~~~~sep~Dad~ma~qF~~~y~~q~fsvgQ~~~f~f~~~~~l~l~v~~ie~  157 (744)
T KOG0741|consen   78 QEVEVKPFTFDGSCDYLGSMTLEIDFLNKKNTTSEPFDADEMAKQFKRQYNSQAFSVGQQLVFEFNGNKLLGLKVKDIEA  157 (744)
T ss_pred             ceeEEEecccCcccccceeEEEEehhhhcCCCCCCCCCHHHHHHHHHHHhcCcccCCccEEEEEecCceEeeeEEEEEee
Confidence            99999999977 4579999999999998875 67899999999999999999999999999999998 557888888765


Q ss_pred             -c-----Ccc---ccccccceeEcCCcEEEEEecCCCceeeecccC-CccccccccCccccccCCccCcHHHHHHHHHHH
Q 007661          166 -E-----GQE---KSNALERGIITNETYFVFEASNDSGIKIVNQRE-GANSNIFRHKEFNLQSLGIGGLSAEFADIFRRA  235 (594)
Q Consensus       166 -~-----~~~---~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~igGl~~~~~~i~~~~  235 (594)
                       +     +..   ......+|++.++|.|.|.+...+.+++.++.+ .+.++.+..|+|+|+++|||||++++..|||+|
T Consensus       158 ~D~~~~~~~~a~~~~~~~~~G~l~~nT~i~F~k~~~s~lnL~~~~~~k~~~n~ii~Pdf~Fe~mGIGGLd~EFs~IFRRA  237 (744)
T KOG0741|consen  158 FDPGISEGESAVTKRQKIERGLLLGNTQIVFEKAENSSLNLIGKSKTKPASNSIINPDFNFESMGIGGLDKEFSDIFRRA  237 (744)
T ss_pred             eccccccCCcccccccceeeeEeecCcEEEEEeccCcceEeeccccccchhccccCCCCChhhcccccchHHHHHHHHHH
Confidence             1     111   113467899999999999999999999988743 233444444999999999999999999999999


Q ss_pred             HHccCCChhhhhhcCCCCCceEEEEcCCCCcHHHHHHHHHHhhCCCCcEEEecchhhhcccchhHHHHHHHHHHHHhhcc
Q 007661          236 FASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQR  315 (594)
Q Consensus       236 ~~~~~~~~~~~~~~g~~~~~giLL~GppGtGKT~lar~ia~~l~~~~~~~v~~~~l~~~~~g~~~~~i~~lf~~a~~~~~  315 (594)
                      |++++++|++.+++|++|.+|||||||||||||++||.|++++++.++.+||+|++++||+|++|+++|++|.+|++.++
T Consensus       238 FAsRvFpp~vie~lGi~HVKGiLLyGPPGTGKTLiARqIGkMLNArePKIVNGPeIL~KYVGeSE~NvR~LFaDAEeE~r  317 (744)
T KOG0741|consen  238 FASRVFPPEVIEQLGIKHVKGILLYGPPGTGKTLIARQIGKMLNAREPKIVNGPEILNKYVGESEENVRKLFADAEEEQR  317 (744)
T ss_pred             HHhhcCCHHHHHHcCccceeeEEEECCCCCChhHHHHHHHHHhcCCCCcccCcHHHHHHhhcccHHHHHHHHHhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCcEEEEEccchhhhccCCCCCCCCchHHHHHHHHHHhhcCccccCcEEEEEeeCCcccccHHhhCCCCccceee
Q 007661          316 TRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVE  395 (594)
Q Consensus       316 ~~~~~~~~~Il~iDEid~l~~~~~~~~~~~~~~~~~v~~Ll~~ld~~~~~~~v~vI~~tn~~~~ld~al~r~gRf~~~i~  395 (594)
                      .+|..+..|||+|||||++|++||+..+++++++.+++|||+.|||+++.+|++|||+|||.|+||+||+|||||+.+++
T Consensus       318 ~~g~~SgLHIIIFDEiDAICKqRGS~~g~TGVhD~VVNQLLsKmDGVeqLNNILVIGMTNR~DlIDEALLRPGRlEVqmE  397 (744)
T KOG0741|consen  318 RLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKMDGVEQLNNILVIGMTNRKDLIDEALLRPGRLEVQME  397 (744)
T ss_pred             hhCccCCceEEEehhhHHHHHhcCCCCCCCCccHHHHHHHHHhcccHHhhhcEEEEeccCchhhHHHHhcCCCceEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCHHHHHHHHHHHHhccccCCCCCCcccHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhccCcc--cCCCCcccchhh
Q 007661          396 ISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMD--DLTKPVDEESIK  473 (594)
Q Consensus       396 i~~P~~~~r~~IL~~~~~~~~~~~~l~~~~~l~~la~~t~g~sg~dl~~l~~~A~~~a~~r~~~~~--~~~~~~~~~~~~  473 (594)
                      +.+||++.|.+||++|+++|..+..+..|+|+.+||..|.+|+||+|+++++.|.++|++|++...  ....+...++.+
T Consensus       398 IsLPDE~gRlQIl~IHT~rMre~~~l~~dVdl~elA~lTKNfSGAEleglVksA~S~A~nR~vk~~~~~~~~~~~~e~lk  477 (744)
T KOG0741|consen  398 ISLPDEKGRLQILKIHTKRMRENNKLSADVDLKELAALTKNFSGAELEGLVKSAQSFAMNRHVKAGGKVEVDPVAIENLK  477 (744)
T ss_pred             EeCCCccCceEEEEhhhhhhhhcCCCCCCcCHHHHHHHhcCCchhHHHHHHHHHHHHHHHhhhccCcceecCchhhhhee
Confidence            999999999999999999999999999999999999999999999999999999999999998866  333445678899


Q ss_pred             cchhHHHHHHHhcccCCCcCCccccccccCcceeccchhhHHHHHHHHHHHHHHhcCCCcceEEEeecCCCCchHHHHHH
Q 007661          474 VTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAAT  553 (594)
Q Consensus       474 vt~~df~~al~~~~ps~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~gvLL~GPpG~GKT~lAka  553 (594)
                      |+++||..|+.+++|+|+.+.+++.....+|++.|+....+++.....++++.+.+..+|..++||.||||+|||+||..
T Consensus       478 V~r~DFl~aL~dVkPAFG~see~l~~~~~~Gmi~~g~~v~~il~~G~llv~qvk~s~~s~lvSvLl~Gp~~sGKTaLAA~  557 (744)
T KOG0741|consen  478 VTRGDFLNALEDVKPAFGISEEDLERFVMNGMINWGPPVTRILDDGKLLVQQVKNSERSPLVSVLLEGPPGSGKTALAAK  557 (744)
T ss_pred             ecHHHHHHHHHhcCcccCCCHHHHHHHHhCCceeecccHHHHHhhHHHHHHHhhccccCcceEEEEecCCCCChHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCEEEEeccccccccccchhhhHHHHHHHhhhcCC
Q 007661          554 AGIDSDFPFVKIISAESMIGLHESTKCAQIVKVSECQFSGS  594 (594)
Q Consensus       554 lA~~~~~~fi~v~~~e~~vG~sE~~~~~~ir~~F~~A~~~~  594 (594)
                      +|..++||||+|.+||.+||.||.+||++|+++|++||||.
T Consensus       558 iA~~S~FPFvKiiSpe~miG~sEsaKc~~i~k~F~DAYkS~  598 (744)
T KOG0741|consen  558 IALSSDFPFVKIISPEDMIGLSESAKCAHIKKIFEDAYKSP  598 (744)
T ss_pred             HHhhcCCCeEEEeChHHccCccHHHHHHHHHHHHHHhhcCc
Confidence            99999999999999999999999999999999999999984

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF02933 CDC48_2: Cell division protein 48 (CDC48), domain 2; InterPro: IPR004201 This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 3e-44
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 3e-44
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 7e-42
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 7e-42
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 8e-42
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-41
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 3e-39
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 9e-36
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-34
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 4e-34
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 4e-34
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 2e-33
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 7e-33
2ce7_A476 Edta Treated Length = 476 9e-33
3kds_E465 Apo-ftsh Crystal Structure Length = 465 5e-32
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-30
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 1e-30
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-28
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-28
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-28
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-28
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 8e-27
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 2e-26
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-23
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 1e-21
3vfd_A389 Human Spastin Aaa Domain Length = 389 7e-21
1nsf_A 273 D2 Hexamerization Domain Of N-Ethylmaleimide Sensit 2e-20
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-20
1xwi_A322 Crystal Structure Of Vps4b Length = 322 6e-20
1d2n_A 272 D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Prot 3e-19
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 7e-18
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 7e-18
3b9p_A297 Spastin Length = 297 9e-18
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-17
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-17
1qdn_A204 Amino Terminal Domain Of The N-Ethylmaleimide Sensi 3e-09
1qcs_A211 N-Terminal Domain Of N-Ethylmaleimide Sensitive Fac 5e-08
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 1e-04
1um8_A376 Crystal Structure Of Helicobacter Pylori Clpx Lengt 3e-04
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 6e-04
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (447), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 186/357 (52%), Gaps = 24/357 (6%)
Query: 221 IGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNG 280
           IGG   + A I +      +  P +   +G+K  +G+LLYGPPGTGKTL+AR +     G
Sbjct: 206 IGGCRKQLAQI-KEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANE-TG 263
Query: 281 MEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGS 340
               ++NGPE++SK  GE+E N+R  F +AE +           +I  DE+DAI   R  
Sbjct: 264 AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREK 315
Query: 341 TRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPD 400
           T     V   IV+QLLT +DG++   +V+++  TNR + +D AL R GR + +V+I +PD
Sbjct: 316 TH--GEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD 373
Query: 401 ENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSM 460
             GRL+ILQIHT  MK    LA DV+L+++A  T  + GA+L  +   A   A+ +++ +
Sbjct: 374 ATGRLEILQIHTKNMK----LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDL 429
Query: 461 DDLT-KPVDEE---SIKVTMDDFLHALYEIVPAFGAST----DDLERSRLNGMVDCGDRH 512
            DL  + +D E   S+ VTMDDF  AL +  P+    T      +    + G+ D     
Sbjct: 430 IDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKREL 489
Query: 513 KHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAE 569
           + + Q  +   ++      +P    L  GP G GKT LA     +    F+ I   E
Sbjct: 490 QELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPE 546
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|1NSF|A Chain A, D2 Hexamerization Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 273 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1D2N|A Chain A, D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Protein Length = 272 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|1QDN|A Chain A, Amino Terminal Domain Of The N-Ethylmaleimide Sensitive Fusion Protein (Nsf) Length = 204 Back     alignment and structure
>pdb|1QCS|A Chain A, N-Terminal Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 211 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|1UM8|A Chain A, Crystal Structure Of Helicobacter Pylori Clpx Length = 376 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query594
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 2e-86
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 2e-84
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 2e-84
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-79
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-76
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-69
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-56
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-55
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 4e-55
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-54
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 8e-54
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-53
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 3e-52
1qcs_A211 N-ethylmaleimide sensitive factor (NSF-N); double- 1e-51
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-50
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-47
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-46
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 5e-46
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 4e-45
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 8e-45
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 5e-43
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 1e-37
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 2e-42
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-42
1cr5_A189 SEC18P (residues 22 - 210); double-PSI beta barrel 6e-40
2krk_A86 26S protease regulatory subunit 8; structural geno 9e-20
3kw6_A78 26S protease regulatory subunit 8; structural geno 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-16
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 1e-13
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 7e-13
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 9e-13
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 6e-09
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 3e-08
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 6e-08
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 6e-08
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 7e-08
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 8e-05
2v1u_A387 Cell division control protein 6 homolog; DNA repli 2e-04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 5e-04
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 7e-04
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 8e-04
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
 Score =  270 bits (692), Expect = 2e-86
 Identities = 93/274 (33%), Positives = 146/274 (53%), Gaps = 36/274 (13%)

Query: 243 PHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKI----VNGPEVLSKFVGE 298
           P    K G+   KG+L YGPPG GKTL+A+ I       E +     + GPE+L+ + GE
Sbjct: 38  PDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIAN-----ECQANFISIKGPELLTMWFGE 92

Query: 299 TEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTR-DGTGVHDSIVNQLLT 357
           +E N+R++F       + R  Q+   V+ FDE+D+I K+RG    DG G  D ++NQ+LT
Sbjct: 93  SEANVREIF------DKAR--QAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILT 144

Query: 358 KIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKE 417
           ++DG+ +  NV +IG TNR D++D A+LRPGRL+  + I LPDE  R+ IL+ +  K   
Sbjct: 145 EMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSP- 203

Query: 418 NSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQL------------SMDDLTK 465
              +A DV+L+ LA  T  +SGA+L  + + A   A+   +            +   +  
Sbjct: 204 ---VAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEV 260

Query: 466 PVDEESIKVTMDDFLHALYEIVPAFGASTDDLER 499
             D+   ++  D F  A+         S +D+ +
Sbjct: 261 EEDDPVPEIRRDHFEEAMRFARR--SVSDNDIRK 292
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>1qcs_A N-ethylmaleimide sensitive factor (NSF-N); double-PSI beta barrel alpha beta roll, fusion protein; 1.90A {Cricetulus griseus} SCOP: b.52.2.3 d.31.1.1 PDB: 1qdn_A Length = 211 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 Length = 189 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Length = 199 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 100.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 100.0
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 100.0
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 100.0
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 100.0
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.98
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.97
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.97
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.97
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.97
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.97
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.97
1qcs_A211 N-ethylmaleimide sensitive factor (NSF-N); double- 99.96
1cr5_A189 SEC18P (residues 22 - 210); double-PSI beta barrel 99.95
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.95
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.93
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.92
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.91
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.86
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.84
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.81
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.79
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.78
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.78
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.77
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.77
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 99.76
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.75
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.74
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.73
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.73
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.72
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.71
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.71
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.71
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 99.71
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.69
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.68
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.68
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.66
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.66
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.63
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.63
3bos_A242 Putative DNA replication factor; P-loop containing 99.62
3pvs_A447 Replication-associated recombination protein A; ma 99.61
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.61
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.61
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.6
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.6
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.6
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 99.6
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.6
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.6
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.59
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.59
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.59
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.57
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.56
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.56
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.56
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.55
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.55
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.51
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.51
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.5
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.48
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.47
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.47
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.46
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.45
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.45
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.43
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.41
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.4
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.39
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.39
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.38
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.37
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.37
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.34
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.33
3co5_A143 Putative two-component system transcriptional RES 99.31
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.31
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.28
2krk_A86 26S protease regulatory subunit 8; structural geno 99.28
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.27
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.25
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.24
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.24
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 99.22
2gno_A305 DNA polymerase III, gamma subunit-related protein; 99.18
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.18
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.18
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 99.17
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.13
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.13
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.13
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.12
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.1
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.1
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.07
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.07
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.06
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.05
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.01
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.99
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 98.96
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 98.96
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.92
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.91
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 98.91
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.85
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.83
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.81
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.77
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.75
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.74
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.66
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.63
2qgz_A308 Helicase loader, putative primosome component; str 98.63
2fna_A357 Conserved hypothetical protein; structural genomic 98.63
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.62
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 98.61
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 98.55
3f8t_A506 Predicted ATPase involved in replication control, 98.52
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 98.47
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 98.43
1tue_A212 Replication protein E1; helicase, replication, E1E 98.41
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 98.35
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.35
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.3
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.28
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.28
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.24
3co5_A143 Putative two-component system transcriptional RES 98.14
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.12
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 98.11
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.1
3pvs_A 447 Replication-associated recombination protein A; ma 98.05
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.97
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.96
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.94
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.94
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.93
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 97.93
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 97.93
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.93
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.92
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.91
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.86
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 97.85
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 97.8
2r44_A 331 Uncharacterized protein; putative ATPase, structur 97.8
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.77
3bos_A 242 Putative DNA replication factor; P-loop containing 97.74
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.73
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.7
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.68
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.68
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 97.68
2qgz_A308 Helicase loader, putative primosome component; str 97.67
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.66
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.65
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.62
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.62
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.62
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.59
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.55
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.55
1tue_A212 Replication protein E1; helicase, replication, E1E 97.54
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.54
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.53
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 97.52
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.51
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.51
2z43_A324 DNA repair and recombination protein RADA; archaea 97.49
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 97.49
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.47
3io5_A333 Recombination and repair protein; storage dimer, i 97.46
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.45
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.44
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.44
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.37
3kb2_A 173 SPBC2 prophage-derived uncharacterized protein YOR 97.37
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.37
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 97.37
1via_A 175 Shikimate kinase; structural genomics, transferase 97.33
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.33
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 97.32
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 97.31
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.31
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 97.31
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.31
2jv2_A83 Putative uncharacterized protein PH1500; AAA ATPas 97.3
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.3
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 97.29
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.29
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.29
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 97.28
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 97.28
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.27
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.27
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.27
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.25
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.25
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.23
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 97.23
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 97.22
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.22
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 97.21
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.21
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.21
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.21
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.19
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.19
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.18
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.17
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.17
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.16
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.15
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 97.14
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.14
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.14
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.14
2vli_A 183 Antibiotic resistance protein; transferase, tunica 97.14
1e6c_A 173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.14
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.14
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.13
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.12
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.12
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.11
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.11
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.1
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 97.09
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.09
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.09
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.08
2pt5_A 168 Shikimate kinase, SK; aromatic amino acid biosynth 97.08
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.08
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 97.07
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.07
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.06
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 97.06
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 97.06
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.06
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.05
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.05
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.04
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 97.02
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 97.01
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 97.0
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.0
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 96.99
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.95
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.95
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.93
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.92
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 96.91
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.9
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.9
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.89
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.88
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 96.87
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.86
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.85
1zc1_A208 Ubiquitin fusion degradation protein 1; UFD1, doub 96.85
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.84
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 96.83
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.82
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.82
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.82
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.81
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.81
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 96.8
2r6a_A454 DNAB helicase, replicative helicase; replication, 96.78
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.78
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.78
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 96.77
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.76
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.76
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.75
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.74
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.73
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.73
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.72
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.72
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.72
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.71
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 96.71
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.7
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 96.7
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.7
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 96.67
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.67
1via_A175 Shikimate kinase; structural genomics, transferase 96.65
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.64
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.63
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.62
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.62
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.6
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.59
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.59
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.59
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.59
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 96.58
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.58
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.58
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.56
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.56
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.55
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.54
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.54
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.52
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.52
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.51
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 96.51
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.5
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.5
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.49
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.47
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.47
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.47
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.47
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.46
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 96.45
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 96.44
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.44
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.44
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.44
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.43
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 96.42
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.42
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.42
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.41
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.41
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 96.41
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.41
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.41
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.4
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.4
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 96.39
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.37
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.34
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.34
2cvh_A 220 DNA repair and recombination protein RADB; filamen 96.34
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.32
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.32
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.31
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.3
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.28
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.28
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.27
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 96.26
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 96.26
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.26
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.26
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.25
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.25
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.24
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.23
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.21
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.21
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.21
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 96.21
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.2
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.2
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.19
3b6e_A216 Interferon-induced helicase C domain-containing P; 96.18
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.17
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 96.16
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.16
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.15
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.15
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.14
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.13
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.13
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.13
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.12
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.12
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.12
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.12
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.11
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.1
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 96.1
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.09
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.08
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.07
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.06
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 96.06
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.06
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.05
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 96.01
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.99
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.97
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 95.97
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 95.95
2fna_A 357 Conserved hypothetical protein; structural genomic 95.94
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.93
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 95.9
4a74_A 231 DNA repair and recombination protein RADA; hydrola 95.9
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 95.88
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.84
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 95.84
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.83
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.82
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 95.81
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.81
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.79
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.78
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 95.77
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.77
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.75
3io5_A 333 Recombination and repair protein; storage dimer, i 95.73
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.72
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.71
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 95.7
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.68
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.68
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.64
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.62
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.62
3r20_A233 Cytidylate kinase; structural genomics, seattle st 95.62
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.61
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.61
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 95.61
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 95.59
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.57
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 95.56
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.54
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 95.53
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 95.53
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.53
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.52
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.52
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 95.52
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.51
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.5
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.49
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.49
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.47
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 95.46
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.45
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 95.44
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 95.44
2ged_A193 SR-beta, signal recognition particle receptor beta 95.43
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.42
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.39
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.38
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 95.36
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.33
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.33
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.32
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 95.3
2og2_A359 Putative signal recognition particle receptor; nuc 95.3
1u94_A 356 RECA protein, recombinase A; homologous recombinat 95.29
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 95.29
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.28
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.28
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 95.27
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.25
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 95.25
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 95.22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 95.21
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.19
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 95.18
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 95.17
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.13
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 95.08
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.08
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.08
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.04
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 95.03
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.02
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.01
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 95.0
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.0
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 94.99
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.98
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 94.97
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 94.96
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.94
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.93
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-81  Score=708.12  Aligned_cols=529  Identities=28%  Similarity=0.398  Sum_probs=450.9

Q ss_pred             eEEEeecCCcccccccEEEeChhhhcccCCCCCCceEEEEeCCc---EEEEEeeCCCCCCCceeeCHhhhhccCccCCCe
Q 007661           14 TMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDS---FVLSLASHPSVNKGQIALNSVQRRHAKVSTGDH   90 (594)
Q Consensus        14 ~l~v~~~p~~~~~~tn~a~vsp~~~~~l~~~g~~~~~v~v~g~~---~v~~~~~~~~~~~~~i~~~~~~r~~~~~~~~~~   90 (594)
                      +|.|..+.+++   .+.|++||++|.+|++.  .|++|.|+|++   .++.+.++++++.+.|+||+.+|+|+++++||.
T Consensus        25 ~~~v~~~~~~d---~~~~~~~~~~~~~l~~~--~gd~v~i~g~~~~~~~~~~~~~~~~~~~~i~~~~~~r~n~~v~~gd~   99 (806)
T 3cf2_A           25 RLIVDEAINED---NSVVSLSQPKMDELQLF--RGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDV   99 (806)
T ss_dssp             EEECBCCSSCC---TTEEEECHHHHHHTTCC--SSCEEEEECGGGCBCCEEEEECTTSBTTBCEECHHHHHTTTCCTTCE
T ss_pred             eEEEccCCCCC---CCEEEECHHHHHHcCCC--CCCEEEEEcCCCceEEEEEcCCCCCCCCEEEeCHHHHHhcCCCCCCE
Confidence            68888887665   67999999999999993  24899998753   455667788999999999999999999999999


Q ss_pred             EEEEEeCCCCcceeEeEEEE-eeeeecCCccccccHHHHHHHHHHHhc--cCcccCCcEEEEEEcCeeEEEEEEEeeecC
Q 007661           91 VSLNRFIPPEDFNLALLTVE-LEFVKKGSKNEQVDAVLLANQLRKRFI--NQVMTAGQRVVFEYHGNNYIFTVNGAAVEG  167 (594)
Q Consensus        91 v~v~~~~~~~~~~~~~~~~~-i~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~g~~~~~~~~~~~~~~~v~~~~~~~  167 (594)
                      |+|+++...  ..+..|++. ++.     ....++...+..+++..|.  +++|..|+.+.+...+..+.|+|++++|  
T Consensus       100 V~v~~~~~~--~~a~~v~l~p~~~-----~~~~~~~~~~~~~l~~~~~~~~~~v~~gd~~~v~~~~~~~~f~V~~~~P--  170 (806)
T 3cf2_A          100 ISIQPCPDV--KYGKRIHVLPIDD-----TVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDP--  170 (806)
T ss_dssp             EEEEECCCC--CBCSBEEEEEBTT-----TSTTCCSCHHHHTHHHHHTTTCCEEETTCEEEECCTTSCEEEEEEEESS--
T ss_pred             EEEEECCCC--CcCCEEEEecccc-----chhccchhHHHHHHHHHHHhcCCcccCCCEEEEecCCcEEEEEEEEEeC--
Confidence            999998522  123334432 111     1122334455666777764  4789999999998888889999999988  


Q ss_pred             ccccccccceeEcCCcEEEEEecCCCceeeecccCCccccccccCccccccCCccCcHHHHHHHHHHHHHccCCChhhhh
Q 007661          168 QEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTS  247 (594)
Q Consensus       168 ~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~igGl~~~~~~i~~~~~~~~~~~~~~~~  247 (594)
                            .+.++++++|.|.+...+...          .......|+++|+|  |||+++++++| ++++.+|+.+|++|.
T Consensus       171 ------~~~~~v~~~T~i~~~~~~~~~----------~~~~~~~~~v~~~d--IgGl~~~~~~l-~e~v~~pl~~p~~f~  231 (806)
T 3cf2_A          171 ------SPYCIVAPDTVIHCEGEPIKR----------EDEEESLNEVGYDD--IGGCRKQLAQI-KEMVELPLRHPALFK  231 (806)
T ss_dssp             ------SSEEECCTTSBCCBCSCCBCC----------CTTSCCSSSCCGGG--CCSCCTTHHHH-HHHHHHHHHCCGGGT
T ss_pred             ------CCCeEECCCcEEEEeccccCc----------ccccccCCCCChhh--hcCHHHHHHHH-HHHHHHHccCHHHHh
Confidence                  457888888888765432111          00111237899999  99999999999 999999999999999


Q ss_pred             hcCCCCCceEEEEcCCCCcHHHHHHHHHHhhCCCCcEEEecchhhhcccchhHHHHHHHHHHHHhhccccCCCCCcEEEE
Q 007661          248 KLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVII  327 (594)
Q Consensus       248 ~~g~~~~~giLL~GppGtGKT~lar~ia~~l~~~~~~~v~~~~l~~~~~g~~~~~i~~lf~~a~~~~~~~~~~~~~~Il~  327 (594)
                      ++|+++|+|||||||||||||++||++|+++ +.+++.++++++.++|.|+++.+++++|+.|+..+        |+|||
T Consensus       232 ~~g~~~p~GILL~GPPGTGKT~LAraiA~el-g~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~--------PsIIf  302 (806)
T 3cf2_A          232 AIGVKPPRGILLYGPPGTGKTLIARAVANET-GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNA--------PAIIF  302 (806)
T ss_dssp             SCCCCCCCEEEEECCTTSCHHHHHHHHHTTT-TCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSC--------SEEEE
T ss_pred             hcCCCCCCeEEEECCCCCCHHHHHHHHHHHh-CCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcC--------CeEEE
Confidence            9999999999999999999999999999998 46788999999999999999999999999999875        56999


Q ss_pred             EccchhhhccCCCCCCCCchHHHHHHHHHHhhcCccccCcEEEEEeeCCcccccHHhhCCCCccceeecCCCCHHHHHHH
Q 007661          328 FDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQI  407 (594)
Q Consensus       328 iDEid~l~~~~~~~~~~~~~~~~~v~~Ll~~ld~~~~~~~v~vI~~tn~~~~ld~al~r~gRf~~~i~i~~P~~~~r~~I  407 (594)
                      |||||+|+++++...+  +..++++++|+..||++....+|+|||+||+++.||++|+|+|||+++|++++||.++|.+|
T Consensus       303 IDEiDal~~~r~~~~~--~~~~riv~~LL~~mdg~~~~~~V~VIaaTN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~~I  380 (806)
T 3cf2_A          303 IDELDAIAPKREKTHG--EVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEI  380 (806)
T ss_dssp             EESGGGTCCTTTTCCC--TTHHHHHHHHHTHHHHCCGGGCEEEEEECSSTTTSCTTTTSTTSSCEEEECCCCCHHHHHHH
T ss_pred             EehhcccccccCCCCC--hHHHHHHHHHHHHHhcccccCCEEEEEecCChhhcCHHHhCCcccceEEecCCCCHHHHHHH
Confidence            9999999999876543  56789999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhccccCCCCCCcccHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhccCcccCCCCc----ccchhhcchhHHHHHH
Q 007661          408 LQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPV----DEESIKVTMDDFLHAL  483 (594)
Q Consensus       408 L~~~~~~~~~~~~l~~~~~l~~la~~t~g~sg~dl~~l~~~A~~~a~~r~~~~~~~~~~~----~~~~~~vt~~df~~al  483 (594)
                      |+.|++++.    +..++|+..||..|+||+|+||.++|++|.+.|++|.....+.....    ..+...++++||..|+
T Consensus       381 L~~~l~~~~----~~~dvdl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al  456 (806)
T 3cf2_A          381 LQIHTKNMK----LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWAL  456 (806)
T ss_dssp             HHHTCSSSE----ECTTCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHH
T ss_pred             HHHHhcCCC----CCcccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHH
Confidence            999998887    66889999999999999999999999999999998876543332211    2245679999999999


Q ss_pred             HhcccCCCc----CCccccccccCcceeccchhhHHHHHHHHHHHHHHhcCCCcceEEEeecCCCCchHHHHHHHHhhcC
Q 007661          484 YEIVPAFGA----STDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSD  559 (594)
Q Consensus       484 ~~~~ps~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~gvLL~GPpG~GKT~lAkalA~~~~  559 (594)
                      ..+.|++..    ..+.+.|..++|+.+.+..+.+.+.++..+++.+.+.+.+|+.|+|||||||||||++|+++|++++
T Consensus       457 ~~~~ps~~r~~~~~~p~v~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~  536 (806)
T 3cf2_A          457 SQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQ  536 (806)
T ss_dssp             SSSSCCCCCCCCCBCCCCCSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTT
T ss_pred             HhCCCcccccccccCCCCCHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhC
Confidence            999998643    3567889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEEeccccc---cccccchhhhHHHHHHHhhhcCC
Q 007661          560 FPFVKIISAESM---IGLHESTKCAQIVKVSECQFSGS  594 (594)
Q Consensus       560 ~~fi~v~~~e~~---vG~sE~~~~~~ir~~F~~A~~~~  594 (594)
                      +||+++++|+++   +|+||++    ||++|+.||+++
T Consensus       537 ~~f~~v~~~~l~s~~vGese~~----vr~lF~~Ar~~~  570 (806)
T 3cf2_A          537 ANFISIKGPELLTMWFGESEAN----VREIFDKARQAA  570 (806)
T ss_dssp             CEEEECCHHHHHTTTCSSCHHH----HHHHHHHHHTTC
T ss_pred             CceEEeccchhhccccchHHHH----HHHHHHHHHHcC
Confidence            999999999994   9999998    999999999753
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1qcs_A N-ethylmaleimide sensitive factor (NSF-N); double-PSI beta barrel alpha beta roll, fusion protein; 1.90A {Cricetulus griseus} SCOP: b.52.2.3 d.31.1.1 PDB: 1qdn_A Back     alignment and structure
>1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 594
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-69
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-66
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 7e-52
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 8e-43
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 2e-39
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-27
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-26
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-26
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-15
d1qcsa186 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF- 7e-19
d1cr5a182 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NS 8e-18
d1cr5a2103 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, N 1e-16
d1qcsa2116 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NS 1e-16
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-15
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 2e-14
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 3e-13
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-07
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-06
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-06
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 1e-04
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-04
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 4e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 4e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 0.002
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  223 bits (570), Expect = 1e-69
 Identities = 85/246 (34%), Positives = 126/246 (51%), Gaps = 27/246 (10%)

Query: 243 PHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKN 302
           P    KLG K  KG+L+ GPPGTGKTL+A+ I      +    ++G + +  FVG     
Sbjct: 34  PSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEA-KVPFFTISGSDFVEMFVGVGASR 92

Query: 303 IRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDG-TGVHDSIVNQLLTKIDG 361
           +RD+F  A+             +I  DEIDA+ + RG+   G     +  +NQ+L ++DG
Sbjct: 93  VRDMFEQAKKAAPC--------IIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDG 144

Query: 362 VESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFL 421
            E    +++I  TNR D+LD ALLRPGR + QV + LPD  GR QIL++H  ++     L
Sbjct: 145 FEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVP----L 200

Query: 422 APDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLH 481
           APD++   +A  T  +SGA+L  +   A  FA                    V+M +F  
Sbjct: 201 APDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKR-------------VVSMVEFEK 247

Query: 482 ALYEIV 487
           A  +I+
Sbjct: 248 AKDKIM 253
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 86 Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Length = 82 Back     information, alignment and structure
>d1cr5a2 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Length = 103 Back     information, alignment and structure
>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 116 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query594
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.94
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.91
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.85
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.81
d1cr5a182 N-terminal domain of NSF-N, NSF-Nn {Baker's yeast 99.77
d1qcsa186 N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice 99.75
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.75
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.69
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.68
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.67
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.64
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.61
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.6
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.6
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.59
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.59
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.58
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.58
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.55
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.55
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.54
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.53
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.52
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.51
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.51
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.34
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.32
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.31
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.27
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.27
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.22
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 99.22
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 99.19
d1qcsa2116 C-terminal domain of NSF-N, NSF-Nc {Hamster (Crice 99.13
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.12
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.08
d1cr5a2103 C-terminal domain of NSF-N, NSF-Nc {Baker's yeast 99.02
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.97
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.93
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.91
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 98.84
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 98.83
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.76
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 98.73
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.73
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 98.65
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 98.6
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 98.58
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.4
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.13
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.1
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.08
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 98.06
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.02
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.98
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.94
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.93
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.83
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.81
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.81
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.79
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 97.77
d1e6ca_ 170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.75
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.75
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.75
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.74
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.71
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.7
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.69
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.66
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.66
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.64
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.64
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.64
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.64
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.61
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.6
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.6
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.6
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.6
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.6
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.59
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.56
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.56
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.55
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.54
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.53
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.51
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.49
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.49
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.48
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.43
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.43
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.41
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.41
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.41
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.4
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.39
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.37
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.36
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.33
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.33
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 97.32
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.31
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.3
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.28
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.28
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.27
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.26
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.25
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.25
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.23
d2qy9a2211 GTPase domain of the signal recognition particle r 97.21
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.19
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 97.18
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.16
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.15
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.13
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.13
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.13
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.1
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.09
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.07
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.07
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.05
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.03
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.02
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.02
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.01
d1okkd2207 GTPase domain of the signal recognition particle r 97.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.0
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.0
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 97.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.99
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.98
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.98
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 96.97
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.97
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.97
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.96
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.93
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.89
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.86
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.85
d1vmaa2213 GTPase domain of the signal recognition particle r 96.82
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.81
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.8
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.8
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.79
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.78
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.77
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.74
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.74
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.73
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.72
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.71
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.7
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.69
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.67
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.62
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.61
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.61
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.55
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.52
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.48
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.48
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.46
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.44
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.44
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.43
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.42
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.39
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.39
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.38
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 96.35
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.33
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 96.27
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.25
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.21
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.18
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.15
d2qy9a2 211 GTPase domain of the signal recognition particle r 96.14
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 96.14
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 96.1
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.1
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.09
d1okkd2 207 GTPase domain of the signal recognition particle r 96.09
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.05
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.04
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.02
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.97
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.97
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.94
d1vmaa2 213 GTPase domain of the signal recognition particle r 95.91
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.9
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.87
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.84
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.66
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.62
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.61
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 95.6
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.58
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.51
d1ls1a2 207 GTPase domain of the signal sequence recognition p 95.31
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.3
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.27
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 95.21
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.2
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.14
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.08
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.06
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.03
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.0
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.97
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.73
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.61
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.6
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.57
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.55
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.55
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.52
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.43
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 94.34
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.28
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.26
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 94.22
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.19
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.08
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.06
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.04
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.03
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.02
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.0
d2awna2 232 Maltose transport protein MalK, N-terminal domain 93.99
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 93.98
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.98
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 93.96
d1g2912 240 Maltose transport protein MalK, N-terminal domain 93.94
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.69
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 93.65
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 93.62
d2a5ja1 173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.58
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.58
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.58
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.58
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.57
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 93.57
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.56
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 93.52
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.52
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 93.49
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.43
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.42
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.4
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.36
d2qtvb1 166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.35
d2fh5b1 207 Signal recognition particle receptor beta-subunit 93.32
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 93.28
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.27
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.26
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.22
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.22
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.2
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.17
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.09
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.08
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.04
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 93.02
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 92.97
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.95
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 92.91
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.89
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 92.88
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.87
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.86
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.85
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.84
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.8
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 92.79
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.76
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.76
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.73
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.73
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 92.67
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.64
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 92.63
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.53
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.51
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.45
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.44
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.42
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 92.41
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.37
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.35
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.35
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.19
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.18
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.18
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.17
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.15
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.14
d2atva1 168 Ras-like estrogen-regulated growth inhibitor, RERG 92.13
d1mkya1 171 Probable GTPase Der, N-terminal and middle domains 92.11
d2f9la1 175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.11
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.11
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.1
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.08
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.02
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.99
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.99
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.99
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 91.95
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.94
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.91
d1g16a_ 166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.8
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.78
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.75
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.73
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.69
d1ky3a_ 175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.68
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.68
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.66
d2erxa1 171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.65
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 91.64
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.61
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 91.61
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 91.6
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.6
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.6
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.56
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.52
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.5
d1yzqa1 164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.48
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.48
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 91.47
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.42
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 91.42
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.41
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.37
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.32
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 91.26
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.24
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.19
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.19
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.16
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 91.13
d2gjsa1 168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.09
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.06
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.05
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.03
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.01
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.01
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 91.0
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 90.97
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.93
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.93
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.92
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 90.92
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.92
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 90.89
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.85
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.8
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 90.79
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.79
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.75
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.69
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 90.62
d2g3ya1 172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.57
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.56
d1ek0a_ 170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.55
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 90.54
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.54
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.53
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.51
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.49
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.46
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.41
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.41
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 90.4
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 90.37
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.35
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.33
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.32
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.31
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.31
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.29
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.28
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.27
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.25
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 90.2
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.17
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.15
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.13
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 90.11
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.07
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.97
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.95
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.92
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.92
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 89.8
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.64
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 89.51
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 89.51
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.51
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 89.46
d1i2ma_ 170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.46
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.45
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.41
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 89.32
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.28
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.23
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.22
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.16
d1wf3a1 178 GTPase Era, N-terminal domain {Thermus thermophilu 89.16
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 89.09
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.08
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.91
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.86
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.83
d1xpua3 289 Transcription termination factor Rho, ATPase domai 88.79
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 88.74
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.73
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 88.68
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.64
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.6
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.59
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 88.39
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.34
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.21
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.05
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.9
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.8
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 87.74
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.54
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.35
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.29
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.26
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 87.16
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 87.06
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 86.75
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.7
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 86.61
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 86.48
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.34
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 86.21
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.14
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 86.11
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 85.96
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.84
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 85.81
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 85.71
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.64
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.64
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.56
d2iv2x1151 Formate dehydrogenase H {Escherichia coli [TaxId: 85.47
d1g8ka1143 Arsenite oxidase large subunit {Alcaligenes faecal 85.42
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.35
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.3
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 85.29
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 85.27
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 85.24
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 85.19
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.16
d2jioa1123 Periplasmic nitrate reductase alpha chain, NapA {D 85.01
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 84.93
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 84.84
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 84.68
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 84.67
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 84.61
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 84.52
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 84.45
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 84.07
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 83.78
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.36
d2fug3182 NADH-quinone oxidoreductase chain 3, Nqo3, C-termi 83.35
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.72
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.59
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 82.29
d1eu1a1155 Dimethylsulfoxide reductase (DMSO reductase) {Rhod 82.17
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 81.86
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 81.26
d1tmoa1167 Trimethylamine N-oxide reductase {Shewanella massi 81.15
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.11
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 80.99
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 80.98
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=6.4e-44  Score=353.07  Aligned_cols=245  Identities=35%  Similarity=0.570  Sum_probs=217.6

Q ss_pred             CccccccCCccCcHHHHHHHHHHHHHccCCChhhhhhcCCCCCceEEEEcCCCCcHHHHHHHHHHhhCCCCcEEEecchh
Q 007661          212 KEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEV  291 (594)
Q Consensus       212 ~~~~~~~~~igGl~~~~~~i~~~~~~~~~~~~~~~~~~g~~~~~giLL~GppGtGKT~lar~ia~~l~~~~~~~v~~~~l  291 (594)
                      +.++|+|  |||+++++++| ++.+.. +.+|+.+.++|.+.|+++|||||||||||++|+++|+++ +.+++.++++++
T Consensus         7 ~~~t~~D--i~Gl~~~k~~l-~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~-~~~~~~i~~~~l   81 (256)
T d1lv7a_           7 IKTTFAD--VAGCDEAKEEV-AELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEA-KVPFFTISGSDF   81 (256)
T ss_dssp             SCCCGGG--SCSCHHHHHHT-HHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHH-TCCEEEECSCSS
T ss_pred             CCCCHHH--HhchHHHHHHH-HHHHHH-HHCHHHHHHcCCCCCCeEEeeCCCCCCccHHHHHHHHHc-CCCEEEEEhHHh
Confidence            7889999  99999999999 777754 788999999999999999999999999999999999998 578899999999


Q ss_pred             hhcccchhHHHHHHHHHHHHhhccccCCCCCcEEEEEccchhhhccCCCCCC-CCchHHHHHHHHHHhhcCccccCcEEE
Q 007661          292 LSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRD-GTGVHDSIVNQLLTKIDGVESLNNVLL  370 (594)
Q Consensus       292 ~~~~~g~~~~~i~~lf~~a~~~~~~~~~~~~~~Il~iDEid~l~~~~~~~~~-~~~~~~~~v~~Ll~~ld~~~~~~~v~v  370 (594)
                      .++|+|+++.+++++|+.|+...        ||||||||+|.++++++.... ......+++++|+..||++....+++|
T Consensus        82 ~~~~~g~~~~~l~~~f~~A~~~~--------P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~v  153 (256)
T d1lv7a_          82 VEMFVGVGASRVRDMFEQAKKAA--------PCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIV  153 (256)
T ss_dssp             TTSCCCCCHHHHHHHHHHHHTTC--------SEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEE
T ss_pred             hhcchhHHHHHHHHHHHHHHHcC--------CEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEE
Confidence            99999999999999999998875        569999999999988765433 334566789999999999988889999


Q ss_pred             EEeeCCcccccHHhhCCCCccceeecCCCCHHHHHHHHHHHHhccccCCCCCCcccHHHHHHHcCCCCHHHHHHHHHHHH
Q 007661          371 IGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAV  450 (594)
Q Consensus       371 I~~tn~~~~ld~al~r~gRf~~~i~i~~P~~~~r~~IL~~~~~~~~~~~~l~~~~~l~~la~~t~g~sg~dl~~l~~~A~  450 (594)
                      |||||+|+.||++++|+|||+.+|+|++|+.++|.+||+.+++++.    +..++++..+++.|.||+++||.++|++|.
T Consensus       154 IatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~----~~~~~~~~~la~~t~G~s~adi~~l~~~A~  229 (256)
T d1lv7a_         154 IAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVP----LAPDIDAAIIARGTPGFSGADLANLVNEAA  229 (256)
T ss_dssp             EEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSC----BCTTCCHHHHHHTCTTCCHHHHHHHHHHHH
T ss_pred             EEeCCCcccCCHhHcCCCCCCEEEECCCcCHHHHHHHHHHhccCCC----cCcccCHHHHHHhCCCCCHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999998876    567899999999999999999999999999


Q ss_pred             HHHHHhccCcccCCCCcccchhhcchhHHHHHHHhc
Q 007661          451 SFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEI  486 (594)
Q Consensus       451 ~~a~~r~~~~~~~~~~~~~~~~~vt~~df~~al~~~  486 (594)
                      ..|.++             ....++.+||.+|++++
T Consensus       230 ~~a~~~-------------~~~~i~~~d~~~Al~rv  252 (256)
T d1lv7a_         230 LFAARG-------------NKRVVSMVEFEKAKDKI  252 (256)
T ss_dssp             HHHHHT-------------TCSSBCHHHHHHHHHHH
T ss_pred             HHHHHc-------------CCCccCHHHHHHHHHHH
Confidence            888764             23468999999999886
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr5a2 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jioa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmoa1 b.52.2.2 (A:632-798) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure