Citrus Sinensis ID: 007677


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590---
MSESTSLSKQLKEDKRKESDEQLPAETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKAGETKTTKHQWKSKLFNGSNLAIPLTSSCSTNV
cccccHHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccHHHHHcHHccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHcccHHcccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHccccccccccHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHccccccHHHHHHHcccHHHHHHHcccccHHHHHHHHHccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHccccccHcccccccHHHHHHHcccHHHHHHHHHcccccccHccccccccHEHEHccccHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccEEcccccccccHHHHHHHcccHHHHHHHHcHHHHHHHHHccHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEcccHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccHHHccccccccEEcccccccccc
MSESTSLSKQLKEdkrkesdeqlpaETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMkgnegiatlpdndgmlPIVRAASLGRTEVVEFLYRETknslkdddCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKnlgdkdrkNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYpdlmwkadkkdnyTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHlagelapqhrlnvvsgSALQMQRELLWFKAvkdvvppklrdaknnkgltpkalFSKEHEELKRNgetwmkdtASSCMIVATLIATIVFAAaitvpggnkedtglpffrqkasfKIFAVSNVISLVASSVSIVNFLSivapryaeeDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRStyashypipkgktglfhkagetkttkhqwksklfngsnlaipltsscstnv
msestslskqlkedkrkesdeqlpaetitRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEgiatlpdndgmLPIVRAASLGRTEVVEFLYRetknslkdddCIELLVQLIETGLYAVALQLLHDHRYLATkraknketalhvlarknlgdkdrknKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKdvvppklrdaknnkgltpkalfskeHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYAShypipkgktglfhKAGETKTTKhqwksklfngsnlaipltsscstnv
MSESTSLSKQLKEDKRKESDEQLPAETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMivatliativfaaaitvPGGNKEDTGLPFFRQKASFKIFavsnvislvassvsivnFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKAGETKTTKHQWKSKLFNGSNLAIPLTSSCSTNV
***************************ITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLA***************TLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVP******************************TWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKAGE****KHQWKSKLFNG**L************
***************************ITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPK********************TASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHY***************************FNGSNLAIPLTSSCS***
*********************QLPAETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKAGETKTTKHQWKSKLFNGSNLAIPL********
********KQLKEDKRK*SDEQLPA**ITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKA***************NGSNLA*P*T*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSESTSLSKQLKEDKRKESDEQLPAETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASHYPIPKGKTGLFHKAGETKTTKHQWKSKLFNGSNLAIPLTSSCSTNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query593 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.715 0.718 0.261 2e-18
Q502K3 1071 Serine/threonine-protein no no 0.419 0.232 0.252 2e-06
Q6AWW5524 Ankyrin repeat-containing no no 0.743 0.841 0.216 3e-06
Q9ZU96532 Ankyrin repeat-containing no no 0.473 0.528 0.233 2e-05
Q4UMH61179 Putative ankyrin repeat p yes no 0.490 0.246 0.233 3e-05
Q5U312 978 Ankycorbin OS=Rattus norv yes no 0.155 0.094 0.35 5e-05
P17221656 Sex-determining protein f no no 0.232 0.210 0.298 6e-05
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes no 0.433 0.065 0.235 0.0001
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.364 0.049 0.256 0.0001
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes no 0.364 0.110 0.252 0.0002
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 215/528 (40%), Gaps = 104/528 (19%)

Query: 33  KLYRAALNGDWA----VAKDIYDKYEG------------EIGVEITNH----GKTALHVA 72
           +L+ AA  GD A    + KDI  + EG            EI   I N     G+TAL  A
Sbjct: 77  ELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRASIVNEVNELGETALFTA 136

Query: 73  AEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDN 132
           A+   +D VK+LLK  S E +AK+N+ G   +  A       +V+  +  +  ++     
Sbjct: 137 ADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEVLLDHDATLSQTFGP 196

Query: 133 DGMLPIVRAASLGRTEVVEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYL 192
               P+V AA  G TEVV  L  +  N                                L
Sbjct: 197 SNATPLVSAAMRGHTEVVNQLLSKAGN-------------------------------LL 225

Query: 193 ATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVI--LLSK--QEIWELIEQP 248
              R+ NK  ALH+ AR+                     EVI  LLSK  Q    + ++ 
Sbjct: 226 EISRSNNK-NALHLAARQG------------------HVEVIKALLSKDPQLARRIDKKG 266

Query: 249 RELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPI 308
           +  +H A    + + + +L+   P ++ + DK  N T  H+A + +  ++ + +  + P 
Sbjct: 267 QTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCN-TALHVATRKKRAEIVELLLSL-PD 324

Query: 309 ADLMVDCTDEKGNNILHLAGELAPQH----------RLNVVSGSALQMQRELL--WFKAV 356
            +      D K    L +A  L              R   +  + L   R+ L      +
Sbjct: 325 TNANTLTRDHK--TALDIAEGLPLSEESSYIKECLARSGALRANELNQPRDELRSTVTQI 382

Query: 357 KDVVPPKLRDAK-NNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAA 415
           K+ V  +L   K  NK +      SKE  +L R G   + +  +S  +VA L AT+ FAA
Sbjct: 383 KNDVHIQLEQTKRTNKNVHN---ISKELRKLHREG---INNATNSVTVVAVLFATVAFAA 436

Query: 416 AITVPGGNKEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRL 475
             TVPGG+  D G      +ASFKIF + N ++L  S   +V  +++V      E  +  
Sbjct: 437 IFTVPGGDNND-GSAVVVGRASFKIFFIFNALALFTSLAVVVVQITLVRGETKAEKRVVE 495

Query: 476 LPTKLLVGFATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSM 523
           +  KL      +++A     V F A+SYIV    + W A L TV+  +
Sbjct: 496 VINKL------MWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGV 537





Arabidopsis thaliana (taxid: 3702)
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=2 SV=2 Back     alignment and function description
>sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
224120488610 predicted protein [Populus trichocarpa] 0.893 0.868 0.457 1e-129
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.863 0.648 0.435 1e-120
225425076563 PREDICTED: ankyrin repeat-containing pro 0.853 0.898 0.442 1e-119
359473665602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.910 0.897 0.434 1e-118
359483665 762 PREDICTED: ankyrin repeat-containing pro 0.863 0.671 0.424 1e-118
297737987 1855 unnamed protein product [Vitis vinifera] 0.853 0.272 0.440 1e-117
224136692 743 predicted protein [Populus trichocarpa] 0.873 0.697 0.424 1e-116
449454911650 PREDICTED: ankyrin repeat-containing pro 0.897 0.818 0.423 1e-113
449454921 1316 PREDICTED: uncharacterized protein LOC10 0.919 0.414 0.387 1e-110
449515682642 PREDICTED: uncharacterized LOC101218503 0.919 0.848 0.389 1e-110
>gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 255/557 (45%), Positives = 346/557 (62%), Gaps = 27/557 (4%)

Query: 30  RRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMS 89
           R L+LY+AAL+GDW  A+ IY    GE+   IT  G+TALH+AA A    FVK+L+  MS
Sbjct: 48  RHLQLYQAALSGDWDTAEGIYKLCPGEVNARITKRGETALHIAAAAEHTHFVKQLVGMMS 107

Query: 90  AEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEV 149
            E LA ++  G TA  +A  S    L K  M     +A       +LPI  A  LG   +
Sbjct: 108 IEALAYRSSAGNTAFCFAAISGVEALAKVMMDKKPDLAMTRGRGNLLPIYMATLLGHRGM 167

Query: 150 VEFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLAR 209
           V +LY ETK  L D D I+LLV LI + +Y VA ++L +HR LA  R +++ TALH  ++
Sbjct: 168 VSYLYDETKEQLTDGDRIKLLVALINSDIYDVAWKMLKEHRGLAYARDEHQLTALHAFSQ 227

Query: 210 K-----NLGD--------------------KDRKNKEAETLVESLWEEVILLSKQEIWEL 244
           K     N+ D                    K   +K+A  L++ LWE+V+LL    I   
Sbjct: 228 KSCMPSNVVDQSPPGFWNKCLNPCFKLAQMKKLMHKQALDLIQYLWEQVVLLDDSTISSQ 287

Query: 245 IEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYD 304
           I +P  LI  AA+RGN+  L+ILIR YP+L++K D+ + Y+IFHIA+ NR ED+ K IY 
Sbjct: 288 IGKPWPLIFTAAERGNLDLLTILIRLYPELIFKVDQ-NTYSIFHIAILNRHEDILKMIYQ 346

Query: 305 IKPIADLMVDCTDEKGNNILHLAGE-LAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPK 363
           I  I ++M    D +GNN+LHLA + L    RLN + G+ALQ+QRELLWF+ VK VV P+
Sbjct: 347 IGSIKNVMTIYKDREGNNMLHLAAKVLESPSRLNAIPGAALQLQRELLWFEEVKKVVQPR 406

Query: 364 LRDAKNNKGLTPKALFSKEHEELKRNGETWMKDTASSCMIVATLIATIVFAAAITVPGGN 423
             + KN  G TP ALF ++H +L + GE WM+DTA SCM+VATLIAT+VFAAA TVPGGN
Sbjct: 407 HIEEKNFHGKTPGALFIEQHRDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGN 466

Query: 424 KEDTGLPFFRQKASFKIFAVSNVISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVG 483
            +D G P F ++ +FK FA+S+ ISLV S+ S++ FLS    RYAE++FL  LP +L++G
Sbjct: 467 FQDKGTPVFLKEIAFKFFAISDAISLVTSASSLLTFLSTRTSRYAEQNFLWSLPNRLIIG 526

Query: 484 FATLFVAIAAMMVVFSATSYIVFEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRST 543
             TLF++I AMMV F AT ++VF +  L  +I   V++S+PVI F+ QHFR F D++ ST
Sbjct: 527 LTTLFISIGAMMVAFMATFFLVFGNKLLPYSIPIAVVASLPVIFFIWQHFRLFVDMIHST 586

Query: 544 YASHYPIPKGKTGLFHK 560
           Y S       K+ LF K
Sbjct: 587 YTSRSLFKPNKSPLFSK 603




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483665|ref|XP_003632996.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454911|ref|XP_004145197.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis sativus] gi|449472070|ref|XP_004153487.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454921|ref|XP_004145202.1| PREDICTED: uncharacterized protein LOC101216177 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515682|ref|XP_004164877.1| PREDICTED: uncharacterized LOC101218503 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.876 0.905 0.329 2.3e-71
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.566 0.968 0.399 9.7e-64
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.532 0.505 0.341 1.3e-57
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.541 0.479 0.329 2e-57
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.559 0.550 0.287 2.1e-42
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.300 0.631 0.308 4.6e-17
RGD|620156 843 Ank2 "ankyrin 2, neuronal" [Ra 0.401 0.282 0.285 2.6e-09
ZFIN|ZDB-GENE-060526-136586 ankdd1b "ankyrin repeat and de 0.475 0.481 0.232 3.2e-09
UNIPROTKB|J9NTH2 2063 ANK2 "Uncharacterized protein" 0.401 0.115 0.285 7.8e-09
UNIPROTKB|F1M5N3 3838 Ank2 "Protein Ank2" [Rattus no 0.401 0.062 0.285 1.5e-08
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 722 (259.2 bits), Expect = 2.3e-71, P = 2.3e-71
 Identities = 181/550 (32%), Positives = 281/550 (51%)

Query:    21 EQLPAETITR---RLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANR 77
             E   +E +T+   R  +Y+A L GDW  A  +  + E  +  +IT + + ALH+A  A  
Sbjct:    38 EDHTSEDVTKPHSRNLMYKAVLTGDWKTASTLISRKECNVVEQITGNSEIALHIAVAAKH 97

Query:    78 IDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLP 137
              DFV+ LL+ M   DL+ +NK G T + +A A   +E  +  +     +  + +   M P
Sbjct:    98 KDFVRNLLREMDPPDLSLKNKDGNTPLSFAAALGDIETAEMLINMIRDLPDISNEKTMTP 157

Query:   138 IVRAASLGRTEVVEFLYRETK-NSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKR 196
             I  AA  G  E+V++L+ +T    L D   + L   +I   +Y V   +      L    
Sbjct:   158 IHIAALYGHGEMVQYLFSKTSIKDLNDQQYLNLFHTMISADIYGVFADV--PLWMLERVD 215

Query:   197 AKNKETALHVLARKNLGDKDRKNKEAETLVE-SLWEEVILLSKQEIWELIEQPRELIHDA 255
                KE AL+  + K L    RK        + +L+++V        W        L+ DA
Sbjct:   216 LYRKELALYPNSNKALHLLARKTSAISHKSQLNLFQQVA-----SSW--------LLFDA 262

Query:   256 ADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDC 315
             A+ GNV+ L ILIR + DL+W  D  +N T+FH+A   R E++F  IY++  I DL+   
Sbjct:   263 AELGNVEILVILIRSHLDLLWIVDN-NNRTLFHVAALYRHENIFSLIYELGGIKDLIASY 321

Query:   316 TDEKGNN-ILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLT 374
              +++  + +LHL   L P +R  V SG+AL MQ+ELLWFKAVK++VP    + KN KG  
Sbjct:   322 KEKQSKDTLLHLVARLPPMNRQQVGSGAALHMQKELLWFKAVKEIVPRSYIETKNTKGEL 381

Query:   375 PKALFSKEHEELKRNGETWMKDTASSCMXXXXXXXXXXXXXXXXXPGGN-----KEDT-G 428
                +F+++HE L++ GE WMK+TA++CM                 PGGN     K +T G
Sbjct:   382 AHDIFTEQHENLRKEGERWMKETATACMLGATLIATVVFAAAITIPGGNDDSGDKANTLG 441

Query:   429 LPFFRQKASFKIFXXXXXXXXXXXXXXXXXFLSIVAPRYAEEDFLRLLPTKLLVGFATLF 488
              P FR++  F IF                 FLSI   RYAEEDF   LPTKL+ G + LF
Sbjct:   442 FPNFRKRLLFDIFTLSDSVALFSSMMSIVIFLSIFTSRYAEEDFRYDLPTKLMFGLSALF 501

Query:   489 VAIAAMMVVFSATSYIV-FEDGSLWIAILATVISSMPVILFVKQHFRFFYDVLRSTYASH 547
             ++I +M++ F+ +  ++  E  SL + +L + ++S+  + F   +F  +++ LRS Y S 
Sbjct:   502 ISIISMILAFTFSMILIRVEKASLSL-VLISCLASLTALTFAYLYFHLWFNTLRSVYISM 560

Query:   548 YPIPKGKTGL 557
             +     K G+
Sbjct:   561 FLFLGRKRGI 570




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060526-136 ankdd1b "ankyrin repeat and death domain containing 1B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTH2 ANK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5N3 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01520066
hypothetical protein (610 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-29
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.003
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.003
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score =  112 bits (283), Expect = 1e-29
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 13/119 (10%)

Query: 393 WMKDTASSCMIVATLIATIVFAAAITVPGGNKEDT-----GLPFFR-QKASFKIFAVSNV 446
           W++ T +S ++VATLIAT+ FAA  T PGG  +D      G P    +   FK F VSN 
Sbjct: 3   WLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVSNT 62

Query: 447 ISLVASSVSIVNFLSIVAPRYAEEDFLRLLPTKLLVGFATLFVAIAAMMVVFSATSYIV 505
           I+ VAS V+++  L IV        F R LP +LL     L++++ ++MV F+A SY V
Sbjct: 63  IAFVASLVAVILLLYIV------PSFSRRLP-RLLALLTLLWLSLLSLMVAFAAGSYRV 114


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 593
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PF13962113 PGG: Domain of unknown function 99.91
PHA02795437 ankyrin-like protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.87
PHA02741169 hypothetical protein; Provisional 99.85
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
KOG0514452 consensus Ankyrin repeat protein [General function 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.82
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
PHA02741169 hypothetical protein; Provisional 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.74
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.72
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.72
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.64
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.63
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.62
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.48
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.47
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.46
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.4
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.37
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.33
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.31
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.31
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.3
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.24
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.99
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.8
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.74
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.6
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.58
KOG0522560 consensus Ankyrin repeat protein [General function 98.57
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.57
KOG0522560 consensus Ankyrin repeat protein [General function 98.53
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.5
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.49
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.46
PF1360630 Ank_3: Ankyrin repeat 98.46
PF1360630 Ank_3: Ankyrin repeat 98.46
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.41
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.38
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.37
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.29
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.19
KOG0520975 consensus Uncharacterized conserved protein, conta 98.09
KOG2384223 consensus Major histocompatibility complex protein 97.9
KOG0511516 consensus Ankyrin repeat protein [General function 97.88
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.88
KOG0520975 consensus Uncharacterized conserved protein, conta 97.8
KOG0511516 consensus Ankyrin repeat protein [General function 97.73
KOG2384223 consensus Major histocompatibility complex protein 97.7
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.64
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.2
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.82
KOG2505591 consensus Ankyrin repeat protein [General function 95.36
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.96
KOG2505591 consensus Ankyrin repeat protein [General function 94.86
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.26
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 93.82
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.73
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.71
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.16
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 89.21
PLN032181060 maturation of RBCL 1; Provisional 85.45
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.89
PLN032181060 maturation of RBCL 1; Provisional 81.23
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=5.2e-45  Score=375.11  Aligned_cols=310  Identities=20%  Similarity=0.241  Sum_probs=277.6

Q ss_pred             ccccccchHhHHHHHcCCHHHHHHHHhhCccccccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCchhhhchhcCCChHH
Q 007677           25 AETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAV  104 (593)
Q Consensus        25 ~~~~~~~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~T~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~d~~g~TpL  104 (593)
                      +.|..|.+|||.|+....++.++.|++. |++...+ |..+.+|+|+|+..|+.+..+.|+++  ++++|..|..|.|||
T Consensus        83 a~D~~~n~~l~~a~~~~~~~~i~~Lls~-gad~~~~-n~~~~aplh~A~~~~~~s~L~~Ll~~--~~dvnl~de~~~TpL  158 (929)
T KOG0510|consen   83 AKDSADNTPLHAAVEYNQGDKIQVLLSY-GADTPLR-NLNKNAPLHLAADSGNYSCLKLLLDY--GADVNLEDENGFTPL  158 (929)
T ss_pred             hhhcccCchhHHHhhcchHHHHHHHHhc-CCCCChh-hhhccCchhhccccchHHHHHHHHHh--cCCccccccCCCchh
Confidence            6688899999999999999999999997 8888887 99999999999999999999999999  899999999999999


Q ss_pred             HHHHHcCCHHHHHHHHhcCCCCCccCCCCCCCHHHHHHHcCCHHHHHHHHHhc-----c-cccCCcchhHHHHHHHHcCC
Q 007677          105 FYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRET-----K-NSLKDDDCIELLVQLIETGL  178 (593)
Q Consensus       105 h~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~-----~-~~~~~~~g~t~L~~A~~~~~  178 (593)
                      |+||..++.|..+.|++.|++. ...|.+|.+|+|.|++.|..|+.+..+.+.     . .+..++++.+|||.|+..|+
T Consensus       159 h~A~~~~~~E~~k~Li~~~a~~-~K~~~~~~~~iH~aa~s~s~e~mEi~l~~~g~~r~~~in~~~n~~~~pLhlAve~g~  237 (929)
T KOG0510|consen  159 HLAARKNKVEAKKELINKGADP-CKSDIDGNFPIHEAARSGSKECMEIFLPEHGYERQTHINFDNNEKATPLHLAVEGGD  237 (929)
T ss_pred             hHHHhcChHHHHHHHHhcCCCC-CcccCcCCchHHHHHHhcchhhhhhhhccccchhhcccccccCCCCcchhhhhhcCC
Confidence            9999999999889999999996 889999999999999999999999999832     2 67789999999999999999


Q ss_pred             HHHHHHHHHhcc--------------hhhhccccCCccHHHHHHhcCCCcccccchhHHHHHHHHHHHHHhcChHHHHHH
Q 007677          179 YAVALQLLHDHR--------------YLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWEL  244 (593)
Q Consensus       179 ~~~v~~Ll~~~~--------------~~~~~~d~~g~t~Lh~a~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~~~~~~~~  244 (593)
                      .++++..|+...              .+++..|.+|.||||+|++.|+          .+.++.|+..|++++.++    
T Consensus       238 ~e~lk~~L~n~~~~a~~~~~~~~q~kelv~~~d~dg~tpLH~a~r~G~----------~~svd~Ll~~Ga~I~~kn----  303 (929)
T KOG0510|consen  238 IEMLKMCLQNGKKIADVQLDAMQQEKELVNDEDNDGCTPLHYAARQGG----------PESVDNLLGFGASINSKN----  303 (929)
T ss_pred             HHHHHHHHhCccccchhhhHHHHHHHHHhhcccccCCchHHHHHHcCC----------hhHHHHHHHcCCcccccC----
Confidence            999999998732              3455678999999999999999          999999999999998766    


Q ss_pred             hhcchhHHHHHHHcCcHHHHHHHHH-HCCCccccccCCCCchHHHHHHHcCchhHHHHHhcccCccccccc--cccCCCC
Q 007677          245 IEQPRELIHDAADRGNVQFLSILIR-EYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVD--CTDEKGN  321 (593)
Q Consensus       245 ~~~g~tpLh~Aa~~g~~~~v~~Ll~-~~~~~~~~~d~~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~lin--~~D~~G~  321 (593)
                       .++.||||.||..|+.+.++.||+ .+.-+.+..|.. |.||||+|+++||.+++++|++.|+..   .+  ..|.+|+
T Consensus       304 -~d~~spLH~AA~yg~~ntv~rLL~~~~~rllne~D~~-g~tpLHlaa~~gH~~v~qlLl~~GA~~---~~~~e~D~dg~  378 (929)
T KOG0510|consen  304 -KDEESPLHFAAIYGRINTVERLLQESDTRLLNESDLH-GMTPLHLAAKSGHDRVVQLLLNKGALF---LNMSEADSDGN  378 (929)
T ss_pred             -CCCCCchHHHHHcccHHHHHHHHhCcCcccccccccc-CCCchhhhhhcCHHHHHHHHHhcChhh---hcccccccCCc
Confidence             788999999999999999999999 555566888999 999999999999999999999999984   33  5699999


Q ss_pred             chhHhhhhhCCCcccccccCchHhhHHHHHHHHHhhhhcCcccccccCCCCCcchh
Q 007677          322 NILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTPKA  377 (593)
Q Consensus       322 T~LH~A~~~~~~~~~~~l~~~~l~~~~~l~~~~~v~~l~~~~~~~~~n~~G~Tpl~  377 (593)
                      ||||+|++.|+...++.+                   +.+|+++..+|++|++++|
T Consensus       379 TaLH~Aa~~g~~~av~~L-------------------i~~Ga~I~~~n~~g~SA~~  415 (929)
T KOG0510|consen  379 TALHLAAKYGNTSAVQKL-------------------ISHGADIGVKNKKGKSAFD  415 (929)
T ss_pred             hhhhHHHHhccHHHHHHH-------------------HHcCCceeecccccccccc
Confidence            999999999998766554                   2356666666666666666



>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 8e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 9e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-04
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Query: 63 NHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASESVELVKATMKG 122 N G T LH+AA ++ V+ LLK + D+ + G T + A A+ +E+V+ +K Sbjct: 45 NDGYTPLHLAASNGHLEIVEVLLK--NGADVNASDLTGITPLHLAAATGHLEIVEVLLKH 102 Query: 123 NEGIATLPDNDGMLPIVRAASLGRTEVVEFLYR 155 + DNDG P+ AA G E+VE L + Sbjct: 103 GADVNAY-DNDGHTPLHLAAKYGHLEIVEVLLK 134
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-04
2rfa_A232 Transient receptor potential cation channel subfa 1e-11
2rfa_A232 Transient receptor potential cation channel subfa 4e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2etb_A256 Transient receptor potential cation channel subfam 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-06
2pnn_A273 Transient receptor potential cation channel subfa 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 3e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score = 72.9 bits (180), Expect = 7e-14
 Identities = 62/357 (17%), Positives = 106/357 (29%), Gaps = 110/357 (30%)

Query: 34  LYRAALNGDWAVAKDIYDKYEGEIGVEI---TNHGKTALHVAAEANRIDFVKKLLKRMSA 90
           L+ AA  G       + +K            T  G T LHVAA+  ++   + LL+R  A
Sbjct: 117 LHIAAREGHVETVLALLEK-----EASQACMTKKGFTPLHVAAKYGKVRVAELLLER-DA 170

Query: 91  EDLAKQNKIGCTAVFYAVASESVELVK----------------------ATMKGNEGIAT 128
                  K G T +  AV   ++++VK                      A  +    +A 
Sbjct: 171 -HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVAR 229

Query: 129 L----------PDNDGMLPIVRAASLGRTEVVEFLYRETKN-SLKDDDCIELLVQLIETG 177
                          G+ P+  AA  G  E+V  L  +  N +L +            T 
Sbjct: 230 SLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSG--------LTP 281

Query: 178 LYAVALQLLHDH----RYLATKRA------KNKETALHVLARKN--------LG---DKD 216
           L+ VA      H      L           +   T LHV +           L    D +
Sbjct: 282 LHLVA---QEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVN 338

Query: 217 RKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMW 276
            K K   +                       P   +H AA +G+   +++L++       
Sbjct: 339 AKTKLGYS-----------------------P---LHQAAQQGHTDIVTLLLKNGASP-- 370

Query: 277 KADKKDNY--TIFHIAVKNRLEDLFKF-IYDIKPIADLMVDCTDEKGNNILHLAGEL 330
             ++  +   T   IA +     +           +   V  +D+   +      E+
Sbjct: 371 --NEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSF--VLVSDKHRMSFPETVDEI 423


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
3gvo_A351 Pumilio 2, pumilio homolog 2; RNA-binding, PUF dom 82.09
3k49_A369 MRNA-binding protein PUF3; PUF3, pumilio, RNA bind 81.17
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=5.1e-49  Score=416.98  Aligned_cols=330  Identities=20%  Similarity=0.216  Sum_probs=182.9

Q ss_pred             ccccccchHhHHHHHcCCHHHHHHHHhhCccccccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCchhhhchhcCCChHH
Q 007677           25 AETITRRLKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAV  104 (593)
Q Consensus        25 ~~~~~~~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~T~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~d~~g~TpL  104 (593)
                      ..|..|.||||.|+..|+.+++++|++. +.+++.+ +..|.||||+|+..|+.++|++|+++  +++++.+|..|.|||
T Consensus        42 ~~~~~~~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~-~~~g~t~L~~A~~~g~~~~v~~Ll~~--ga~~~~~~~~g~t~L  117 (437)
T 1n11_A           42 VSNVKVETPLHMAARAGHTEVAKYLLQN-KAKVNAK-AKDDQTPLHCAARIGHTNMVKLLLEN--NANPNLATTAGHTPL  117 (437)
T ss_dssp             CSSSCCCCHHHHHHHHTCHHHHHHHHHH-TCCSSCC-CTTSCCHHHHHHHHTCHHHHHHHHHH--TCCTTCCCTTCCCHH
T ss_pred             CCCCCCCCHHHHHHHcCCHHHHHHHHhC-CCCCCCC-CCCCCCHHHHHHHCCCHHHHHHHHhC--CCCCCCCCCCCCcHH
Confidence            3344455555555555555555555554 4444444 44555555555555555555555555  455555555555555


Q ss_pred             HHHHHcCCHHHHHHHHhcCCCCCccCCCCCCCHHHHHHHcCCHHHHHHHHHhcc-cccCCcchhHHHHHHHHcCCHHHHH
Q 007677          105 FYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVVEFLYRETK-NSLKDDDCIELLVQLIETGLYAVAL  183 (593)
Q Consensus       105 h~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~-~~~~~~~g~t~L~~A~~~~~~~~v~  183 (593)
                      |+|+..|+.++++.|++++++. ...+..|.||||+|+..|+.+++++|++++. .+..+..|.||||.|+..++.++++
T Consensus       118 ~~A~~~g~~~~v~~Ll~~~~~~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~  196 (437)
T 1n11_A          118 HIAAREGHVETVLALLEKEASQ-ACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVK  196 (437)
T ss_dssp             HHHHHHTCHHHHHHHHHTTCCS-CCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHH
T ss_pred             HHHHHcCCHHHHHHHHhCCCCC-cCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHH
Confidence            5555555555555555555443 3444455555555555555555555555554 4444555555555555555555555


Q ss_pred             HHHHhcchhhhccccCCccHHHHHHhcCCCcccccchhHHHHHHHHHHHHHhcChHHHHHHhhcchhHHHHHHHcCcHHH
Q 007677          184 QLLHDHRYLATKRAKNKETALHVLARKNLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQF  263 (593)
Q Consensus       184 ~Ll~~~~~~~~~~d~~g~t~Lh~a~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~g~tpLh~Aa~~g~~~~  263 (593)
                      .|+++ +...+..+.+|.||||+|+..++          .++++.|++.|.+++..+     ..|.||||+|+..|+.++
T Consensus       197 ~Ll~~-g~~~~~~~~~g~t~L~~A~~~~~----------~~~~~~Ll~~g~~~~~~~-----~~g~t~L~~A~~~g~~~~  260 (437)
T 1n11_A          197 LLLPR-GGSPHSPAWNGYTPLHIAAKQNQ----------VEVARSLLQYGGSANAES-----VQGVTPLHLAAQEGHAEM  260 (437)
T ss_dssp             HHGGG-TCCSCCCCTTCCCHHHHHHHTTC----------HHHHHHHHHTTCCTTCCC-----TTCCCHHHHHHHTTCHHH
T ss_pred             HHHhC-CCCCCCcCCCCCCHHHHHHHcCC----------HHHHHHHHHcCCCCCCCC-----CCCCCHHHHHHHCCCHHH
Confidence            55554 23333444455555555555555          566666666655544332     456667777777677777


Q ss_pred             HHHHHHHCCCccccccCCCCchHHHHHHHcCchhHHHHHhcccCccccccccccCCCCchhHhhhhhCCCccccccc---
Q 007677          264 LSILIREYPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVS---  340 (593)
Q Consensus       264 v~~Ll~~~~~~~~~~d~~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~lin~~D~~G~T~LH~A~~~~~~~~~~~l~---  340 (593)
                      +++|+++++++ +..|.. |+||||+|++.|+.+++++|+++|.+    ++.+|..|+||||+|+..|+.++++.|-   
T Consensus       261 v~~Ll~~~~~~-~~~~~~-g~t~L~~A~~~~~~~~~~~Ll~~g~~----~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g  334 (437)
T 1n11_A          261 VALLLSKQANG-NLGNKS-GLTPLHLVAQEGHVPVADVLIKHGVM----VDATTRMGYTPLHVASHYGNIKLVKFLLQHQ  334 (437)
T ss_dssp             HHHHHTTTCCT-TCCCTT-CCCHHHHHHHHTCHHHHHHHHHHTCC----TTCCCSSCCCHHHHHHHSSCSHHHHHHHHTT
T ss_pred             HHHHHhcCCCC-CCCCCC-CCCHHHHHHHcCCHHHHHHHHhCCcc----CCCCCCCCCCHHHHHHHcCcHHHHHHHHhcC
Confidence            77776666666 566666 66777777777777777777666665    5666677777777777766666555431   


Q ss_pred             ----------CchHhhHHHHHHHHHhhhhc-CcccccccCCCCCcchhhhhH
Q 007677          341 ----------GSALQMQRELLWFKAVKDVV-PPKLRDAKNNKGLTPKALFSK  381 (593)
Q Consensus       341 ----------~~~l~~~~~l~~~~~v~~l~-~~~~~~~~n~~G~Tpl~~a~~  381 (593)
                                .++++.+......+.++.++ .+++++.+|.+|+||+++|.+
T Consensus       335 ad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~  386 (437)
T 1n11_A          335 ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKR  386 (437)
T ss_dssp             CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHH
Confidence                      12233333323333344333 456666666666666666654



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3gvo_A Pumilio 2, pumilio homolog 2; RNA-binding, PUF domain, RNA binding protein; HET: DTD; 1.60A {Mus musculus} SCOP: a.118.1.8 PDB: 3gvt_A 3q0q_A 3q0r_A 3q0s_A 1ib2_A 1m8w_A 1m8x_A 1m8y_A 1m8z_A 3q0l_A 3q0m_A 3q0n_A 3q0o_A 3q0p_A 2yjy_A 3bsx_A 3bsb_A 3h3d_X Back     alignment and structure
>3k49_A MRNA-binding protein PUF3; PUF3, pumilio, RNA binding, mitochondrial mRNA,, membrane, mitochondrion; HET: CIT; 2.50A {Saccharomyces cerevisiae} SCOP: a.118.1.0 PDB: 3k4e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 593
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.5 bits (174), Expect = 7e-14
 Identities = 63/359 (17%), Positives = 114/359 (31%), Gaps = 46/359 (12%)

Query: 34  LYRAALNGDWAVAKDIYDKYEGEIGVEI---TNHGKTALHVAAEANRIDFVKKLLKRMSA 90
           L+ A+  G   + K++  +     G          +T LH+AA A   +  K LL+  + 
Sbjct: 4   LHVASFMGHLPIVKNLLQR-----GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKA- 57

Query: 91  EDLAKQNKIGCTAVFYAVASESVELVKATMKGNEGIATLPDNDGMLPIVRAASLGRTEVV 150
             +  + K   T +  A       +VK  ++ N               + A       V+
Sbjct: 58  -KVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 116

Query: 151 EFLYRETKNSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARK 210
             L +E   +         L    + G   VA +LL +         KN  T LHV    
Sbjct: 117 ALLEKEASQACMTKKGFTPLHVAAKYGKVRVA-ELLLERDAHPNAAGKNGLTPLHVAVHH 175

Query: 211 NLGDKDRKNKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIRE 270
           N  D          +V+ L                      +H AA +  V+    L++ 
Sbjct: 176 NNLD----------IVKLLLPR-----GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQY 220

Query: 271 YPDLMWKADKKDNYTIFHIAVKNRLEDLFKFIYDIKPIADLMVDCTDEKGNNILHLA--- 327
                  A+     T  H+A +    ++   +   +       +  ++ G   LHL    
Sbjct: 221 GG--SANAESVQGVTPLHLAAQEGHAEMVALLLSKQA----NGNLGNKSGLTPLHLVAQE 274

Query: 328 -----GELAPQHRLNV-----VSGSALQMQRELLWFKAVKD-VVPPKLRDAKNNKGLTP 375
                 ++  +H + V     +  + L +       K VK  +      +AK   G +P
Sbjct: 275 GHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSP 333


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.77
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.7e-43  Score=364.66  Aligned_cols=316  Identities=20%  Similarity=0.215  Sum_probs=250.7

Q ss_pred             hHhHHHHHcCCHHHHHHHHhhCccccccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCchhhhchhcCCChHHHHHHHcC
Q 007677           32 LKLYRAALNGDWAVAKDIYDKYEGEIGVEITNHGKTALHVAAEANRIDFVKKLLKRMSAEDLAKQNKIGCTAVFYAVASE  111 (593)
Q Consensus        32 t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~g~T~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~d~~g~TpLh~A~~~g  111 (593)
                      ||||.||..|+.++|+.|+++ |.+++.+ |..|+||||+|+..|+.++|++|+++  |++++.+|..|+||||+|+..|
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~-g~~in~~-d~~g~TpL~~A~~~g~~~iv~~Ll~~--gadi~~~~~~g~t~L~~A~~~g   77 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQR-GASPNVS-NVKVETPLHMAARAGHTEVAKYLLQN--KAKVNAKAKDDQTPLHCAARIG   77 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHT-TCCSCCS-SSCCCCHHHHHHHHTCHHHHHHHHHH--TCCSSCCCTTSCCHHHHHHHHT
T ss_pred             ChHHHHHHCcCHHHHHHHHHC-CCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHHC--cCCCCCCCCCCCCHHHHHHHcC
Confidence            788888888888888888876 7788876 88888888888888888888888888  7888888888888888888888


Q ss_pred             CHHHHHHHHhcCCCC--------------------------------CccCCCCCCCHHHHHHHcCCHHHHHHHHHhcc-
Q 007677          112 SVELVKATMKGNEGI--------------------------------ATLPDNDGMLPIVRAASLGRTEVVEFLYRETK-  158 (593)
Q Consensus       112 ~~~iv~~Ll~~~~~~--------------------------------~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~-  158 (593)
                      +.++++.|+..+++.                                ....+..+.++++.|+..++.+++++|++++. 
T Consensus        78 ~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~  157 (408)
T d1n11a_          78 HTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAH  157 (408)
T ss_dssp             CHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             CHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCC
Confidence            888888888665432                                12345677788888888888888888888887 


Q ss_pred             cccCCcchhHHHHHHHHcCCHHHHHHHHHhcchhhhccccCCccHHHHHHhcCCCc---------------cccc-----
Q 007677          159 NSLKDDDCIELLVQLIETGLYAVALQLLHDHRYLATKRAKNKETALHVLARKNLGD---------------KDRK-----  218 (593)
Q Consensus       159 ~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~a~~~~~~~---------------~~~~-----  218 (593)
                      .+..+.+|.+|||.|+..++.++++.|+++ +..++..+.+|.||+|++.......               ....     
T Consensus       158 ~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~-g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~  236 (408)
T d1n11a_         158 PNAAGKNGLTPLHVAVHHNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLH  236 (408)
T ss_dssp             TTCCCSSCCCHHHHHHHTTCHHHHHHHGGG-TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHH
T ss_pred             CCcCCCcCchHHHHHHHcCCHHHHHHHHhc-CCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHH
Confidence            777778888888888888888888888876 4445566667777777766655400               0000     


Q ss_pred             ---chhHHHHHHHHHHHHHhcChHHHHHHhhcchhHHHHHHHcCcHHHHHHHHHHCCCccccccCCCCchHHHHHHHcCc
Q 007677          219 ---NKEAETLVESLWEEVILLSKQEIWELIEQPRELIHDAADRGNVQFLSILIREYPDLMWKADKKDNYTIFHIAVKNRL  295 (593)
Q Consensus       219 ---~~~~~~~~~~L~~~~~~~~~~~~~~~~~~g~tpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~~g~t~Lh~Av~~~~  295 (593)
                         .....++++.+.+.+...+.     .+..|.||++.|++.++.+++++|+++|+++ +..+.. +.||||.|+..++
T Consensus       237 ~a~~~~~~~~~~~~~~~~~~~~~-----~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~-~~~~~~-~~t~L~~~~~~~~  309 (408)
T d1n11a_         237 LAAQEGHAEMVALLLSKQANGNL-----GNKSGLTPLHLVAQEGHVPVADVLIKHGVMV-DATTRM-GYTPLHVASHYGN  309 (408)
T ss_dssp             HHHHTTCHHHHHHHHTTTCCTTC-----CCTTCCCHHHHHHHHTCHHHHHHHHHHTCCT-TCCCSS-CCCHHHHHHHSSC
T ss_pred             HHHHhCcHhHhhhhhcccccccc-----ccCCCCChhhhhhhcCcHHHHHHHHHCCCcc-cccccc-ccccchhhcccCc
Confidence               00114445555444433333     2467899999999999999999999999998 788888 9999999999999


Q ss_pred             hhHHHHHhcccCccccccccccCCCCchhHhhhhhCCCcccccccCchHhhHHHHHHHHHhhhhcCcccccccCCCCCcc
Q 007677          296 EDLFKFIYDIKPIADLMVDCTDEKGNNILHLAGELAPQHRLNVVSGSALQMQRELLWFKAVKDVVPPKLRDAKNNKGLTP  375 (593)
Q Consensus       296 ~~iv~~Ll~~~~~~~~lin~~D~~G~T~LH~A~~~~~~~~~~~l~~~~l~~~~~l~~~~~v~~l~~~~~~~~~n~~G~Tp  375 (593)
                      .++++++++.|++    +|.+|.+|+||||+|++.|+.++++.|                   +-.|++++.+|++|+||
T Consensus       310 ~~~~~~ll~~g~~----in~~d~~G~T~Lh~A~~~g~~~iv~~L-------------------l~~GAd~n~~d~~G~t~  366 (408)
T d1n11a_         310 IKLVKFLLQHQAD----VNAKTKLGYSPLHQAAQQGHTDIVTLL-------------------LKNGASPNEVSSDGTTP  366 (408)
T ss_dssp             SHHHHHHHHTTCC----TTCCCTTSCCHHHHHHHTTCHHHHHHH-------------------HHTTCCSCCCCSSSCCH
T ss_pred             ceeeeeecccccc----ccccCCCCCCHHHHHHHcCCHHHHHHH-------------------HHCCCCCCCCCCCCCCH
Confidence            9999999999988    889999999999999999997765544                   23789999999999999


Q ss_pred             hhhhhHH
Q 007677          376 KALFSKE  382 (593)
Q Consensus       376 l~~a~~~  382 (593)
                      +|+|.+.
T Consensus       367 L~~A~~~  373 (408)
T d1n11a_         367 LAIAKRL  373 (408)
T ss_dssp             HHHHHHT
T ss_pred             HHHHHHc
Confidence            9999865



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure