Citrus Sinensis ID: 007725


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEEITEEVGAVSSGSHRSSGTEYLAREKADPSKSEHSANGRGSSTKPEFLPDLKDDPESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVAGQASTAVDPKGISSDPGPRLSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccc
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccHHccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccc
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATEnmknmrpedlKCAAEqlthtppeeVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNlqgihsseGRTLLLACSLNsmscylktkqYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDlsnahevspddgtIADVLRDAKEILMkedghhgprgllIEEITEEvgavssgshrssgteylarekadpsksehsangrgsstkpeflpdlkddpesIRSFQNFisnanpdsfaalsggkageispDMFKAVSIMINKMSPEELQRMIQIASsfqgenphangdsietnfngfrpgstppnmrpdmlKTASDVMSKMSSEDLQKMFEMESTLKNKvagqastavdpkgissdpgprlsesrersavngnnvvgqpssggffpnsrtnqqssfspstADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQRGvqgvkktknwllgkpGMILAICMLILAVILHRLGFIGG
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSdlsnahevspddgtIADVLRDAKEILMkedghhgprgLLIEEITEEVgavssgshrssgTEYLarekadpsksehsangrgsstkpeflpDLKDDPESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVagqastavdpkgissdpgprlSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQrgvqgvkktknwllgKPGMILAICMLILAVILHRLGFIGG
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEEITEEVGAVSSGSHRSSGTEYLAREKADPSKSEHSANGRGSSTKPEFLPDLKDDPESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVAGQASTAVDPKGISSDPGPRLSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
*********************************************************************************************AQMNYEFNAAKMLK**GNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLE********************DVLR****I************LLI*******************************************************************************************AVSIM********************************************************************************************************************************************************************************************************NDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFI**
*****************************************************DL*CAA******PPEEVAEIGEKLANA**********************AKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRD****************************************************************************************************************************************************************************************************************************************************************************************************************************DLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEEITEEV*************************************KPEFLPDLKDDPESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNK******************************VNGNNVVGQPSSGGFFPNSR*************LQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
*****MDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEEIT*******************************************FLPDLKDD*ESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLK*********************************************************************************************************************SSLSLNDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEEITEEVGAVSSGSHRSSGTEYLAREKADPSKSEHSANGRGSSTKPEFLPDLKDDPESIRSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGENPHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVAGQASTAVDPKGISSDPGPRLSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLNDLDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query591 2.2.26 [Sep-21-2011]
B7ZWR6554 Outer envelope protein 61 yes no 0.934 0.996 0.595 0.0
Q43207559 70 kDa peptidyl-prolyl is N/A no 0.189 0.200 0.364 4e-14
Q9FJL3578 Peptidyl-prolyl cis-trans no no 0.213 0.217 0.325 5e-13
A4K2V0309 Mitochondrial import rece yes no 0.243 0.466 0.320 1e-12
Q9LDC0365 Peptidyl-prolyl cis-trans no no 0.225 0.364 0.333 1e-12
Q15785309 Mitochondrial import rece yes no 0.243 0.466 0.314 2e-12
Q38931551 Peptidyl-prolyl cis-trans no no 0.211 0.226 0.335 3e-12
P0C1I1364 Peptidyl-prolyl cis-trans N/A no 0.192 0.313 0.353 2e-11
Q5RAP0 929 Protein unc-45 homolog A no no 0.196 0.124 0.336 1e-10
Q3KRD5309 Mitochondrial import rece yes no 0.164 0.313 0.372 2e-10
>sp|B7ZWR6|OEP61_ARATH Outer envelope protein 61, chloroplastic OS=Arabidopsis thaliana GN=OEP61 PE=1 SV=1 Back     alignment and function desciption
 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/591 (59%), Positives = 430/591 (72%), Gaps = 39/591 (6%)

Query: 1   MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAE 60
           MFNG+MDPEMIRLAQ+QM+RM+P DFARIQQQMM+NP+LM +ATE+MKNMRPEDLK AAE
Sbjct: 1   MFNGLMDPEMIRLAQDQMSRMTPADFARIQQQMMSNPDLMNMATESMKNMRPEDLKQAAE 60

Query: 61  QLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFS 120
           QL HT PE++AEI EK+A ASPE+IA MRA  DAQ  Y+ NAA+MLKKQGNEL+S G FS
Sbjct: 61  QLKHTRPEDMAEISEKMAKASPEDIAAMRAHADAQFTYQINAAQMLKKQGNELHSRGNFS 120

Query: 121 NALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNV 180
           +A +KYL AK NL+ I SS+G  +LLACSLN MSCYLKT Q++ECIK GSEVL YDA+NV
Sbjct: 121 DAAEKYLRAKNNLKEIPSSKGGAILLACSLNLMSCYLKTNQHEECIKEGSEVLGYDARNV 180

Query: 181 KALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLL 240
           KALYRRGQAY+D+G  E+AVSDLS AHEVSP+D TIADVLRD KE L  E      RG++
Sbjct: 181 KALYRRGQAYRDLGLFEDAVSDLSKAHEVSPEDETIADVLRDVKERLAVEGPGKASRGVV 240

Query: 241 IEEITEEVGAVSSGSHRSSGTEYLAREKADPSKSEHSANGRGSSTKPEFLPDLKDDPESI 300
           IE+ITEE   V+SG ++             PSK E + + +G  T  + L  L+D+PE+I
Sbjct: 241 IEDITEE-NNVTSGENKK------------PSK-EANGHAQGVKTDVDGLQALRDNPEAI 286

Query: 301 RSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGEN 360
           R+FQNFIS  +PD+ AALSGGKAG++SPDMFK  S MI KMSPEE+Q+M+Q ASSF+G+N
Sbjct: 287 RTFQNFISKTDPDTLAALSGGKAGDMSPDMFKTASSMIGKMSPEEIQKMVQTASSFKGDN 346

Query: 361 PHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVAG 420
           P A   +  +  NGF P        PDMLK ASD+M KMS E+ ++MF M S+L  K   
Sbjct: 347 PFA--PTAPSTENGFTP-------TPDMLKLASDMMGKMSPEERERMFNMASSL--KANA 395

Query: 421 QASTAVDPKGISSDPGPRLSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTAD 480
            AST+    G +    PR  ES   S  +  N    P S GF P       S  S   AD
Sbjct: 396 PASTSY---GNAEASEPR--ESLGASGSSSGNSFVAPRS-GFEP-------SIPSAPPAD 442

Query: 481 LQ-QMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLND 539
           LQ QMRNQM DPAM+QMF+SM+KNM+PEMMA+MSEQFG+KLS+ED  K QQ M+SLS + 
Sbjct: 443 LQEQMRNQMKDPAMRQMFTSMIKNMNPEMMASMSEQFGMKLSQEDAAKAQQAMASLSPDA 502

Query: 540 LDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIG 590
           L++MM WADR Q G++  KK K WL GK G+I AI ML+LA++LHRLG+IG
Sbjct: 503 LEKMMRWADRAQTGMEKAKKAKKWLFGKGGLIFAILMLVLAMVLHRLGYIG 553




Chaperone receptor mediating Hsp70-dependent protein targeting to chloroplasts. Interacts specifically with some chloroplast precursors, but not with mitochondrial precursors. Able to select precursors for delivery to the chloroplast translocase independently of Hsp70.
Arabidopsis thaliana (taxid: 3702)
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 Back     alignment and function description
>sp|Q9LDC0|FKB42_ARATH Peptidyl-prolyl cis-trans isomerase FKBP42 OS=Arabidopsis thaliana GN=FKBP42 PE=1 SV=1 Back     alignment and function description
>sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 Back     alignment and function description
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function description
>sp|P0C1I1|PPID_RHIO9 Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 Back     alignment and function description
>sp|Q5RAP0|UN45A_PONAB Protein unc-45 homolog A OS=Pongo abelii GN=UNC45A PE=2 SV=1 Back     alignment and function description
>sp|Q3KRD5|TOM34_RAT Mitochondrial import receptor subunit TOM34 OS=Rattus norvegicus GN=Tomm34 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
225436083590 PREDICTED: outer envelope protein 61, ch 0.983 0.984 0.644 0.0
224102985588 predicted protein [Populus trichocarpa] 0.988 0.993 0.681 0.0
296084010584 unnamed protein product [Vitis vinifera] 0.979 0.991 0.645 0.0
255549607595 fk506 binding protein, putative [Ricinus 0.996 0.989 0.652 0.0
224132120559 predicted protein [Populus trichocarpa] 0.937 0.991 0.632 0.0
356517663581 PREDICTED: uncharacterized protein LOC10 0.978 0.994 0.611 0.0
356544786590 PREDICTED: uncharacterized protein LOC10 0.979 0.981 0.606 0.0
449448844569 PREDICTED: outer envelope protein 61, ch 0.961 0.998 0.591 0.0
26452527554 unknown protein [Arabidopsis thaliana] 0.934 0.996 0.595 0.0
30688239554 tetratricopeptide repeat domain-containi 0.934 0.996 0.595 0.0
>gi|225436083|ref|XP_002272729.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/591 (64%), Positives = 469/591 (79%), Gaps = 10/591 (1%)

Query: 4   GMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAEQLT 63
            MMDPE+IRLAQEQMNRMSP +FA+IQ+QMMANPELMR+A+E M NMRPEDL+ AAEQL 
Sbjct: 5   AMMDPELIRLAQEQMNRMSPTEFAKIQEQMMANPELMRMASETMMNMRPEDLRNAAEQLK 64

Query: 64  HTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNAL 123
           +  PEE+AEIGEK+AN+SPEEIA MRAR D+Q+ Y+ NAA+MLKKQGNEL+++G+F+ A 
Sbjct: 65  YARPEEMAEIGEKMANSSPEEIAAMRARADSQITYQINAAQMLKKQGNELHNKGKFNEAS 124

Query: 124 QKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKAL 183
           QKYLLAKKNL GI +S+GRTLLLACSLN MSCYLKTKQYDECI+ G+EVLAYD KNVKAL
Sbjct: 125 QKYLLAKKNLTGIPASKGRTLLLACSLNLMSCYLKTKQYDECIQEGTEVLAYDPKNVKAL 184

Query: 184 YRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLLIEE 243
           YRRGQAYK++G+L +AVSDL+ A+ VSP+D TI +VLRD KE L+K+ G    R L+IEE
Sbjct: 185 YRRGQAYKELGQLNDAVSDLNKAYGVSPEDETIGEVLRDVKEKLIKQGGEPAQRKLVIEE 244

Query: 244 ITEEVGAVSSGSHRSSGTEYLA---REKADPSKSEHSANGRGSSTKPEFLPDLKDDPESI 300
           ITEE  AVS+G+ + S  E      +E     KS+   N    +T  E+L  LKDDPE+I
Sbjct: 245 ITEE--AVSTGNGKCSAMENCVTQPQENGACRKSQSGTNSEDLTTNSEYLQTLKDDPEAI 302

Query: 301 RSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGEN 360
           RSFQNF+SNA+PD+ AALS GK+GE SPDMFK  S MI+KMSPEELQRM+Q+ASSFQ EN
Sbjct: 303 RSFQNFMSNADPDTLAALSAGKSGEYSPDMFKTASNMISKMSPEELQRMVQMASSFQREN 362

Query: 361 PHANGDSIETNFNGFRPGSTPPNMRPDMLKTASDVMSKMSSEDLQKMFEMESTLKNKVAG 420
            +    S+++NF  FRPGS PPN+ P+MLKTA+D+M+ MS+E+ QKM EM S+L+ + + 
Sbjct: 363 EYFPKGSLDSNFGSFRPGSVPPNLTPEMLKTATDMMNNMSTEERQKMLEMASSLRARDSV 422

Query: 421 QASTAVDPKGISSDPGPRLSESRERSAVNGNNVVGQPSSGGFFPNSRTNQQSSFSPSTAD 480
               +++  G+SS    +  E+RE SAVNGNN +G+ SS G F N R   QSSF PSTA 
Sbjct: 423 STPASLNTDGLSS----KFPETRENSAVNGNNDMGESSSHGSFSNLRGGSQSSFQPSTAG 478

Query: 481 LQ-QMRNQMNDPAMKQMFSSMVKNMSPEMMANMSEQFGIKLSREDTEKFQQTMSSLSLND 539
           +Q QMRNQM DPAM+QMF+SM+KNMSPEMM NM EQFG+KLSRED EK QQ +SS++  +
Sbjct: 479 MQEQMRNQMKDPAMRQMFTSMIKNMSPEMMTNMGEQFGVKLSREDAEKAQQALSSITPEN 538

Query: 540 LDRMMLWADRVQRGVQGVKKTKNWLLGKPGMILAICMLILAVILHRLGFIG 590
           LDRMM WAD +Q+G +  +K KNWLLGKPGMILAICMLILA+ILHRLG+IG
Sbjct: 539 LDRMMRWADGIQKGAERARKAKNWLLGKPGMILAICMLILAIILHRLGYIG 589




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224102985|ref|XP_002312880.1| predicted protein [Populus trichocarpa] gi|222849288|gb|EEE86835.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296084010|emb|CBI24398.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549607|ref|XP_002515855.1| fk506 binding protein, putative [Ricinus communis] gi|223545010|gb|EEF46524.1| fk506 binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224132120|ref|XP_002328190.1| predicted protein [Populus trichocarpa] gi|222837705|gb|EEE76070.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356517663|ref|XP_003527506.1| PREDICTED: uncharacterized protein LOC100800315 [Glycine max] Back     alignment and taxonomy information
>gi|356544786|ref|XP_003540828.1| PREDICTED: uncharacterized protein LOC100793234 [Glycine max] Back     alignment and taxonomy information
>gi|449448844|ref|XP_004142175.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Cucumis sativus] gi|449503433|ref|XP_004162000.1| PREDICTED: outer envelope protein 61, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|26452527|dbj|BAC43348.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30688239|ref|NP_680187.2| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] gi|357580467|sp|B7ZWR6.1|OEP61_ARATH RecName: Full=Outer envelope protein 61, chloroplastic; AltName: Full=Tetratricopeptide repeat domain-containing protein 7 gi|219291100|gb|ACL13985.1| At5g21990 [Arabidopsis thaliana] gi|332005581|gb|AED92964.1| tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
TAIR|locus:504956437554 TPR7 "AT5G21990" [Arabidopsis 0.834 0.889 0.508 2.5e-120
UNIPROTKB|Q7XIM1547 OJ1714_H10.131 "Putative uncha 0.813 0.879 0.393 8.2e-83
UNIPROTKB|Q7XRB1392 OSJNBa0006B20.12 "cDNA clone:0 0.561 0.846 0.418 3.4e-61
UNIPROTKB|A8I9E1580 TPR1 "Predicted chloroplast-ta 0.734 0.748 0.266 2.2e-31
TAIR|locus:2037650164 TPR6 "AT1G58450" [Arabidopsis 0.213 0.768 0.335 1.5e-13
UNIPROTKB|Q2QXS0370 LOC_Os12g05090 "Os12g0145500 p 0.270 0.432 0.323 7.5e-13
UNIPROTKB|Q7F1F2580 OJ1191_A10.119 "cDNA clone:J03 0.285 0.291 0.314 8.4e-13
UNIPROTKB|Q15785309 TOMM34 "Mitochondrial import r 0.243 0.466 0.320 2.1e-12
UNIPROTKB|Q9XFE4585 OSJNBa0091C07.4 "OSJNBa0091C07 0.225 0.227 0.35 3e-12
TAIR|locus:2152561578 ROF2 "AT5G48570" [Arabidopsis 0.225 0.230 0.323 4.9e-12
TAIR|locus:504956437 TPR7 "AT5G21990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1184 (421.8 bits), Expect = 2.5e-120, P = 2.5e-120
 Identities = 267/525 (50%), Positives = 343/525 (65%)

Query:     1 MFNGMMDPEMIRLAQEQMNRMSPDDFARIQQQMMANPELMRIATENMKNMRPEDLKCAAE 60
             MFNG+MDPEMIRLAQ+QM+RM+P DFARIQQQMM+NP+LM +ATE+MKNMRPEDLK AAE
Sbjct:     1 MFNGLMDPEMIRLAQDQMSRMTPADFARIQQQMMSNPDLMNMATESMKNMRPEDLKQAAE 60

Query:    61 QLTHTPPEEVAEIGEKLANASPEEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFS 120
             QL HT PE++AEI EK+A ASPE+IA MRA  DAQ  Y+ NAA+MLKKQGNEL+S G FS
Sbjct:    61 QLKHTRPEDMAEISEKMAKASPEDIAAMRAHADAQFTYQINAAQMLKKQGNELHSRGNFS 120

Query:   121 NALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNV 180
             +A +KYL AK NL+ I SS+G  +LLACSLN MSCYLKT Q++ECIK GSEVL YDA+NV
Sbjct:   121 DAAEKYLRAKNNLKEIPSSKGGAILLACSLNLMSCYLKTNQHEECIKEGSEVLGYDARNV 180

Query:   181 KALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMKEDGHHGPRGLL 240
             KALYRRGQAY+D+G  E+AVSDLS AHEVSP+D TIADVLRD KE L  E      RG++
Sbjct:   181 KALYRRGQAYRDLGLFEDAVSDLSKAHEVSPEDETIADVLRDVKERLAVEGPGKASRGVV 240

Query:   241 IEEITEEVGAVSSGSHRSSGTEYLAREKADPSKSEHSANGRGSSTKPEFLPDLKDDPESI 300
             IE+ITEE   V+SG ++             PSK E + + +G  T  + L  L+D+PE+I
Sbjct:   241 IEDITEE-NNVTSGENKK------------PSK-EANGHAQGVKTDVDGLQALRDNPEAI 286

Query:   301 RSFQNFISNANPDSFAALSGGKAGEISPDMFKAVSIMINKMSPEELQRMIQIASSFQGEN 360
             R+FQNFIS  +PD+ AALSGGKAG++SPDMFK  S MI KMSPEE+Q+M+Q ASSF+G+N
Sbjct:   287 RTFQNFISKTDPDTLAALSGGKAGDMSPDMFKTASSMIGKMSPEEIQKMVQTASSFKGDN 346

Query:   361 PHANGDSIETNFNGFRPGSTPPNMRPDML-KTASDVMSKM--SSEDLQKMFEMESTLKNK 417
             P A   +  +  NGF P      +  DM+ K + +   +M   +  L+      ++  N 
Sbjct:   347 PFA--PTAPSTENGFTPTPDMLKLASDMMGKMSPEERERMFNMASSLKANAPASTSYGNA 404

Query:   418 VAGQASTAVDPKGISSDPG---PRLS-ESRERSAVNGN------NVVGQPSSGGFFPNSR 467
              A +   ++   G SS      PR   E    SA   +      N +  P+    F +  
Sbjct:   405 EASEPRESLGASGSSSGNSFVAPRSGFEPSIPSAPPADLQEQMRNQMKDPAMRQMFTSMI 464

Query:   468 TNQQSSFSPSTADLQQMRNQMNDPAMKQMFSSMVKNMSPEMMANM 512
              N       S ++   M+    D A  Q     + ++SP+ +  M
Sbjct:   465 KNMNPEMMASMSEQFGMKLSQEDAAKAQQ---AMASLSPDALEKM 506


GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IBA
GO:0005528 "FK506 binding" evidence=IBA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0005829 "cytosol" evidence=IDA
GO:0009707 "chloroplast outer membrane" evidence=IDA
GO:0005789 "endoplasmic reticulum membrane" evidence=IDA
GO:0046967 "cytosol to ER transport" evidence=IGI
UNIPROTKB|Q7XIM1 OJ1714_H10.131 "Putative uncharacterized protein OJ1714_H10.131" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XRB1 OSJNBa0006B20.12 "cDNA clone:002-172-D07, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8I9E1 TPR1 "Predicted chloroplast-targeted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
TAIR|locus:2037650 TPR6 "AT1G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QXS0 LOC_Os12g05090 "Os12g0145500 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q15785 TOMM34 "Mitochondrial import receptor subunit TOM34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7ZWR6OEP61_ARATHNo assigned EC number0.59560.93400.9963yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_IX000173
hypothetical protein (588 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-12
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 5e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 6e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 62.4 bits (152), Expect = 4e-12
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 9/109 (8%)

Query: 104 KMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYD 163
           + L   GN  Y  G +  AL+ Y  A +    +            +      Y K  +Y+
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALE----LDPDNADAYYNLAA-----AYYKLGKYE 51

Query: 164 ECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPD 212
           E ++   + L  D  N KA Y  G AY  +G+ EEA+     A E+ P+
Sbjct: 52  EALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 591
KOG0553304 consensus TPR repeat-containing protein [General f 99.84
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.62
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.58
KOG4234271 consensus TPR repeat-containing protein [General f 99.56
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.53
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
PRK15359144 type III secretion system chaperone protein SscB; 99.48
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.47
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.45
KOG4648536 consensus Uncharacterized conserved protein, conta 99.45
KOG0547606 consensus Translocase of outer mitochondrial membr 99.41
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.4
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 99.38
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.35
PRK10370198 formate-dependent nitrite reductase complex subuni 99.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.32
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.29
KOG0553304 consensus TPR repeat-containing protein [General f 99.28
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.26
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.25
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.2
KOG1126638 consensus DNA-binding cell division cycle control 99.2
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.2
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.2
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.19
PRK11189296 lipoprotein NlpI; Provisional 99.16
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 99.14
PRK12370553 invasion protein regulator; Provisional 99.13
PRK12370553 invasion protein regulator; Provisional 99.12
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.08
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.07
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.05
KOG1126638 consensus DNA-binding cell division cycle control 99.03
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.03
PRK15359144 type III secretion system chaperone protein SscB; 99.03
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.02
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.02
KOG1125579 consensus TPR repeat-containing protein [General f 98.99
PRK11189296 lipoprotein NlpI; Provisional 98.98
KOG1125579 consensus TPR repeat-containing protein [General f 98.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.93
PRK10370198 formate-dependent nitrite reductase complex subuni 98.91
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.9
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.89
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.89
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.89
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.87
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.85
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.85
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.82
KOG0547606 consensus Translocase of outer mitochondrial membr 98.82
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.81
PLN02789320 farnesyltranstransferase 98.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.8
KOG2003840 consensus TPR repeat-containing protein [General f 98.8
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.79
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.78
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.76
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.75
PLN02789320 farnesyltranstransferase 98.74
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.74
PRK11788389 tetratricopeptide repeat protein; Provisional 98.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.71
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.69
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.69
PRK11788389 tetratricopeptide repeat protein; Provisional 98.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.67
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.64
PRK15331165 chaperone protein SicA; Provisional 98.64
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.6
PRK10049765 pgaA outer membrane protein PgaA; Provisional 98.6
KOG1129478 consensus TPR repeat-containing protein [General f 98.57
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.5
KOG4555175 consensus TPR repeat-containing protein [Function 98.47
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 98.46
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.45
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.45
PF1337173 TPR_9: Tetratricopeptide repeat 98.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.41
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.4
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.4
PRK10803263 tol-pal system protein YbgF; Provisional 98.39
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.37
KOG4648536 consensus Uncharacterized conserved protein, conta 98.37
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 98.37
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.29
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.27
PRK14574 822 hmsH outer membrane protein; Provisional 98.26
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.23
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.22
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.22
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.21
KOG1128777 consensus Uncharacterized conserved protein, conta 98.21
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.2
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.2
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.2
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.2
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.19
PF1337173 TPR_9: Tetratricopeptide repeat 98.19
KOG2076 895 consensus RNA polymerase III transcription factor 98.18
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.16
PF13512142 TPR_18: Tetratricopeptide repeat 98.14
PRK14574 822 hmsH outer membrane protein; Provisional 98.14
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.13
PF12688120 TPR_5: Tetratrico peptide repeat 98.12
KOG2076 895 consensus RNA polymerase III transcription factor 98.1
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.09
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.08
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.08
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.08
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.08
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.07
KOG1129478 consensus TPR repeat-containing protein [General f 98.07
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.06
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.03
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.98
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.98
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.94
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.91
KOG1310758 consensus WD40 repeat protein [General function pr 97.9
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.89
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.89
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.86
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.85
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.83
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.82
PRK11906458 transcriptional regulator; Provisional 97.82
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.82
KOG4234271 consensus TPR repeat-containing protein [General f 97.8
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.79
KOG2003840 consensus TPR repeat-containing protein [General f 97.74
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.74
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.72
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.71
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.66
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.66
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.65
KOG1128777 consensus Uncharacterized conserved protein, conta 97.64
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.58
PF1343134 TPR_17: Tetratricopeptide repeat 97.57
PRK10803263 tol-pal system protein YbgF; Provisional 97.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.5
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.46
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.46
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.44
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.41
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.4
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.36
PRK11906458 transcriptional regulator; Provisional 97.34
PRK15331165 chaperone protein SicA; Provisional 97.34
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.33
PF1342844 TPR_14: Tetratricopeptide repeat 97.29
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.27
KOG2376652 consensus Signal recognition particle, subunit Srp 97.26
PF12688120 TPR_5: Tetratrico peptide repeat 97.26
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.18
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 97.14
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.09
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.04
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.01
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.98
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.94
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.94
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.88
PF1342844 TPR_14: Tetratricopeptide repeat 96.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.83
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.77
KOG2471696 consensus TPR repeat-containing protein [General f 96.75
COG4700251 Uncharacterized protein conserved in bacteria cont 96.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.71
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.67
KOG4555175 consensus TPR repeat-containing protein [Function 96.66
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.59
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 96.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.55
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.54
PF1343134 TPR_17: Tetratricopeptide repeat 96.51
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.48
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.48
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.41
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.38
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.35
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.3
PF13512142 TPR_18: Tetratricopeptide repeat 96.28
KOG4340459 consensus Uncharacterized conserved protein [Funct 96.24
PRK10941269 hypothetical protein; Provisional 96.22
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.14
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.12
KOG4340459 consensus Uncharacterized conserved protein [Funct 95.89
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 95.87
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.87
KOG4507886 consensus Uncharacterized conserved protein, conta 95.83
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.58
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 95.56
KOG3785557 consensus Uncharacterized conserved protein [Funct 95.55
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.43
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.35
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.26
COG3898531 Uncharacterized membrane-bound protein [Function u 95.07
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.68
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.64
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 94.62
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.57
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.5
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.4
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.39
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.28
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 94.23
PRK04841903 transcriptional regulator MalT; Provisional 94.23
KOG1941518 consensus Acetylcholine receptor-associated protei 94.22
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.19
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.15
KOG1586288 consensus Protein required for fusion of vesicles 94.08
PLN03077857 Protein ECB2; Provisional 93.85
KOG3364149 consensus Membrane protein involved in organellar 93.49
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.46
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.42
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.37
COG4700251 Uncharacterized protein conserved in bacteria cont 93.35
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 93.07
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.6
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 92.43
PLN032181060 maturation of RBCL 1; Provisional 92.28
KOG4507 886 consensus Uncharacterized conserved protein, conta 92.24
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 92.21
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.74
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.48
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 91.46
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.42
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 91.25
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.24
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.0
PRK04841903 transcriptional regulator MalT; Provisional 90.88
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.75
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 90.75
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 90.72
PLN03077857 Protein ECB2; Provisional 90.48
PLN032181060 maturation of RBCL 1; Provisional 90.31
PRK10941269 hypothetical protein; Provisional 90.3
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 90.1
KOG2471696 consensus TPR repeat-containing protein [General f 90.05
KOG1915 677 consensus Cell cycle control protein (crooked neck 90.03
COG2912269 Uncharacterized conserved protein [Function unknow 89.94
KOG2796366 consensus Uncharacterized conserved protein [Funct 89.85
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 88.11
KOG1941518 consensus Acetylcholine receptor-associated protei 87.53
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.4
KOG2610491 consensus Uncharacterized conserved protein [Funct 87.17
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.32
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 86.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 85.84
KOG3364149 consensus Membrane protein involved in organellar 85.69
COG4105254 ComL DNA uptake lipoprotein [General function pred 85.64
KOG1915677 consensus Cell cycle control protein (crooked neck 83.91
COG2912269 Uncharacterized conserved protein [Function unknow 83.25
smart0072741 STI1 Heat shock chaperonin-binding motif. 82.16
PF1111685 DUF2624: Protein of unknown function (DUF2624); In 81.62
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 80.35
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.05
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
Probab=99.84  E-value=1.3e-21  Score=196.69  Aligned_cols=122  Identities=28%  Similarity=0.367  Sum_probs=116.6

Q ss_pred             cchHHHHHHHhcccccccccchhHHHHHHHhhhccccccccccceeeeeeccccceeeeccccchhhhhhcceeeecccc
Q 007725           99 EFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAK  178 (591)
Q Consensus        99 ~~~~a~~lk~~Gn~~~~~g~y~eAi~~Y~kAL~l~p~~~~~e~~~l~~~~~~Nla~~y~~lg~y~eAi~~~~~AL~ldP~  178 (591)
                      ....++.+|..||.+.+.++|.+|+.+|.+||+++|.++.         +|.||+.+|.++|.|+.||++|+.||.+||.
T Consensus        77 ~~~~AE~LK~eGN~~m~~~~Y~eAv~kY~~AI~l~P~nAV---------yycNRAAAy~~Lg~~~~AVkDce~Al~iDp~  147 (304)
T KOG0553|consen   77 DKALAESLKNEGNKLMKNKDYQEAVDKYTEAIELDPTNAV---------YYCNRAAAYSKLGEYEDAVKDCESALSIDPH  147 (304)
T ss_pred             HHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhcCCCcch---------HHHHHHHHHHHhcchHHHHHHHHHHHhcChH
Confidence            4557889999999999999999999999999999999975         8999999999999999999999999999999


Q ss_pred             chHHHHHhccchhhhhhHHHHhhhcccccccCCCCChHHHHHhHHHHHhhh
Q 007725          179 NVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKEILMK  229 (591)
Q Consensus       179 ~~~a~~~rg~al~~lg~~eeAl~~lekAl~l~P~~~~a~~~L~~a~~~l~~  229 (591)
                      +.++|.|+|.+|+.+|+|++|++.|++||+++|++...++.|..++.++.+
T Consensus       148 yskay~RLG~A~~~~gk~~~A~~aykKaLeldP~Ne~~K~nL~~Ae~~l~e  198 (304)
T KOG0553|consen  148 YSKAYGRLGLAYLALGKYEEAIEAYKKALELDPDNESYKSNLKIAEQKLNE  198 (304)
T ss_pred             HHHHHHHHHHHHHccCcHHHHHHHHHhhhccCCCcHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999888853



>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF11116 DUF2624: Protein of unknown function (DUF2624); InterPro: IPR020277 This entry contains proteins with no known function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 9e-14
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 2e-11
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 5e-11
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 7e-10
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 1e-08
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-08
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 7e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-06
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 5e-06
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 6e-06
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 8e-06
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-05
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 2e-04
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-04
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure

Iteration: 1

Score = 75.5 bits (184), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 8/147 (5%) Query: 83 EEIATMRARIDAQMNYEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKK--------NLQ 134 +E +AR D + AA K GN L+ E + A+Q+Y +A L Sbjct: 159 DETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLY 218 Query: 135 GIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIG 194 G + + C LN +C +K K+YDE I + VL + KN KAL+RRG+A ++G Sbjct: 219 GKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELG 278 Query: 195 RLEEAVSDLSNAHEVSPDDGTIADVLR 221 +++ A D A + +PDD I LR Sbjct: 279 QMDSARDDFRKAQKYAPDDKAIRRELR 305
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-34
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-33
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-32
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 6e-32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 5e-23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-19
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-19
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-17
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-14
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 5e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-04
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
 Score =  128 bits (324), Expect = 1e-34
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 9/146 (6%)

Query: 95  QMNYE--FNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEG-------RTLL 145
               E    +A  +K++GNE + +   + A+ KY  A          +        + + 
Sbjct: 28  DYTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWDDQILLDKKKNIE 87

Query: 146 LACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSN 205
           ++C+LN  +CY K K Y + I   S+VL  D  NVKALY+ G A    G LEEA  +L  
Sbjct: 88  ISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYK 147

Query: 206 AHEVSPDDGTIADVLRDAKEILMKED 231
           A  ++P++  I +        L +  
Sbjct: 148 AASLNPNNLDIRNSYELCVNKLKEAR 173


>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.75
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.69
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.62
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.61
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.6
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.6
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.59
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.57
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.54
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.53
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.51
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.51
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.51
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.48
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.46
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.43
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.42
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.4
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.39
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
3u4t_A272 TPR repeat-containing protein; structural genomics 99.37
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.37
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.36
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.35
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.35
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.35
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.32
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.32
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.31
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.3
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.3
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.3
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.29
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.28
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.27
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.27
3k9i_A117 BH0479 protein; putative protein binding protein, 99.27
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.27
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.27
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.27
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.26
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.24
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.23
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.23
3u4t_A272 TPR repeat-containing protein; structural genomics 99.23
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.23
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.23
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.22
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.22
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.22
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.21
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.2
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.2
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.18
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.18
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.18
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.18
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.16
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.11
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.1
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.1
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.04
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.03
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.03
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.02
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.0
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.98
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.96
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.96
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.95
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.95
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.95
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.94
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.94
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.93
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.91
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.91
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.89
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.86
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.86
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.85
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.83
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.82
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.81
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.8
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.79
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.78
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.77
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.75
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.75
3k9i_A117 BH0479 protein; putative protein binding protein, 98.74
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.74
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.74
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.73
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.72
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.72
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.69
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.68
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.65
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.65
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.65
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.64
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.63
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.6
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.59
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.58
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.57
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.57
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.55
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.53
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.5
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.5
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.47
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.46
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.45
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.41
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.31
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.22
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.22
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.18
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.16
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.12
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.03
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.02
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.01
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.98
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.96
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.91
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.91
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.89
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.83
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.73
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.7
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.69
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.68
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.67
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.64
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.58
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.44
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.29
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.21
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.16
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.01
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.94
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.79
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.46
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.35
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.3
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.99
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.96
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.07
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.0
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 93.38
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.35
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.64
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 89.22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 87.92
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.57
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 82.98
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.75  E-value=6.2e-20  Score=164.46  Aligned_cols=117  Identities=19%  Similarity=0.291  Sum_probs=112.3

Q ss_pred             ccchHHHHHHHhcccccccccchhHHHHHHHhhhccccccccccceeeeeeccccceeeeccccchhhhhhcceeeeccc
Q 007725           98 YEFNAAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDA  177 (591)
Q Consensus        98 ~~~~~a~~lk~~Gn~~~~~g~y~eAi~~Y~kAL~l~p~~~~~e~~~l~~~~~~Nla~~y~~lg~y~eAi~~~~~AL~ldP  177 (591)
                      .+|+.++.++++|+.+++.|+|++|+.+|.++|+++|.++.         +|+|+|.||+++|+|++|+.+|+++|+++|
T Consensus         8 inP~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~---------~~~~~~~~~~~~~~~~~A~~~~~~al~~~p   78 (126)
T 4gco_A            8 INPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAI---------LYSNRAACLTKLMEFQRALDDCDTCIRLDS   78 (126)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHH---------HHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             HCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHH---------HHHHHhhHHHhhccHHHHHHHHHHHHHhhh
Confidence            46777899999999999999999999999999999999876         899999999999999999999999999999


Q ss_pred             cchHHHHHhccchhhhhhHHHHhhhcccccccCCCCChHHHHHhHH
Q 007725          178 KNVKALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDA  223 (591)
Q Consensus       178 ~~~~a~~~rg~al~~lg~~eeAl~~lekAl~l~P~~~~a~~~L~~a  223 (591)
                      +++.+|+++|.+|..+|++++|+.+|+++++++|++.+++..|+.+
T Consensus        79 ~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~l~P~~~~a~~~l~~~  124 (126)
T 4gco_A           79 KFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNC  124 (126)
T ss_dssp             TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCcCCHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999988876



>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 591
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-12
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 7e-10
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-09
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-08
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 4e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.004
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 8e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.003
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 62.7 bits (151), Expect = 3e-12
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 95  QMNYE--FNAAKMLKKQGNELYSEGRFSNALQKYLLA------KKNLQGIHSSEGRTLLL 146
           +M+ +     A ++K++G   +  G++  A+ +Y         +  L    S    + LL
Sbjct: 5   EMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLL 64

Query: 147 ACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVKALYRRGQAYKDIGRLEEAVSDLSNA 206
           A  LN   CYLK ++Y + ++   + L  D+ N K LYRRG+A   +   E A  D    
Sbjct: 65  AAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKV 124

Query: 207 HEVSPDDGTIADVLRDAKEILMKED 231
            EV+P +      +   ++   + +
Sbjct: 125 LEVNPQNKAARLQIFMCQKKAKEHN 149


>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.7
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.67
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.67
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.47
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.43
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.36
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.35
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.35
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.34
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.29
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.29
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.26
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.26
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.14
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.02
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.96
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.92
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.88
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.86
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.85
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.82
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.8
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.76
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.76
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.46
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.31
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.14
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.08
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.84
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.83
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.79
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.67
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.61
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.58
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.96
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.33
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.16
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=4e-19  Score=155.48  Aligned_cols=115  Identities=23%  Similarity=0.275  Sum_probs=109.8

Q ss_pred             HHHHHHHhcccccccccchhHHHHHHHhhhccccccccccceeeeeeccccceeeeccccchhhhhhcceeeeccccchH
Q 007725          102 AAKMLKKQGNELYSEGRFSNALQKYLLAKKNLQGIHSSEGRTLLLACSLNSMSCYLKTKQYDECIKVGSEVLAYDAKNVK  181 (591)
Q Consensus       102 ~a~~lk~~Gn~~~~~g~y~eAi~~Y~kAL~l~p~~~~~e~~~l~~~~~~Nla~~y~~lg~y~eAi~~~~~AL~ldP~~~~  181 (591)
                      .+..++.+|+.++..|+|++|+.+|.++|.++|.++.         +|+++|.||+++|+|++|+.+|+++|+++|+++.
T Consensus         2 ~~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~---------~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~   72 (117)
T d1elwa_           2 QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHV---------LYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGK   72 (117)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHH---------HHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHH
T ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCcchh---------hhhcccccccccccccccchhhhhHHHhccchhh
Confidence            3567899999999999999999999999999999876         8999999999999999999999999999999999


Q ss_pred             HHHHhccchhhhhhHHHHhhhcccccccCCCCChHHHHHhHHHH
Q 007725          182 ALYRRGQAYKDIGRLEEAVSDLSNAHEVSPDDGTIADVLRDAKE  225 (591)
Q Consensus       182 a~~~rg~al~~lg~~eeAl~~lekAl~l~P~~~~a~~~L~~a~~  225 (591)
                      +|+++|.+|..+|++++|+.+|+++++++|+++.++..++.++.
T Consensus        73 ~~~~~g~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~l~~  116 (117)
T d1elwa_          73 GYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA  116 (117)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999988764



>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure