Citrus Sinensis ID: 007731
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 591 | 2.2.26 [Sep-21-2011] | |||||||
| P54947 | 270 | Uncharacterized protein Y | yes | no | 0.436 | 0.955 | 0.288 | 5e-22 | |
| P0A8Y7 | 270 | Phosphatase YidA OS=Shige | yes | no | 0.438 | 0.959 | 0.330 | 1e-21 | |
| P0A8Y5 | 270 | Sugar phosphatase YidA OS | N/A | no | 0.438 | 0.959 | 0.330 | 1e-21 | |
| P0A8Y6 | 270 | Phosphatase YidA OS=Esche | yes | no | 0.438 | 0.959 | 0.330 | 1e-21 | |
| Q5XD45 | 269 | Putative hydrolase M6_Spy | N/A | no | 0.434 | 0.955 | 0.276 | 5e-20 | |
| Q2ILG1 | 193 | Endoribonuclease YbeY OS= | yes | no | 0.194 | 0.595 | 0.430 | 1e-18 | |
| O67367 | 150 | Endoribonuclease YbeY OS= | yes | no | 0.182 | 0.72 | 0.447 | 2e-18 | |
| Q7VE08 | 195 | Endoribonuclease YbeY OS= | yes | no | 0.175 | 0.533 | 0.472 | 2e-18 | |
| Q65H70 | 158 | Endoribonuclease YbeY OS= | no | no | 0.181 | 0.677 | 0.460 | 3e-18 | |
| B9MRS0 | 158 | Endoribonuclease YbeY OS= | yes | no | 0.184 | 0.689 | 0.463 | 9e-18 |
| >sp|P54947|YXEH_BACSU Uncharacterized protein YxeH OS=Bacillus subtilis (strain 168) GN=yxeH PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 106 bits (265), Expect = 5e-22, Method: Compositional matrix adjust.
Identities = 79/274 (28%), Positives = 129/274 (47%), Gaps = 16/274 (5%)
Query: 319 FRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVVATGKTRPAVISALKKVDLVGR 378
++ I DMDGTLLN +++ AL A + G+K+V+ TG+ V L +++L+
Sbjct: 2 YKLIAIDMDGTLLNDHHEVTEEVRDALHAAKAEGVKIVLCTGRPIGGVQRYLDELNLIEE 61
Query: 379 DGIISEFAPGVFIQGLLVHGRQGREIFRR-NLDRDFCREAYQYSWEHKVPLIAFSGDRCL 437
+ + G LV E+ +L D Y S E K P+ F
Sbjct: 62 GDYVIAY------NGALVQNTHTNEVVSELSLGYDDLTSLYDLSLELKTPMHFFDSSNLY 115
Query: 438 TLFDHPLVDSLHTTYHEPKAEIIP----AIEDLLATVDIQKLIFLDTAEGVATTIRPYWS 493
T P D T +E +P I+++ + I K++F+D E ++ I
Sbjct: 116 T----PNRDISEFTVYESYVTQVPLHFRKIDEVPKDILIPKVMFIDKPENLSRVITSIPK 171
Query: 494 EATKDRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEIMAIGDGENDVEMLELA 553
+ +++ +V++ P EI+ SKG+ V+ L LG+ E+M IGD ND+ M+E A
Sbjct: 172 D-VREKYTMVRSAPFFYEILHSEASKGNAVRQLAQLLGIEQAEVMCIGDNGNDLTMIEWA 230
Query: 554 SLGIALSNGSEKAKAVANVIGASNDEDGVADAIY 587
G+A++N + AN SN+E GVA AI+
Sbjct: 231 GCGVAMANAIPEVLEAANFQTRSNNEHGVAHAIH 264
|
Bacillus subtilis (strain 168) (taxid: 224308) |
| >sp|P0A8Y7|YIDA_SHIFL Phosphatase YidA OS=Shigella flexneri GN=yidA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0A8Y5|YIDA_ECOLI Sugar phosphatase YidA OS=Escherichia coli (strain K12) GN=yidA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0A8Y6|YIDA_ECOL6 Phosphatase YidA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yidA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XD45|Y533_STRP6 Putative hydrolase M6_Spy0533 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0533 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q2ILG1|YBEY_ANADE Endoribonuclease YbeY OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ybeY PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O67367|YBEY_AQUAE Endoribonuclease YbeY OS=Aquifex aeolicus (strain VF5) GN=ybeY PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7VE08|YBEY_PROMA Endoribonuclease YbeY OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ybeY PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q65H70|YBEY_BACLD Endoribonuclease YbeY OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=ybeY PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B9MRS0|YBEY_CALBD Endoribonuclease YbeY OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ybeY PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 591 | ||||||
| 296081586 | 570 | unnamed protein product [Vitis vinifera] | 0.964 | 1.0 | 0.755 | 0.0 | |
| 255550974 | 595 | Phosphatase yidA, putative [Ricinus comm | 0.957 | 0.951 | 0.729 | 0.0 | |
| 224142850 | 574 | predicted protein [Populus trichocarpa] | 0.896 | 0.923 | 0.754 | 0.0 | |
| 225429386 | 1499 | PREDICTED: receptor-like protein kinase | 0.852 | 0.336 | 0.805 | 0.0 | |
| 356552642 | 581 | PREDICTED: uncharacterized protein LOC10 | 0.978 | 0.994 | 0.708 | 0.0 | |
| 30682927 | 584 | haloacid dehalogenase-like hydrolase dom | 0.976 | 0.988 | 0.680 | 0.0 | |
| 147856469 | 532 | hypothetical protein VITISV_042331 [Viti | 0.900 | 1.0 | 0.698 | 0.0 | |
| 297822029 | 584 | hypothetical protein ARALYDRAFT_901259 [ | 0.984 | 0.996 | 0.676 | 0.0 | |
| 449502862 | 613 | PREDICTED: uncharacterized LOC101219624 | 0.854 | 0.823 | 0.760 | 0.0 | |
| 449436898 | 591 | PREDICTED: uncharacterized protein LOC10 | 0.854 | 0.854 | 0.760 | 0.0 |
| >gi|296081586|emb|CBI20591.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 849 bits (2193), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 433/573 (75%), Positives = 493/573 (86%), Gaps = 3/573 (0%)
Query: 19 MARIISRATPLPVTRTSYAAISFLNSPSISYKTHRLDASSPSNSSPLFGRGFRVLCRREE 78
MAR++S A+PLP AA F+++ S S+ + SSPS S +FG FR++CR E
Sbjct: 1 MARVLSHASPLPCPSPPSAA--FVSNLSFSHSSIPFQISSPSPKSSIFGAAFRLVCRENE 58
Query: 79 ESVVRSSRKVFAEQRGYRKARRRVAKSKQKELELNVSICIEDELPDDPEVLNIAEMLRLN 138
R R + A QRGYRK RRR AKSK KELEL V ICIE+ELPDDPE+LNIAEMLRL+
Sbjct: 59 RFSKRFGR-ILASQRGYRKLRRRPAKSKAKELELGVKICIEEELPDDPEILNIAEMLRLD 117
Query: 139 APTLMKLAFDSLKDSTYKTRDTAVEDVGGFESIELSILFCNNEFIRKLNKEWRDEDHATD 198
P MKLAF+ +KDS YKTRDT + D+GGFE++ELS+L CN+EFIRKLNKEWRDEDHATD
Sbjct: 118 VPIAMKLAFEGIKDSEYKTRDTTISDLGGFENVELSVLLCNDEFIRKLNKEWRDEDHATD 177
Query: 199 VLSMSQHVPELKLPILMLGDIVISVETAARQAEERGHSLLDEIRILMVHGLLHLLGFDHE 258
VLSMSQH+PELKLPILMLGDIVISVETAARQAEERGH+LLDEIRILMVHGLLHLLGFDHE
Sbjct: 178 VLSMSQHIPELKLPILMLGDIVISVETAARQAEERGHTLLDEIRILMVHGLLHLLGFDHE 237
Query: 259 ISEEAEAEMEKNEEFLLQSLGWKGKGLIQSAYDSETNTNIQVENSDDRKQEGSLRFYKPK 318
IS+EAE EMEK EE LL+SLGWKGKGLIQSAYD+ET+ N ENSDDRK+EGSLRFYKPK
Sbjct: 238 ISDEAEVEMEKEEELLLKSLGWKGKGLIQSAYDAETDGNSHTENSDDRKKEGSLRFYKPK 297
Query: 319 FRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVVATGKTRPAVISALKKVDLVGR 378
F YIFCD+DGT+LNS+S+I+ TT KALKEALSRG+KVVVATGK RPAVI+ALK VDLVG+
Sbjct: 298 FSYIFCDVDGTMLNSKSQITATTTKALKEALSRGVKVVVATGKARPAVITALKAVDLVGK 357
Query: 379 DGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREAYQYSWEHKVPLIAFSGDRCLT 438
DG+ISEF+PGVFIQGLLV+GRQGR+IF+RNLD D CREA+ YS + +VPL+AFS DR LT
Sbjct: 358 DGVISEFSPGVFIQGLLVYGRQGRKIFKRNLDPDVCREAFHYSCKSEVPLVAFSEDRLLT 417
Query: 439 LFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIFLDTAEGVATTIRPYWSEATKD 498
LFDHPLV+SLHT YHEPKAEI+P++E LLA +IQK++FLDTAEGVAT +RPYWSEA
Sbjct: 418 LFDHPLVESLHTVYHEPKAEIMPSVEHLLAIAEIQKVLFLDTAEGVATALRPYWSEAVGG 477
Query: 499 RANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEIMAIGDGENDVEMLELASLGIA 558
RANVVQ+ DMLEIVPPGTSKGSGV+MLLDHL V +E+MAIGDGEND+EMLELASLGIA
Sbjct: 478 RANVVQSQADMLEIVPPGTSKGSGVRMLLDHLNVPAQEVMAIGDGENDIEMLELASLGIA 537
Query: 559 LSNGSEKAKAVANVIGASNDEDGVADAIYRYAF 591
LSNGSEK KAVANVIG SNDEDGVADAIYRYAF
Sbjct: 538 LSNGSEKTKAVANVIGPSNDEDGVADAIYRYAF 570
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255550974|ref|XP_002516535.1| Phosphatase yidA, putative [Ricinus communis] gi|223544355|gb|EEF45876.1| Phosphatase yidA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224142850|ref|XP_002324751.1| predicted protein [Populus trichocarpa] gi|222866185|gb|EEF03316.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225429386|ref|XP_002278343.1| PREDICTED: receptor-like protein kinase HSL1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552642|ref|XP_003544672.1| PREDICTED: uncharacterized protein LOC100810101 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30682927|ref|NP_850072.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] gi|20466676|gb|AAM20655.1| unknown protein [Arabidopsis thaliana] gi|26452541|dbj|BAC43355.1| unknown protein [Arabidopsis thaliana] gi|133778884|gb|ABO38782.1| At2g25870 [Arabidopsis thaliana] gi|330252671|gb|AEC07765.1| haloacid dehalogenase-like hydrolase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147856469|emb|CAN80775.1| hypothetical protein VITISV_042331 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297822029|ref|XP_002878897.1| hypothetical protein ARALYDRAFT_901259 [Arabidopsis lyrata subsp. lyrata] gi|297324736|gb|EFH55156.1| hypothetical protein ARALYDRAFT_901259 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449502862|ref|XP_004161764.1| PREDICTED: uncharacterized LOC101219624 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449436898|ref|XP_004136229.1| PREDICTED: uncharacterized protein LOC101219624 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 591 | ||||||
| TAIR|locus:2043535 | 584 | AT2G25870 [Arabidopsis thalian | 0.984 | 0.996 | 0.661 | 1.1e-199 | |
| UNIPROTKB|Q9KS95 | 273 | VC_1364 "Putative uncharacteri | 0.436 | 0.945 | 0.318 | 9.1e-26 | |
| TIGR_CMR|VC_1364 | 273 | VC_1364 "conserved hypothetica | 0.436 | 0.945 | 0.318 | 9.1e-26 | |
| GENEDB_PFALCIPARUM|PF10_0325 | 288 | PF10_0325 "haloacid dehalogena | 0.467 | 0.958 | 0.276 | 1.5e-24 | |
| UNIPROTKB|Q8IJ74 | 288 | PF10_0325 "Haloacid dehalogena | 0.467 | 0.958 | 0.276 | 1.5e-24 | |
| UNIPROTKB|P0A8Y5 | 270 | yidA [Escherichia coli K-12 (t | 0.438 | 0.959 | 0.334 | 1.1e-23 | |
| UNIPROTKB|P54947 | 270 | yxeH "Uncharacterized protein | 0.436 | 0.955 | 0.291 | 3e-23 | |
| UNIPROTKB|Q8A2F3 | 270 | BT_3352 "Haloacid dehalogenase | 0.441 | 0.966 | 0.270 | 3e-23 | |
| TIGR_CMR|CHY_0268 | 266 | CHY_0268 "HAD-superfamily hydr | 0.424 | 0.943 | 0.281 | 1.3e-22 | |
| TIGR_CMR|BA_5646 | 273 | BA_5646 "hydrolase, haloacid d | 0.441 | 0.956 | 0.267 | 2.7e-21 |
| TAIR|locus:2043535 AT2G25870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1933 (685.5 bits), Expect = 1.1e-199, P = 1.1e-199
Identities = 392/593 (66%), Positives = 461/593 (77%)
Query: 1 MLPRLSSVLRALPSSTAPMARIISRATPLPVTRTSYAAISFLNSPSISYKTHRLDASSPS 60
ML R+ LR +A AR + RAT L + + ++ F +SP + +RLD +S S
Sbjct: 1 MLSRVCPTLRYNRIWSAH-AREMPRATLL-LLQPNF----FHSSPKTAL-VNRLDVTS-S 52
Query: 61 NSSPLFGRGFXXXXXXXXXXXXXXX--XKVFAEQRGYRKARRRVAKSKQKELELNVSICI 118
S +F R F +VFAE+R YRK RRR K KQ ELEL+VSICI
Sbjct: 53 EFSSMFRRSFHALRSTVGDWRKLPKPPGQVFAERREYRKIRRRAPKKKQ-ELELSVSICI 111
Query: 119 EDELPDDPEVLNIAEMLRLNAPTLMKLAFDSLKDSTYKTRDTAVEDVGGFESIELSILFC 178
E++LPDD E+ NIAEMLRLN P M LAF+ LKDS YKTR+T +ED+GG+E++ELS++ C
Sbjct: 112 EEQLPDDLEIQNIAEMLRLNVPMAMTLAFNGLKDSKYKTRETDIEDLGGYETVELSVMLC 171
Query: 179 NNEFIRKLNKEWRDEDHATDVLSMSQHVPELKLPILMLGDIVISVETAARQAEERGHSLL 238
N++FI KLNKEWR EDHATDVLSMSQHVPELKLP+LM+GD+VISVETAARQA ERGH+LL
Sbjct: 172 NDDFICKLNKEWRGEDHATDVLSMSQHVPELKLPVLMMGDLVISVETAARQAAERGHTLL 231
Query: 239 DEIRILMVHGLLHLLGFDHXXXXXXXXXXXXXXXFLLQSLGWKGKGLIQSAYDSETNTNI 298
DEIRIL++HGLLHLLGFDH LL++LGWKGKGLIQSAYD + T +
Sbjct: 232 DEIRILVIHGLLHLLGFDHEISDEAEQEMEEEEELLLKNLGWKGKGLIQSAYDIQKTTTV 291
Query: 299 QVENSDDRKQEGSLRFYKPKFRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVVA 358
Q E SDDRK+ LR YKPKF YIFCDMDGTLLNS+S+IS AKALKEAL RGLKVV+A
Sbjct: 292 QPEKSDDRKEGDGLRLYKPKFSYIFCDMDGTLLNSKSQISEANAKALKEALLRGLKVVIA 351
Query: 359 TGKTRPAVISALKKVDLVGRDGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREAY 418
TGK+RP I LK DL G DGIISE +PGVF+QGLLV+GRQG+E++R NLDRD CRE
Sbjct: 352 TGKSRPGAIRILKTADLTGSDGIISESSPGVFVQGLLVYGRQGKEVYRGNLDRDVCRETC 411
Query: 419 QYSWEHKVPLIAFSGDRCLTLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIFL 478
YS EH++PLIAFS DRCLTLFDHPLVDSLHT Y+EPKAEII +++ L+A DIQK+IF+
Sbjct: 412 LYSLEHRIPLIAFSQDRCLTLFDHPLVDSLHTIYNEPKAEIISSVDQLIAEADIQKVIFM 471
Query: 479 DTAEGVATTIRPYWSEATKDRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEIM 538
DT EGV++ IRPYWSEAT DRANVVQA DMLEIVPPGTSKG+GVKMLL+HLGVS EIM
Sbjct: 472 DTTEGVSSVIRPYWSEATGDRANVVQAQSDMLEIVPPGTSKGNGVKMLLNHLGVSPDEIM 531
Query: 539 AIGDGENDVEMLELASLGIALSNGSEKAKAVANVIGASNDEDGVADAIYRYAF 591
AIGDGEND+EML+LASLG+ALSNG+EK KAVA+VIG SND+DGVADAIYRYAF
Sbjct: 532 AIGDGENDIEMLQLASLGVALSNGAEKTKAVADVIGVSNDQDGVADAIYRYAF 584
|
|
| UNIPROTKB|Q9KS95 VC_1364 "Putative uncharacterized protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1364 VC_1364 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF10_0325 PF10_0325 "haloacid dehalogenase-like hydrolase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IJ74 PF10_0325 "Haloacid dehalogenase-like hydrolase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A8Y5 yidA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54947 yxeH "Uncharacterized protein YxeH" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8A2F3 BT_3352 "Haloacid dehalogenase-like hydrolase" [Bacteroides thetaiotaomicron VPI-5482 (taxid:226186)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0268 CHY_0268 "HAD-superfamily hydrolase, subfamily IIB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5646 BA_5646 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00032126001 | SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (570 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 591 | |||
| PLN02887 | 580 | PLN02887, PLN02887, hydrolase family protein | 0.0 | |
| pfam08282 | 254 | pfam08282, Hydrolase_3, haloacid dehalogenase-like | 2e-59 | |
| TIGR00099 | 256 | TIGR00099, Cof-subfamily, Cof subfamily of IIB sub | 4e-52 | |
| COG0561 | 264 | COG0561, Cof, Predicted hydrolases of the HAD supe | 6e-52 | |
| PRK00016 | 159 | PRK00016, PRK00016, metal-binding heat shock prote | 3e-42 | |
| pfam02130 | 142 | pfam02130, UPF0054, Uncharacterized protein family | 3e-42 | |
| TIGR00043 | 110 | TIGR00043, TIGR00043, probable rRNA maturation fac | 6e-38 | |
| PRK10513 | 270 | PRK10513, PRK10513, sugar phosphate phosphatase; P | 2e-37 | |
| COG0319 | 153 | COG0319, COG0319, Predicted metal-dependent hydrol | 6e-37 | |
| PRK01158 | 230 | PRK01158, PRK01158, phosphoglycolate phosphatase; | 2e-24 | |
| PRK15126 | 272 | PRK15126, PRK15126, thiamin pyrimidine pyrophospha | 1e-18 | |
| TIGR01484 | 204 | TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, | 1e-16 | |
| PRK10976 | 266 | PRK10976, PRK10976, putative hydrolase; Provisiona | 2e-16 | |
| TIGR01487 | 215 | TIGR01487, Pglycolate_arch, phosphoglycolate phosp | 3e-15 | |
| PRK10530 | 272 | PRK10530, PRK10530, pyridoxal phosphate (PLP) phos | 2e-14 | |
| PRK13963 | 258 | PRK13963, PRK13963, unkown domain/putative metallo | 7e-14 | |
| TIGR01482 | 225 | TIGR01482, SPP-subfamily, sucrose-phosphate phosph | 2e-13 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 2e-10 | |
| PRK00192 | 273 | PRK00192, PRK00192, mannosyl-3-phosphoglycerate ph | 2e-08 | |
| pfam05116 | 247 | pfam05116, S6PP, Sucrose-6F-phosphate phosphohydro | 1e-06 | |
| TIGR00338 | 219 | TIGR00338, serB, phosphoserine phosphatase SerB | 7e-06 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 3e-05 | |
| PRK10530 | 272 | PRK10530, PRK10530, pyridoxal phosphate (PLP) phos | 1e-04 | |
| COG0560 | 212 | COG0560, SerB, Phosphoserine phosphatase [Amino ac | 1e-04 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 2e-04 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 2e-04 | |
| PRK11133 | 322 | PRK11133, serB, phosphoserine phosphatase; Provisi | 3e-04 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 5e-04 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 0.002 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 0.004 |
| >gnl|CDD|215479 PLN02887, PLN02887, hydrolase family protein | Back alignment and domain information |
|---|
Score = 959 bits (2480), Expect = 0.0
Identities = 425/594 (71%), Positives = 482/594 (81%), Gaps = 17/594 (2%)
Query: 1 MLPRLSSVLRALPSSTAPMARIISRATP--LPVTRTSYAAISFLNSPSISYKTHRLDASS 58
MLP LS V S + R+ A P R S SP S +RLD +S
Sbjct: 1 MLPMLSRV-----SLPLRLPRLFPAAAREMPPAARLLLQPSSLSFSPKTS-NFNRLDVTS 54
Query: 59 PSNSSPLFGRGFRVLCRREEESVVRSSRKVFAEQRGYRKARRR-VAKSKQKELELNVSIC 117
SS F +GF + +V+A RGYRK RRR K++ELEL+VSIC
Sbjct: 55 TEFSS--FRKGFHAFRSTKPRG------RVWAAHRGYRKIRRRAPPPKKEQELELSVSIC 106
Query: 118 IEDELPDDPEVLNIAEMLRLNAPTLMKLAFDSLKDSTYKTRDTAVEDVGGFESIELSILF 177
IE++LPDDPE+LNIAE+LRLN P MKLAFD LKDS YKTRDT + DVGG++S+ELS++
Sbjct: 107 IEEDLPDDPEILNIAELLRLNVPMAMKLAFDGLKDSKYKTRDTDISDVGGYDSVELSVML 166
Query: 178 CNNEFIRKLNKEWRDEDHATDVLSMSQHVPELKLPILMLGDIVISVETAARQAEERGHSL 237
CN++FIRKLNKEWR EDHATDVLSMSQHVP LKLP+LMLGDIVISVETAARQAEERGH+L
Sbjct: 167 CNDDFIRKLNKEWRGEDHATDVLSMSQHVPGLKLPVLMLGDIVISVETAARQAEERGHTL 226
Query: 238 LDEIRILMVHGLLHLLGFDHEISEEAEAEMEKNEEFLLQSLGWKGKGLIQSAYDSETNTN 297
LDEIRIL+VHGLLHLLGFDHEIS EAEAEMEK EE LL+SLGWKGKGLIQSAYD+E
Sbjct: 227 LDEIRILVVHGLLHLLGFDHEISNEAEAEMEKEEELLLKSLGWKGKGLIQSAYDAEKTQT 286
Query: 298 IQVENSDDRKQEGSLRFYKPKFRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVV 357
Q+E SDDRK+EGSLRFYKPKF YIFCDMDGTLLNS+S+IS T AKALKEALSRG+KVV+
Sbjct: 287 DQLEKSDDRKKEGSLRFYKPKFSYIFCDMDGTLLNSKSQISETNAKALKEALSRGVKVVI 346
Query: 358 ATGKTRPAVISALKKVDLVGRDGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREA 417
ATGK RPAVI LK VDL G+DGIISE +PGVF+QGLLV+GRQGREI+R NLD++ CREA
Sbjct: 347 ATGKARPAVIDILKMVDLAGKDGIISESSPGVFLQGLLVYGRQGREIYRSNLDQEVCREA 406
Query: 418 YQYSWEHKVPLIAFSGDRCLTLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIF 477
YS EHK+PLIAFS DRCLTLFDHPLVDSLHT YHEPKAEI+ +++ LLA DIQK+IF
Sbjct: 407 CLYSLEHKIPLIAFSQDRCLTLFDHPLVDSLHTIYHEPKAEIMSSVDQLLAAADIQKVIF 466
Query: 478 LDTAEGVATTIRPYWSEATKDRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEI 537
LDTAEGV++ +RPYWSEAT DRANVVQA PDMLEIVPPGTSKG+GVKMLL+HLGVS EI
Sbjct: 467 LDTAEGVSSVLRPYWSEATGDRANVVQAQPDMLEIVPPGTSKGNGVKMLLNHLGVSPDEI 526
Query: 538 MAIGDGENDVEMLELASLGIALSNGSEKAKAVANVIGASNDEDGVADAIYRYAF 591
MAIGDGEND+EML+LASLG+ALSNG+EK KAVA+VIG SNDEDGVADAIYRYAF
Sbjct: 527 MAIGDGENDIEMLQLASLGVALSNGAEKTKAVADVIGVSNDEDGVADAIYRYAF 580
|
Length = 580 |
| >gnl|CDD|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234575 PRK00016, PRK00016, metal-binding heat shock protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216891 pfam02130, UPF0054, Uncharacterized protein family UPF0054 | Back alignment and domain information |
|---|
| >gnl|CDD|232796 TIGR00043, TIGR00043, probable rRNA maturation factor YbeY | Back alignment and domain information |
|---|
| >gnl|CDD|182509 PRK10513, PRK10513, sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223396 COG0319, COG0319, Predicted metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185080 PRK15126, PRK15126, thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233434 TIGR01484, HAD-SF-IIB, HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >gnl|CDD|182878 PRK10976, PRK10976, putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213628 TIGR01487, Pglycolate_arch, phosphoglycolate phosphatase, TA0175-type | Back alignment and domain information |
|---|
| >gnl|CDD|182523 PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237573 PRK13963, PRK13963, unkown domain/putative metalloprotease fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233433 TIGR01482, SPP-subfamily, sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|234684 PRK00192, PRK00192, mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218442 pfam05116, S6PP, Sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|182523 PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|182988 PRK11133, serB, phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 591 | |||
| PLN02887 | 580 | hydrolase family protein | 100.0 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 100.0 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 100.0 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 100.0 | |
| COG0319 | 153 | Predicted metal-dependent hydrolase [General funct | 100.0 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 100.0 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 100.0 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 100.0 | |
| PRK13963 | 258 | unkown domain/putative metalloprotease fusion prot | 100.0 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 100.0 | |
| TIGR00043 | 110 | metalloprotein, YbeY/UPF0054 family. This minimall | 100.0 | |
| PRK00016 | 159 | metal-binding heat shock protein; Provisional | 100.0 | |
| PF02130 | 145 | UPF0054: Uncharacterized protein family UPF0054; I | 100.0 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 100.0 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 100.0 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 100.0 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 100.0 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 100.0 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 100.0 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.97 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.97 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 99.96 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.96 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.96 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.95 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.93 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.93 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 99.92 | |
| PLN02423 | 245 | phosphomannomutase | 99.91 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.91 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 99.9 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.89 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 99.83 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 99.81 | |
| PLN02580 | 384 | trehalose-phosphatase | 99.77 | |
| PLN03017 | 366 | trehalose-phosphatase | 99.71 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.7 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.69 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.68 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.66 | |
| PLN02151 | 354 | trehalose-phosphatase | 99.65 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 99.59 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.59 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 99.58 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 99.56 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 99.53 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 99.5 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 99.31 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 99.28 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.24 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.22 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.18 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 99.14 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.12 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.11 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.1 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 99.1 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 99.1 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.07 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.05 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.03 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 99.03 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.02 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 99.01 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.0 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 98.98 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 98.97 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 98.96 | |
| PF03332 | 220 | PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 | 98.96 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 98.92 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 98.91 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 98.91 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 98.89 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.88 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 98.88 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 98.86 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.86 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 98.85 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 98.85 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 98.85 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 98.81 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 98.8 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 98.79 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 98.78 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.74 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.72 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 98.72 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 98.68 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.66 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 98.66 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.63 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 98.63 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 98.63 | |
| PLN02940 | 382 | riboflavin kinase | 98.62 | |
| KOG1050 | 732 | consensus Trehalose-6-phosphate synthase component | 98.62 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 98.59 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 98.59 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.58 | |
| PRK06769 | 173 | hypothetical protein; Validated | 98.58 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.55 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 98.55 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 98.54 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 98.52 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 98.51 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 98.51 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 98.49 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 98.47 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 98.46 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 98.46 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 98.44 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 98.44 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 98.43 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 98.42 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.42 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 98.39 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 98.37 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 98.37 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 98.37 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 98.33 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.33 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 98.33 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.32 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 98.3 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 98.29 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 98.29 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 98.28 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.28 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 98.28 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 98.28 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 98.28 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 98.27 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 98.26 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 98.26 | |
| PRK08238 | 479 | hypothetical protein; Validated | 98.26 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 98.25 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 98.23 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 98.22 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.22 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.21 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 98.21 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 98.2 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 98.19 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.16 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 98.15 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 98.14 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 98.14 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 98.14 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.12 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 98.11 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 98.09 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.03 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 97.95 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.95 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 97.92 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 97.91 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 97.89 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.87 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 97.85 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 97.83 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 97.81 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 97.79 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 97.79 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 97.77 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 97.76 | |
| PLN02887 | 580 | hydrolase family protein | 97.73 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 97.68 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 97.65 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.62 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 97.59 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 97.5 | |
| PLN02811 | 220 | hydrolase | 97.47 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 97.44 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 97.38 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 97.37 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 97.25 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 97.19 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 97.16 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 97.1 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 97.05 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 97.02 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 97.01 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 96.99 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 96.97 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 96.94 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 96.9 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 96.89 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 96.84 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 96.79 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 96.63 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 96.57 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 96.49 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 96.38 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 96.33 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 96.32 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 96.32 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.07 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 95.43 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 95.38 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 95.23 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 95.16 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 94.38 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 94.27 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 94.15 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 94.14 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 93.18 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 92.53 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 91.75 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 91.58 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 89.73 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 89.28 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 88.68 | |
| PF11350 | 203 | DUF3152: Protein of unknown function (DUF3152); In | 87.78 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 87.61 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 87.5 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 87.46 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 86.24 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 85.74 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 80.95 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 80.91 |
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-113 Score=950.86 Aligned_cols=547 Identities=75% Similarity=1.164 Sum_probs=478.8
Q ss_pred hhcccCCCCccccccCCCCCC----CCCCCCcccccccccccccccccccccchhhhhhhhhhhcccCC-Ccccccccee
Q 007731 38 AISFLNSPSISYKTHRLDASS----PSNSSPLFGRGFRVLCRREEESVVRSSRKVFAEQRGYRKARRRV-AKSKQKELEL 112 (591)
Q Consensus 38 ~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~ 112 (591)
+.++..++++||.++.+...+ +++++| |.+|||++++++.+ +|+||.+|+|||.|||| ||||++++++
T Consensus 29 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 101 (580)
T PLN02887 29 ARLLLQPSSLSFSPKTSNFNRLDVTSTEFSS-FRKGFHAFRSTKPR------GRVWAAHRGYRKIRRRAPPPKKEQELEL 101 (580)
T ss_pred hhhhcCccccccCCCCCCCccccCCCCchhh-HHHHHHHHhhcCcc------ccchhhhccCccccCCCCCCCcccceee
Confidence 334455556666543332211 224455 89999999999888 89999999999999985 7789999999
Q ss_pred EEEEEecCCCCChhHHHHHHHHhhhchhHHHHHHhhhcccccccccchhhhccCCCceeeEEEEEeChHHHHHHHHHHhC
Q 007731 113 NVSICIEDELPDDPEVLNIAEMLRLNAPTLMKLAFDSLKDSTYKTRDTAVEDVGGFESIELSILFCNNEFIRKLNKEWRD 192 (591)
Q Consensus 113 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~i~~~~~~~~~~lN~~~r~ 192 (591)
.++|+||+++|+|+++.+++|.+|++||+||+.|+++|++|.|+|+++.|++++++...||||+||||++|++||++|||
T Consensus 102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~elsv~~~~d~~i~~LN~~yr~ 181 (580)
T PLN02887 102 SVSICIEEDLPDDPEILNIAELLRLNVPMAMKLAFDGLKDSKYKTRDTDISDVGGYDSVELSVMLCNDDFIRKLNKEWRG 181 (580)
T ss_pred eEEEeeccCCCCCHHHHHHHHHHhhccHHHHHHHhhhcccccccccchHHHhcCCCCceEEEEEEECHHHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCcEeeccCCCCCCCCCccccccEEeeHHHHHHHHHHhCCCHHHHHHHHHHHhhhhhcCCCCCCCHHHHHHHHHHHH
Q 007731 193 EDHATDVLSMSQHVPELKLPILMLGDIVISVETAARQAEERGHSLLDEIRILMVHGLLHLLGFDHEISEEAEAEMEKNEE 272 (591)
Q Consensus 193 ~d~~TdVlSF~~~~~~~~~~~~~lGdi~i~~~~~~~~a~~~~~~~~~~~~~l~vHG~LHLlGyDh~~~~~~~~~M~~~e~ 272 (591)
+|+||||||||++.|+.+.+..+|||||||++++++||+|+|+++++|+.+|+|||+|||+||||+++++++++|+.+|+
T Consensus 182 ~d~~TDVLSF~~~~~~~~~~~~~lGDIvIs~~~~~~qA~e~~~s~~~el~~l~vHG~LHLlGyDH~~~~~~~~~M~~~e~ 261 (580)
T PLN02887 182 EDHATDVLSMSQHVPGLKLPVLMLGDIVISVETAARQAEERGHTLLDEIRILVVHGLLHLLGFDHEISNEAEAEMEKEEE 261 (580)
T ss_pred CCCCCcEEeccCcCCCCCCCCccceEEEEeHHHHHHHHHHhCCCHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHH
Confidence 99999999999876655545568999999999999999999999999999999999999999999987777889999999
Q ss_pred HHHHhcCCcccCccccccccccchHHHHhhchhhhccccccccCCCceEEEEecCCCccCCCCCCCHHHHHHHHHHHhcC
Q 007731 273 FLLQSLGWKGKGLIQSAYDSETNTNIQVENSDDRKQEGSLRFYKPKFRYIFCDMDGTLLNSQSKISLTTAKALKEALSRG 352 (591)
Q Consensus 273 ~il~~l~~~~~gl~~~a~d~~~~~~~~l~~~~~~~~~~~l~~~~~~iKlI~fDLDGTLld~~~~is~~~~eaL~~L~~~G 352 (591)
+||++|||+++||++++||+++.++...+.++++++.+.++|++++||+|+|||||||+++++.+++.++++|++++++|
T Consensus 262 ~il~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iKLIa~DLDGTLLn~d~~Is~~t~eAI~kl~ekG 341 (580)
T PLN02887 262 LLLKSLGWKGKGLIQSAYDAEKTQTDQLEKSDDRKKEGSLRFYKPKFSYIFCDMDGTLLNSKSQISETNAKALKEALSRG 341 (580)
T ss_pred HHHHHcCCCCCceeeeecccccccccccccccchhhhcchhhhccCccEEEEeCCCCCCCCCCccCHHHHHHHHHHHHCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CeEEEEcCCChhHHHHHHHhcCCCCCCceeecCCCEEEecCEEEEcCCCcEEEeecCCHHHHHHHHHHHHhCCCCEEEEe
Q 007731 353 LKVVVATGKTRPAVISALKKVDLVGRDGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREAYQYSWEHKVPLIAFS 432 (591)
Q Consensus 353 i~vviaTGRs~~~~~~~l~~lgl~~~d~~I~eng~~I~~NGA~I~d~~g~~i~~~~l~~e~v~eil~~l~~~~i~~~i~~ 432 (591)
+.|++||||++..+..+++.+++...+++|+++++.|++||+.||+.+++.++...++.+.+.++++++.+.++.+.+++
T Consensus 342 i~~vIATGR~~~~i~~~l~~L~l~~~~~~I~~~~p~I~~NGA~I~d~~g~~I~~~~L~~e~v~eIi~~~~~~~i~~~~~~ 421 (580)
T PLN02887 342 VKVVIATGKARPAVIDILKMVDLAGKDGIISESSPGVFLQGLLVYGRQGREIYRSNLDQEVCREACLYSLEHKIPLIAFS 421 (580)
T ss_pred CeEEEEcCCCHHHHHHHHHHhCcccccceEeecccEEeecCeEEEECCCcEEEEEeCCHHHHHHHHHHHHHcCCeEEEEE
Confidence 99999999999999999999987656789999999999999999988888899999999999999999988888887888
Q ss_pred CCceeeecCCcccccccccccCCcccccccHHHhhcccCeeEEEEecChhhHHHhHHHHHHHhccCCeEEEEecCCeeee
Q 007731 433 GDRCLTLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIFLDTAEGVATTIRPYWSEATKDRANVVQAIPDMLEI 512 (591)
Q Consensus 433 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~i~ki~~~~~~~~~~~~l~~~l~~~~~~~~~vv~s~~~~iEI 512 (591)
.+.+|.....+........+.........++.++.....+.|+++...++.....+.+.+...+.+.+.++.+++.++||
T Consensus 422 ~d~~y~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~i~Ki~~~~~~e~~~~~l~~~l~~~~~~~~~v~~S~~~~lEI 501 (580)
T PLN02887 422 QDRCLTLFDHPLVDSLHTIYHEPKAEIMSSVDQLLAAADIQKVIFLDTAEGVSSVLRPYWSEATGDRANVVQAQPDMLEI 501 (580)
T ss_pred CCeEEEecCchHHHHHHHhhccccccccCCHHHhhcccCeeEEEEEcChHHHHHHHHHHHHHHhcCcEEEEEecCcEEEE
Confidence 87777543332221111111111111223344443334678888776655444456666666666778888898899999
Q ss_pred cCCCCCHHHHHHHHHHHcCCCCCcEEEEecChhhHHHHHHCCceEEecCCcHHHHhhcceecCCCChHHHHHHHHHhhC
Q 007731 513 VPPGTSKGSGVKMLLDHLGVSTKEIMAIGDGENDVEMLELASLGIALSNGSEKAKAVANVIGASNDEDGVADAIYRYAF 591 (591)
Q Consensus 513 ~p~gvsKg~AL~~L~e~lgI~~eeviafGDs~NDi~Mlk~ag~gVAmgNA~~elk~~Ad~Vt~s~~edGVa~~L~~~~f 591 (591)
+|+++|||.||+++++++||+.++|+||||+.||++||+.+|+||||+||.+++|+.|++|+.+|+++||+++|++++|
T Consensus 502 ~p~gvSKG~ALk~L~e~lGI~~eeviAFGDs~NDIeMLe~AG~gVAMgNA~eeVK~~Ad~VT~sNdEDGVA~aLek~~~ 580 (580)
T PLN02887 502 VPPGTSKGNGVKMLLNHLGVSPDEIMAIGDGENDIEMLQLASLGVALSNGAEKTKAVADVIGVSNDEDGVADAIYRYAF 580 (580)
T ss_pred ecCCCCHHHHHHHHHHHcCCCHHHEEEEecchhhHHHHHHCCCEEEeCCCCHHHHHhCCEEeCCCCcCHHHHHHHHhhC
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999999987
|
|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0319 Predicted metal-dependent hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK13963 unkown domain/putative metalloprotease fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR00043 metalloprotein, YbeY/UPF0054 family | Back alignment and domain information |
|---|
| >PRK00016 metal-binding heat shock protein; Provisional | Back alignment and domain information |
|---|
| >PF02130 UPF0054: Uncharacterized protein family UPF0054; InterPro: IPR002036 These, as yet, uncharacterised proteins are of 17 to 21 kDa | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >KOG1050 consensus Trehalose-6-phosphate synthase component TPS1 and related subunits [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF11350 DUF3152: Protein of unknown function (DUF3152); InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 591 | ||||
| 1rkq_A | 282 | Crystal Structure Of Had-Like Phosphatase Yida From | 1e-22 | ||
| 4dw8_A | 279 | Crystal Structure Of A Haloacid Dehalogenase-Like H | 2e-22 | ||
| 1nf2_A | 268 | X-Ray Crystal Structure Of Tm0651 From Thermotoga M | 6e-21 | ||
| 3niw_A | 279 | Crystal Structure Of A Haloacid Dehalogenase-Like H | 1e-19 | ||
| 2b30_A | 301 | Initial Crystallographic Structural Analysis Of A P | 1e-19 | ||
| 3mpo_A | 279 | The Crystal Structure Of A Hydrolase From Lactobaci | 1e-18 | ||
| 2pq0_A | 258 | Crystal Structure Of Hyopthetical Protein (Gk_1056) | 1e-18 | ||
| 3r4c_A | 268 | Divergence Of Structure And Function Among Phosphat | 6e-18 | ||
| 1ymq_A | 261 | Had Superfamily Phosphotransferase Substrate Divers | 9e-18 | ||
| 1oz9_A | 150 | Crystal Structure Of Aq_1354, A Hypothetical Protei | 2e-17 | ||
| 2rar_A | 261 | X-Ray Crystallographic Structures Show Conservation | 7e-17 | ||
| 1nrw_A | 288 | The Structure Of A Haloacid Dehalogenase-Like Hydro | 1e-14 | ||
| 3l7y_A | 304 | The Crystal Structure Of Smu.1108c From Streptococc | 3e-13 | ||
| 3pgv_A | 285 | Crystal Structure Of A Haloacid Dehalogenase-Like H | 5e-12 | ||
| 1rlm_A | 271 | Crystal Structure Of Ybiv From Escherichia Coli K12 | 9e-10 | ||
| 3dnp_A | 290 | Crystal Structure Of Stress Response Protein Yhax F | 1e-09 | ||
| 1rlo_A | 271 | Phospho-Aspartyl Intermediate Analogue Of Ybiv From | 7e-09 | ||
| 1xax_A | 154 | Nmr Structure Of Hi0004, A Putative Essential Gene | 3e-08 | ||
| 1xm5_A | 155 | Crystal Structure Of Metal-Dependent Hydrolase Ybey | 2e-07 | ||
| 2hf2_A | 283 | Domain Shifting Confirms Monomeric Structure Of Esc | 2e-06 | ||
| 3fzq_A | 274 | Crystal Structure Of Putative Haloacid Dehalogenase | 3e-06 | ||
| 3gyg_A | 289 | Crystal Structure Of Yhjk (Haloacid Dehalogenase-Li | 2e-05 | ||
| 1wr8_A | 231 | Crystal Structure Of Hypothetical Protein Ph1421 Fr | 2e-05 | ||
| 3dao_A | 283 | Crystal Structure Of A Putative Phosphatse (Eubrec_ | 6e-05 | ||
| 1tvi_A | 172 | Solution Structure Of Tm1509 From Thermotoga Mariti | 7e-05 |
| >pdb|1RKQ|A Chain A, Crystal Structure Of Had-Like Phosphatase Yida From E. Coli Length = 282 | Back alignment and structure |
|
| >pdb|4DW8|A Chain A, Crystal Structure Of A Haloacid Dehalogenase-Like Hydrolase (Target Efi-900331) From Bacteroides Thetaiotaomicron With Bound Na Crystal Form I Length = 279 | Back alignment and structure |
| >pdb|1NF2|A Chain A, X-Ray Crystal Structure Of Tm0651 From Thermotoga Maritima Length = 268 | Back alignment and structure |
| >pdb|3NIW|A Chain A, Crystal Structure Of A Haloacid Dehalogenase-Like Hydrolase From Bacteroides Thetaiotaomicron Length = 279 | Back alignment and structure |
| >pdb|2B30|A Chain A, Initial Crystallographic Structural Analysis Of A Putative HadCOF-Like Hydrolase From Plasmodium Vivax Length = 301 | Back alignment and structure |
| >pdb|3MPO|A Chain A, The Crystal Structure Of A Hydrolase From Lactobacillus Brevis Length = 279 | Back alignment and structure |
| >pdb|2PQ0|A Chain A, Crystal Structure Of Hyopthetical Protein (Gk_1056) From Geobacillus Kaustophilus Hta426 Length = 258 | Back alignment and structure |
| >pdb|3R4C|A Chain A, Divergence Of Structure And Function Among Phosphatases Of The Haloalkanoate (Had) Enzyme Superfamily: Analysis Of Bt1666 From Bacteroides Thetaiotaomicron Length = 268 | Back alignment and structure |
| >pdb|1YMQ|A Chain A, Had Superfamily Phosphotransferase Substrate Diversification: Structure And Function Analysis Of The Had Subclass Iib Sugar Phosphatase Bt4131 Length = 261 | Back alignment and structure |
| >pdb|1OZ9|A Chain A, Crystal Structure Of Aq_1354, A Hypothetical Protein From Aquifex Aeolicus Length = 150 | Back alignment and structure |
| >pdb|2RAR|A Chain A, X-Ray Crystallographic Structures Show Conservation Of A Trigonal- Bipyramidal Intermediate In A Phosphoryl-Transfer Superfamily. Length = 261 | Back alignment and structure |
| >pdb|1NRW|A Chain A, The Structure Of A Haloacid Dehalogenase-Like Hydrolase From B. Subtilis Length = 288 | Back alignment and structure |
| >pdb|3L7Y|A Chain A, The Crystal Structure Of Smu.1108c From Streptococcus Mutans Ua159 Length = 304 | Back alignment and structure |
| >pdb|3PGV|A Chain A, Crystal Structure Of A Haloacid Dehalogenase-Like Hydrolase (Kpn_04322) From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.39 A Resolution Length = 285 | Back alignment and structure |
| >pdb|1RLM|A Chain A, Crystal Structure Of Ybiv From Escherichia Coli K12 Length = 271 | Back alignment and structure |
| >pdb|3DNP|A Chain A, Crystal Structure Of Stress Response Protein Yhax From Bacillus Subtilis Length = 290 | Back alignment and structure |
| >pdb|1RLO|A Chain A, Phospho-Aspartyl Intermediate Analogue Of Ybiv From E. Coli K12 Length = 271 | Back alignment and structure |
| >pdb|1XAX|A Chain A, Nmr Structure Of Hi0004, A Putative Essential Gene Product From Haemophilus Influenzae Length = 154 | Back alignment and structure |
| >pdb|1XM5|A Chain A, Crystal Structure Of Metal-Dependent Hydrolase Ybey From E. Coli, Pfam Upf0054 Length = 155 | Back alignment and structure |
| >pdb|2HF2|A Chain A, Domain Shifting Confirms Monomeric Structure Of Escherichia Sugar Phosphatase Suph Length = 283 | Back alignment and structure |
| >pdb|3FZQ|A Chain A, Crystal Structure Of Putative Haloacid Dehalogenase-Like Hydrolase (Yp_001086940.1) From Clostridium Difficile 630 At 2.10 A Resolution Length = 274 | Back alignment and structure |
| >pdb|3GYG|A Chain A, Crystal Structure Of Yhjk (Haloacid Dehalogenase-Like Hydrolase Protein) From Bacillus Subtilis Length = 289 | Back alignment and structure |
| >pdb|1WR8|A Chain A, Crystal Structure Of Hypothetical Protein Ph1421 From Pyrococcus Horikoshii. Length = 231 | Back alignment and structure |
| >pdb|3DAO|A Chain A, Crystal Structure Of A Putative Phosphatse (Eubrec_1417) From Eubacterium Rectale At 1.80 A Resolution Length = 283 | Back alignment and structure |
| >pdb|1TVI|A Chain A, Solution Structure Of Tm1509 From Thermotoga Maritima: Vt1, A Nesgc Target Protein Length = 172 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Length = 301 | Back alignment and structure |
|---|
Score = 246 bits (631), Expect = 1e-77
Identities = 71/294 (24%), Positives = 129/294 (43%), Gaps = 11/294 (3%)
Query: 300 VENSDDRKQEGSLRFYKPKFRYIFCDMDGTLLN-SQSKISLTTAKALKEALSRGLKVVVA 358
+ + D K E +L+ K + D DGTL K+ A+KEA+ +G V +
Sbjct: 10 ADQNPDLKVEEALKGADIK--LLLIDFDGTLFVDKDIKVPSENIDAIKEAIEKGYMVSIC 67
Query: 359 TGKTRPAVISALKKVDLVGRDGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREAY 418
TG+++ ++SA + +L + PGV+I G +V+ + G + ++ D E
Sbjct: 68 TGRSKVGILSAFGEENLKKMNFYGM---PGVYINGTIVYDQIGYTLLDETIETDVYAELI 124
Query: 419 QYSWEHKVP--LIAFSGDRCLTLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLI 476
Y E + I G+ D+ D L Y E ++ II ++L + KL+
Sbjct: 125 SYLVEKNLVNQTIFHRGESNYVTEDNKYADFLQKMYSENRSIIIR-HNEMLKYRTMNKLM 183
Query: 477 FLDTAEGVATTIRPYWSEATKDRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKE 536
+ T + + K++ + E+ G K +G+ LL H +S +
Sbjct: 184 IVLDPSESKT-VIGNLKQKFKNKLTIFTTYNGHAEVTKLGHDKYTGINYLLKHYNISNDQ 242
Query: 537 IMAIGDGENDVEMLELASLGIALSNGSEKAKAVANVI-GASNDEDGVADAIYRY 589
++ +GD END+ ML A++N ++ AK+ A + S+ E VA + +
Sbjct: 243 VLVVGDAENDIAMLSNFKYSFAVANATDSAKSHAKCVLPVSHREGAVAYLLKKV 296
|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} Length = 279 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Length = 282 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Length = 268 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Length = 279 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} Length = 268 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Length = 285 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} Length = 290 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Length = 288 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Length = 258 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Length = 261 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} Length = 274 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Length = 283 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Length = 271 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Length = 304 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Length = 231 | Back alignment and structure |
|---|
| >1oz9_A Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSG structure funded by NIH; 1.89A {Aquifex aeolicus} SCOP: d.92.1.15 Length = 150 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Length = 244 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289 | Back alignment and structure |
|---|
| >1tvi_A Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima} SCOP: d.92.1.15 Length = 172 | Back alignment and structure |
|---|
| >1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} SCOP: d.92.1.15 Length = 155 | Back alignment and structure |
|---|
| >1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} Length = 154 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Length = 275 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Length = 259 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Length = 249 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Length = 219 | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Length = 168 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Length = 176 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Length = 164 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Length = 162 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Length = 189 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Length = 180 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Length = 188 | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} Length = 191 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Length = 195 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Length = 225 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 591 | |||
| 1xm5_A | 155 | Hypothetical UPF0054 protein YBEY; structural geno | 100.0 | |
| 1xax_A | 154 | Hypothetical UPF0054 protein HI0004; structural ge | 100.0 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 100.0 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 100.0 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 100.0 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 100.0 | |
| 1oz9_A | 150 | Hypothetical protein AQ_1354; matrix metalloprotei | 100.0 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 100.0 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 100.0 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 100.0 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 100.0 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 100.0 | |
| 1tvi_A | 172 | Hypothetical UPF0054 protein TM1509; alpha + beta, | 100.0 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 100.0 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 100.0 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 100.0 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 100.0 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 100.0 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 100.0 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 100.0 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 100.0 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 100.0 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 99.97 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 99.97 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.97 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 99.97 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.97 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.96 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 99.96 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.95 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 99.86 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.82 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.82 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.76 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.76 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.75 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.75 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.74 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.73 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.73 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.73 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.72 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.7 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.69 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 99.69 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 99.69 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.67 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.66 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.64 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.63 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.63 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.63 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.62 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.61 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.61 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.61 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.59 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.59 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.58 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.58 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.58 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.58 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.57 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.56 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.55 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.55 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.55 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.54 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.54 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.53 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 99.52 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.52 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.5 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.48 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.48 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.48 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.46 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.46 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.46 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.46 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.46 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.45 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.45 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.44 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.44 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.43 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.42 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.42 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.42 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.42 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.41 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.4 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.4 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.38 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.38 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.37 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.37 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.36 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.34 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.34 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.33 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.3 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.28 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 99.27 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.26 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.25 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.24 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.23 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.23 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 99.22 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.22 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.15 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.15 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.12 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.11 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.11 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 99.1 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.09 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.08 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.08 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 99.08 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.06 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.05 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.05 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.04 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 99.03 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 99.02 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.99 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 98.95 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 98.86 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 98.85 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.83 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.82 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 98.8 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 98.77 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 98.77 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 98.71 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 98.57 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 98.46 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 98.46 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 98.45 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.43 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 97.79 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.41 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.33 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 98.24 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 98.21 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 98.17 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 98.17 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 97.97 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 97.95 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 97.81 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.14 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 97.09 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.06 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 96.95 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 95.3 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 95.19 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 94.66 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 94.04 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 93.48 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 92.08 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 91.4 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 90.73 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 90.42 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 87.21 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 85.65 |
| >1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} SCOP: d.92.1.15 | Back alignment and structure |
|---|
Probab=100.00 E-value=6.1e-42 Score=316.57 Aligned_cols=146 Identities=29% Similarity=0.500 Sum_probs=127.7
Q ss_pred ceeEEEEEecC--CCCChhHHHHHHHHhhhchhHHHHHHhhhcccccccccchhhhccCCCceeeEEEEEeChHHHHHHH
Q 007731 110 LELNVSICIED--ELPDDPEVLNIAEMLRLNAPTLMKLAFDSLKDSTYKTRDTAVEDVGGFESIELSILFCNNEFIRKLN 187 (591)
Q Consensus 110 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~i~~~~~~~~~~lN 187 (591)
+.+++|+.++. .||....+.+|++.+ +... ....||||+||||++|++||
T Consensus 4 ~~l~iqi~~~~~~~~~~~~~~~~~~~~~-----------l~~~-----------------~~~~elsv~~vdd~~i~~LN 55 (155)
T 1xm5_A 4 VILDLQLACEDNSGLPEESQFQTWLNAV-----------IPQF-----------------QEESEVTIRVVDTAESHSLN 55 (155)
T ss_dssp EEEEEEECSSSCCSCCCHHHHHHHHHTT-----------SHHH-----------------HSEEEEEEEEECHHHHHHHH
T ss_pred eEEEEEEecccccCCCCHHHHHHHHHHH-----------HHhc-----------------CCCcEEEEEEECHHHHHHHH
Confidence 67889998875 499989999999862 2110 13489999999999999999
Q ss_pred HHHhCCCCCCcEeeccCCCCCCCCCccccccEEeeHHHHHHHHHHhCCCHHHHHHHHHHHhhhhhcCCCCCCCHHHHHHH
Q 007731 188 KEWRDEDHATDVLSMSQHVPELKLPILMLGDIVISVETAARQAEERGHSLLDEIRILMVHGLLHLLGFDHEISEEAEAEM 267 (591)
Q Consensus 188 ~~~r~~d~~TdVlSF~~~~~~~~~~~~~lGdi~i~~~~~~~~a~~~~~~~~~~~~~l~vHG~LHLlGyDh~~~~~~~~~M 267 (591)
++|||+|+||||||||+..|+. .+..+|||||||+++|+|||+++||++.+|+++|+|||+|||+||||++ ++|+++|
T Consensus 56 ~~yr~~d~pTDVLSFp~~~~~~-~~~~~LGDIvIs~~~v~~qA~e~g~s~~~el~~L~vHG~LHLlGyDH~~-~~e~~~M 133 (155)
T 1xm5_A 56 LTYRGKDKPTNVLSFPFEVPPG-MEMSLLGDLVICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIE-DDEAEEM 133 (155)
T ss_dssp HHHHCCSSCCSEEEEECCCCSS-CCCCEEEEEEEEHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTCCCSS-HHHHHHH
T ss_pred HHHhCCCCCCeEEeECCCCCCC-CCcccCccEEEcHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCCCCC-hhHHHHH
Confidence 9999999999999999986543 2234799999999999999999999999999999999999999999985 8899999
Q ss_pred HHHHHHHHHhcCCcccCc
Q 007731 268 EKNEEFLLQSLGWKGKGL 285 (591)
Q Consensus 268 ~~~e~~il~~l~~~~~gl 285 (591)
+++|++||+.||+++++.
T Consensus 134 ~~~E~~iL~~lg~~~py~ 151 (155)
T 1xm5_A 134 EALETEIMLALGYEDPYI 151 (155)
T ss_dssp HHHHHHHHHHTTCCCSCC
T ss_pred HHHHHHHHHHcCCCCCcc
Confidence 999999999999998764
|
| >1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1oz9_A Hypothetical protein AQ_1354; matrix metalloproteinase type fold, structural genomics, BSG structure funded by NIH; 1.89A {Aquifex aeolicus} SCOP: d.92.1.15 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1tvi_A Hypothetical UPF0054 protein TM1509; alpha + beta, mixed 4-stranded beta sheet, four helix bundle, structural genomics; NMR {Thermotoga maritima} SCOP: d.92.1.15 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 591 | ||||
| d1rkqa_ | 271 | c.108.1.10 (A:) Hypothetical protein YidA {Escheri | 7e-46 | |
| d2rbka1 | 260 | c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B | 6e-44 | |
| d1nrwa_ | 285 | c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu | 3e-43 | |
| d1nf2a_ | 267 | c.108.1.10 (A:) Hypothetical protein TM0651 {Therm | 1e-42 | |
| d1rlma_ | 269 | c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc | 7e-41 | |
| d2b30a1 | 283 | c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod | 1e-40 | |
| d1oz9a_ | 141 | d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquif | 5e-31 | |
| d1s2oa1 | 244 | c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { | 2e-30 | |
| d1xm5a_ | 152 | d.92.1.15 (A:) Hypothetical protein YbeY {Escheric | 2e-29 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 7e-29 | |
| d1tvia_ | 150 | d.92.1.15 (A:) Hypothetical protein TM1509 {Thermo | 2e-28 | |
| d1xvia_ | 232 | c.108.1.10 (A:) Putative mannosyl-3-phosphoglycera | 3e-28 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 1e-27 | |
| d2fuea1 | 244 | c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human | 2e-24 | |
| d2amya1 | 243 | c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( | 4e-24 | |
| d1wzca1 | 243 | c.108.1.10 (A:1-243) Putative mannosyl-3-phosphogl | 3e-23 | |
| d1u02a_ | 229 | c.108.1.15 (A:) Trehalose-6-phosphate phosphatase | 6e-14 | |
| d1j97a_ | 210 | c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon | 8e-10 | |
| d1rkua_ | 206 | c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona | 9e-09 | |
| d1k1ea_ | 177 | c.108.1.5 (A:) Probable phosphatase YrbI {Haemophi | 1e-08 | |
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 5e-05 | |
| d2c4na1 | 250 | c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId | 3e-04 | |
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 3e-04 | |
| d1yv9a1 | 253 | c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En | 5e-04 | |
| d2feaa1 | 226 | c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio | 6e-04 | |
| d1wvia_ | 253 | c.108.1.14 (A:) Putative phosphatase SMU.1415c {St | 0.002 |
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Predicted hydrolases Cof domain: Hypothetical protein YidA species: Escherichia coli [TaxId: 562]
Score = 160 bits (406), Expect = 7e-46
Identities = 81/272 (29%), Positives = 123/272 (45%), Gaps = 6/272 (2%)
Query: 318 KFRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVVATGKTRPAVISALKKVDLVG 377
+ I DMDGTLL IS A+ A +RG+ VV+ TG+ V + LK++ +
Sbjct: 3 AIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQ 62
Query: 378 RDGIISEFAPGVFIQGLLVHGRQGREIFRRNLDRDFCREAYQYSWEHKVPLIAFSGDRCL 437
+ L+ G + + L D R + S E A
Sbjct: 63 PGDYC-----ITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLY 117
Query: 438 TLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIFLDTAEGVATTIRPYWSEATK 497
T ++H ++ + E + K++ +D + I E K
Sbjct: 118 TANRDISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEV-K 176
Query: 498 DRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEIMAIGDGENDVEMLELASLGI 557
++ V+++ P LEI+ +KG+GVK L D LG+ +EIMAIGD END+ M+E A +G+
Sbjct: 177 EKYTVLKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGV 236
Query: 558 ALSNGSEKAKAVANVIGASNDEDGVADAIYRY 589
A+ N K VAN + SN EDGVA AI +Y
Sbjct: 237 AVDNAIPSVKEVANFVTKSNLEDGVAFAIEKY 268
|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 | Back information, alignment and structure |
|---|
| >d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]} Length = 141 | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 | Back information, alignment and structure |
|---|
| >d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} Length = 152 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]} Length = 150 | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 243 | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Length = 177 | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 591 | |||
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 100.0 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 100.0 | |
| d1xm5a_ | 152 | Hypothetical protein YbeY {Escherichia coli [TaxId | 100.0 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 100.0 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 100.0 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 100.0 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 100.0 | |
| d1oz9a_ | 141 | Hypothetical protein Aq_1354 {Aquifex aeolicus [Ta | 100.0 | |
| d1tvia_ | 150 | Hypothetical protein TM1509 {Thermotoga maritima [ | 100.0 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.98 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.98 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.97 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.95 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.94 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 99.92 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 99.92 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.77 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 99.72 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.7 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 99.36 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 99.32 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 99.29 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.28 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.27 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.24 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.08 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.05 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 99.03 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 98.97 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 98.96 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.95 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.93 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.89 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 98.85 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.85 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 98.74 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 98.72 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.72 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 98.69 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 98.68 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 98.67 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 98.61 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 98.6 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 98.59 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 98.57 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 98.39 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 98.36 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 98.3 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 98.1 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 98.08 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 98.06 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.99 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.74 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 97.67 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.49 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 97.26 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 94.94 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 94.16 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 82.36 |
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Predicted hydrolases Cof domain: Hypothetical protein TM0651 species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=4.4e-40 Score=330.57 Aligned_cols=262 Identities=26% Similarity=0.386 Sum_probs=218.7
Q ss_pred CceEEEEecCCCccCCCCCCCHHHHHHHHHHHhcCCeEEEEcCCChhHHHHHHHhcCCCCCCceeecCCCEEEecCEEEE
Q 007731 318 KFRYIFCDMDGTLLNSQSKISLTTAKALKEALSRGLKVVVATGKTRPAVISALKKVDLVGRDGIISEFAPGVFIQGLLVH 397 (591)
Q Consensus 318 ~iKlI~fDLDGTLld~~~~is~~~~eaL~~L~~~Gi~vviaTGRs~~~~~~~l~~lgl~~~d~~I~eng~~I~~NGA~I~ 397 (591)
|+|+|+|||||||+++++.++++++++|+++++ |+.++++|||++..+..+++.++.. ..+.|+.||+.|+
T Consensus 1 m~Kli~~DlDGTL~~~~~~i~~~~~~al~~l~~-~~~~~i~TGR~~~~~~~~~~~~~~~--------~~~~I~~nGa~i~ 71 (267)
T d1nf2a_ 1 MYRVFVFDLDGTLLNDNLEISEKDRRNIEKLSR-KCYVVFASGRMLVSTLNVEKKYFKR--------TFPTIAYNGAIVY 71 (267)
T ss_dssp CBCEEEEECCCCCSCTTSCCCHHHHHHHHHHTT-TSEEEEECSSCHHHHHHHHHHHSSS--------CCCEEEGGGTEEE
T ss_pred CeEEEEEeCCccccCCcCccCHHHHHHHHHHHc-CCEEEEECCCChHHHHHHHHHhccc--------CCceeccCCeEEE
Confidence 689999999999999999999999999999876 5589999999999999988876541 2355667799999
Q ss_pred cCCCcEEEeecCCHHHHHHHHHHHHhCCCCEEEEeCCceeeecCCcccccccccccCCcccccccHHHhhcccCeeEEEE
Q 007731 398 GRQGREIFRRNLDRDFCREAYQYSWEHKVPLIAFSGDRCLTLFDHPLVDSLHTTYHEPKAEIIPAIEDLLATVDIQKLIF 477 (591)
Q Consensus 398 d~~g~~i~~~~l~~e~v~eil~~l~~~~i~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~i~ki~~ 477 (591)
+.+++.++..+++.+.+.++++++.+++..+.++..+.++.....+........... .........+......+.++++
T Consensus 72 ~~~~~~i~~~~i~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~i~~ 150 (267)
T d1nf2a_ 72 LPEEGVILNEKIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNV-DYRVEPNLSELVSKMGTTKLLL 150 (267)
T ss_dssp ETTTEEEEECCBCHHHHHHHHHHHGGGCCCEEEECSSCEEESSCCHHHHHHHHHTTC-CEEECTTHHHHHHHHCBSEEEE
T ss_pred ecccccccccCCCHHHHHHHHHHHHhcCceEEEeeCceEEecCCcHHHHHHHHhcCC-CceecCcHHHHhhhccceEEEE
Confidence 888888999999999999999999999999999888888776554433322221111 1122334445555567777777
Q ss_pred ecChhhHHHhHHHHHHHhccCCeEEEEecCCeeeecCCCCCHHHHHHHHHHHcCCCCCcEEEEecChhhHHHHHHCCceE
Q 007731 478 LDTAEGVATTIRPYWSEATKDRANVVQAIPDMLEIVPPGTSKGSGVKMLLDHLGVSTKEIMAIGDGENDVEMLELASLGI 557 (591)
Q Consensus 478 ~~~~~~~~~~l~~~l~~~~~~~~~vv~s~~~~iEI~p~gvsKg~AL~~L~e~lgI~~eeviafGDs~NDi~Mlk~ag~gV 557 (591)
..+.+ ..+.+.+.+.+.+.+.+.++.+++.++||+|+++|||.|++++++++|++.+++++||||.||++||+.+|+||
T Consensus 151 ~~~~~-~~~~~~~~l~~~~~~~~~~~~~~~~~~di~~~~~~K~~ai~~l~~~~~i~~~~vva~GD~~ND~~ml~~~~~sv 229 (267)
T d1nf2a_ 151 IDTPE-RLDELKEILSERFKDVVKVFKSFPTYLEIVPKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRV 229 (267)
T ss_dssp ECCHH-HHHHHHHHHHHHHTTTSEEEEEETTEEEEECTTCCHHHHHHHHHHHHTCCGGGEEEEECSHHHHHHHTTCSEEE
T ss_pred eccHH-HHHHHHHHHHHhhCCcEEEEEeecceeeecCCCCchhHHHHHHHHhhccCcccEEEEcCCcchHHHHHhCCcEE
Confidence 66554 44567777777777778999999999999999999999999999999999999999999999999999999999
Q ss_pred EecCCcHHHHhhcceecCCCChHHHHHHHHHhh
Q 007731 558 ALSNGSEKAKAVANVIGASNDEDGVADAIYRYA 590 (591)
Q Consensus 558 AmgNA~~elk~~Ad~Vt~s~~edGVa~~L~~~~ 590 (591)
||+||.+++|+.|++|+.+|+++||+++|++++
T Consensus 230 a~~na~~~~k~~A~~i~~~~~~~Gva~~i~~ll 262 (267)
T d1nf2a_ 230 AMENAIEKVKEASDIVTLTNNDSGVSYVLERIS 262 (267)
T ss_dssp ECTTSCHHHHHHCSEECCCTTTTHHHHHHTTBC
T ss_pred EeCCCCHHHHHhCCEEcCCCCccHHHHHHHHHH
Confidence 999999999999999999999999999999875
|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xm5a_ d.92.1.15 (A:) Hypothetical protein YbeY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1oz9a_ d.92.1.15 (A:) Hypothetical protein Aq_1354 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1tvia_ d.92.1.15 (A:) Hypothetical protein TM1509 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|