Citrus Sinensis ID: 007765

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590
MQMLLGPSLRSLRRQLWSSSSSIFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAAVAANLSTKEIVSKVTRRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDLNGEQISEIELASRHKEWSQS
cccccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccccccccccccccccccHHHHHcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHccccEEEEEEEEcccccccccccccccccccEEEEcccEEEEcccccccccEEEEEEccccEEEEEEEEEEcccccEEEEEEEccccccccccEEcccccccccEEEEEEccccccccEEEEEEEEccccccccccccEEEEEEEEccccccccccccccccEEEEEEEEEEcccccEEEEEcHHHHHHHHHHHHHcccEEEEEEEEEEEEEcccHHHHHHccccccccEEEEEEEccccHHHHccccccEEEEEccEEEccccccccccccccHHHHcccccccccEEEEEEEEccEEEEEEEEEEccccccccccccccccccEEccEEEEcccHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEEEccccHHcccccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEEcccEEEEEEcHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccc
ccHHcccHHHHHHHHHcccccHHHEHccHHHHHcHHHHccccEEEEHHHHHcccccEccccccccccccHHHHHHHHHcccccccccccHcccccccccccccccHHHHHHHcccEEEEEEEcccccccccccccccccccccEEEEcccEEEEccEEEccccEEEEEEcccccEEEEEEEEEcccccEEEEEEccHHHcccccccccccccccccEEEEEEcccccccEEEEEEEEEEEccEEEccccccccEEEEEcEEccccccccEEcccEEEEEEEEEccccccEEEEEcHHHHHHHHHHHHHcccEccccEEEEEEEccccHHHHHHccccccccEEEEEEEccccHHHHHcccccEEEEEccEEccccccEccccccEEEHHHHHEccccccEEEEEEEEccEEEEEEEEEcccccccccHccccccccEEEEEEEEEcccHHHHHHHcccccccccHHHHHHHHHHccccccccEEEEEEEccccHHHccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccEEEEEEHHHHHHHHHHHHHHccccccccHHHHHHccccccccccccccccc
mqmllgpslRSLRRQLWsssssifsnyssfnssgllqtfsntlrliilpstsslstistkncnfhyFSTSAAVAANLSTKEIVSKVTRRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFtvssspnyglpwqnksqrettgsgfvipgkkiltnahVVADSTFVLVRkhgsptkyrAQVEAVGHECDLAILIVesdefwegmhflelgdipfLQQAVAVVgypqggdnisvtkgvvsrveptqyvhgATQLMAIQIDAainpgnsggpaimgnkVAGVAFQNlsgaenigyiipvpvIKHFITGVVEHGKYVgfcslglscqttenvqlrnnfgmrsEVTGVLvnkinplsdaheilkkddiilafdgvpiandgtvafrnreriTFDHLvsmkkpnekSLVRVLRDGKEHEFSITLRllqplvpvhqfdklpsyyIFAGLvfipltqpylheygedwyntsprRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENcssenlrfdldddrvVVLNYDVAKiatskilkrhripsamsgdlngeqISEIELASRHKEWSQS
MQMLLGPSLRSLRRQLWSSSSSIFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAavaanlstkeivskvtrrrqrrrlaktcgkttnaYAAIELALDSVVKIFTVSSspnyglpwqnksqretTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITfdhlvsmkkpneksLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDvakiatskilkrhripsamsgdlngeqiSEIELASRHKEWSQS
MQMLLGPslrslrrqlwsssssifsnyssfnssgllQTFSNtlrliilpstsslstistKNCNFHYFSTSAAVAANLSTKEIVSKVTrrrqrrrLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSEnlrfdldddrvvvlnydvAKIATSKILKRHRIPSAMSGDLNGEQISEIELASRHKEWSQS
**********************IFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAAVAANLSTKEIVSKVTRRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQ*******TGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMK****KSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRH******************************
*********************************GLLQTFSNTLRLIILPSTSSLST***************************************************AIELALDSVVKIFTVSS**********************IPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENV*******MRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRL****************YIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERAL***********VILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAM************************
MQMLLGPSLRSLRRQLWSSSSSIFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAAVAANLSTKEIVSK**********AKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDLNGEQISEIEL**********
*************RQLWSSSSSIFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAAVAANLS**********************KTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQN*****TTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAM************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMLLGPSLRSLRRQLWSSSSSIFSNYSSFNSSGLLQTFSNTLRLIILPSTSSLSTISTKNCNFHYFSTSAAVAANLSTKEIVSKVTRRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDLNGEQISEIELASRHKEWSQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query590 2.2.26 [Sep-21-2011]
Q9FIV6586 Protease Do-like 10, mito yes no 0.838 0.844 0.798 0.0
Q9SHZ1559 Putative protease Do-like no no 0.776 0.819 0.623 1e-172
Q9SHZ0518 Protease Do-like 4, mitoc no no 0.759 0.864 0.630 1e-169
Q9FM41486 Putative protease Do-like no no 0.764 0.927 0.566 1e-149
Q9LK71560 Putative protease Do-like no no 0.735 0.775 0.517 1e-134
Q9LK70499 Putative protease Do-like no no 0.803 0.949 0.490 1e-133
Q9FL12592 Protease Do-like 9 OS=Ara no no 0.784 0.782 0.516 1e-126
O82261607 Protease Do-like 2, chlor no no 0.769 0.747 0.453 1e-107
Q9C691219 Putative protease Do-like no no 0.301 0.812 0.474 8e-44
Q3E8B4198 Putative Do-like 15 prote no no 0.281 0.838 0.475 3e-41
>sp|Q9FIV6|DGP10_ARATH Protease Do-like 10, mitochondrial OS=Arabidopsis thaliana GN=DEGP10 PE=2 SV=1 Back     alignment and function desciption
 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/496 (79%), Positives = 443/496 (89%), Gaps = 1/496 (0%)

Query: 88  RRRQRRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVI 147
           R+  RRR A      + A  A++LALDSVVKIFTVS+SP+Y LPWQNKSQRE+ GSGFVI
Sbjct: 87  RKISRRRKAGKSLSISPAADAVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVI 146

Query: 148 PGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLE 207
            G+KI+TNAHVVAD +FVLVRKHGS  K+RA+V+AVGHECDLAIL+V+S+ FWEGM+ LE
Sbjct: 147 SGRKIITNAHVVADHSFVLVRKHGSSIKHRAEVQAVGHECDLAILVVDSEVFWEGMNALE 206

Query: 208 LGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG 267
           LGDIPFLQ+AVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG
Sbjct: 207 LGDIPFLQEAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSG 266

Query: 268 GPAIMGNKVAGVAFQNLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTEN 327
           GPAIMGNKVAGVAFQNLSGAENIGYIIP PVIKHFI GV E GKY+GFCS+G+SCQ  EN
Sbjct: 267 GPAIMGNKVAGVAFQNLSGAENIGYIIPTPVIKHFINGVEECGKYIGFCSMGVSCQPMEN 326

Query: 328 VQLRNNFGMRSEVTGVLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERIT 387
            +LR+ F M SE+TGVLV+KINPLSDAH+ILKKDD++LAFDGVPIANDGTV FRNRERIT
Sbjct: 327 GELRSGFQMSSEMTGVLVSKINPLSDAHKILKKDDVLLAFDGVPIANDGTVPFRNRERIT 386

Query: 388 FDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPL 447
           FDHLVSMKKP+E +LV+VLR+GKEHEFSITLR LQPLVPVHQFD+LPSYYIFAG VF+PL
Sbjct: 387 FDHLVSMKKPDETALVKVLREGKEHEFSITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPL 446

Query: 448 TQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVK 507
           TQPYLHEYGEDWYNTSPR LC RAL++LPKKAG+QLVI+SQVLMDDIN GYER A+LQV 
Sbjct: 447 TQPYLHEYGEDWYNTSPRTLCHRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVN 506

Query: 508 KVNGVEIENLKHLCQLVENCSSENLRFDLDDD-RVVVLNYDVAKIATSKILKRHRIPSAM 566
           KVNGVE+ NL+HLCQL+ENC++E LR DLDD+ RV+VLNY  AKIATS ILKRHRI SA+
Sbjct: 507 KVNGVEVNNLRHLCQLIENCNTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAI 566

Query: 567 SGDLNGEQISEIELAS 582
           S DL  EQ  E ELAS
Sbjct: 567 SSDLLIEQNLETELAS 582
Probable serine protease.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q9SHZ1|DEGP3_ARATH Putative protease Do-like 3, mitochondrial OS=Arabidopsis thaliana GN=DEGP3 PE=3 SV=1 Back     alignment and function description
>sp|Q9SHZ0|DEGP4_ARATH Protease Do-like 4, mitochondrial OS=Arabidopsis thaliana GN=DEGP4 PE=2 SV=1 Back     alignment and function description
>sp|Q9FM41|DGP13_ARATH Putative protease Do-like 13 OS=Arabidopsis thaliana GN=DEGP13 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK71|DGP11_ARATH Putative protease Do-like 11, mitochondrial OS=Arabidopsis thaliana GN=DEGP11 PE=2 SV=2 Back     alignment and function description
>sp|Q9LK70|DGP12_ARATH Putative protease Do-like 12, mitochondrial OS=Arabidopsis thaliana GN=DEGP12 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL12|DEGP9_ARATH Protease Do-like 9 OS=Arabidopsis thaliana GN=DEGP9 PE=2 SV=1 Back     alignment and function description
>sp|O82261|DEGP2_ARATH Protease Do-like 2, chloroplastic OS=Arabidopsis thaliana GN=DEGP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9C691|DEGP6_ARATH Putative protease Do-like 6, chloroplastic OS=Arabidopsis thaliana GN=DEGP6 PE=3 SV=2 Back     alignment and function description
>sp|Q3E8B4|DGP15_ARATH Putative Do-like 15 protein OS=Arabidopsis thaliana GN=DEGP15 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
224098810587 predicted protein [Populus trichocarpa] 0.813 0.817 0.856 0.0
359495826564 PREDICTED: protease Do-like 10, mitochon 0.815 0.852 0.860 0.0
242090545587 hypothetical protein SORBIDRAFT_09g02048 0.798 0.802 0.825 0.0
125552354614 hypothetical protein OsI_19981 [Oryza sa 0.805 0.773 0.823 0.0
413945374585 hypothetical protein ZEAMMB73_513869 [Ze 0.813 0.820 0.814 0.0
222631610563 hypothetical protein OsJ_18561 [Oryza sa 0.805 0.843 0.823 0.0
115463921614 Os05g0417100 [Oryza sativa Japonica Grou 0.805 0.773 0.823 0.0
242051074586 hypothetical protein SORBIDRAFT_02g04114 0.798 0.803 0.825 0.0
357133665585 PREDICTED: protease Do-like 10, mitochon 0.808 0.815 0.819 0.0
449477786601 PREDICTED: protease Do-like 10, mitochon 0.793 0.778 0.844 0.0
>gi|224098810|ref|XP_002311275.1| predicted protein [Populus trichocarpa] gi|222851095|gb|EEE88642.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/488 (85%), Positives = 452/488 (92%), Gaps = 8/488 (1%)

Query: 103 TNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADS 162
           ++AY+AIELALDSVVKIFTVSSSPNY LPWQNKSQRET GSGFVI GKKILTNAHVVAD 
Sbjct: 98  SDAYSAIELALDSVVKIFTVSSSPNYFLPWQNKSQRETMGSGFVITGKKILTNAHVVADH 157

Query: 163 TFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVG 222
           TFVLVRKHGSPTKYRA+V+AVGHECDLAIL+VE++EFW+GM+FLELGDIPFLQ+AVAVVG
Sbjct: 158 TFVLVRKHGSPTKYRAEVQAVGHECDLAILVVENEEFWKGMNFLELGDIPFLQEAVAVVG 217

Query: 223 YPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQ 282
           YPQGGDNISVTKGVVSRVEPTQYVHGA+QLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQ
Sbjct: 218 YPQGGDNISVTKGVVSRVEPTQYVHGASQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQ 277

Query: 283 NLSGAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTG 342
           NLSGAENIGYIIPVPVIKHFI GV E GKYVGFCS+GLSCQ TENVQLR +FGMR E+TG
Sbjct: 278 NLSGAENIGYIIPVPVIKHFINGVEESGKYVGFCSMGLSCQPTENVQLRKHFGMRPEMTG 337

Query: 343 VLVNKINPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSL 402
           VLV+KINPLSDAH +LK DDIILAFDGVPIANDGTV FRNRERITFDHLVSMKKPNE + 
Sbjct: 338 VLVSKINPLSDAHRVLKTDDIILAFDGVPIANDGTVPFRNRERITFDHLVSMKKPNETAS 397

Query: 403 VRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNT 462
           VR+LR G+EHEFSITLR LQPLVPVHQFDKLPSYYIFAGLVF+PLTQPYLHEYGE+WYNT
Sbjct: 398 VRLLRGGEEHEFSITLRPLQPLVPVHQFDKLPSYYIFAGLVFVPLTQPYLHEYGEEWYNT 457

Query: 463 SPRRLCERALRELPKKAGEQLVILSQ-------VLMDDINAGYERFADLQVKKVNGVEIE 515
           SPRRLCERAL+ELPKKA +QL+ILSQ       VLMDDINAGYER A+LQVKKVNGVEI+
Sbjct: 458 SPRRLCERALKELPKKADQQLIILSQACLRFFFVLMDDINAGYERLAELQVKKVNGVEID 517

Query: 516 NLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDLNGEQ- 574
           NLKHLCQL+ +CSSE+LRFDLDDDRV+ LNY  AK+ATS+ILKRHRIPSAMS DL+ EQ 
Sbjct: 518 NLKHLCQLIRDCSSESLRFDLDDDRVIALNYQSAKVATSRILKRHRIPSAMSSDLSAEQN 577

Query: 575 ISEIELAS 582
           I E E AS
Sbjct: 578 IPESESAS 585

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359495826|ref|XP_002265825.2| PREDICTED: protease Do-like 10, mitochondrial-like [Vitis vinifera] gi|296086873|emb|CBI33040.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|242090545|ref|XP_002441105.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor] gi|241946390|gb|EES19535.1| hypothetical protein SORBIDRAFT_09g020480 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|125552354|gb|EAY98063.1| hypothetical protein OsI_19981 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|413945374|gb|AFW78023.1| hypothetical protein ZEAMMB73_513869 [Zea mays] Back     alignment and taxonomy information
>gi|222631610|gb|EEE63742.1| hypothetical protein OsJ_18561 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115463921|ref|NP_001055560.1| Os05g0417100 [Oryza sativa Japonica Group] gi|50511464|gb|AAT77386.1| putative serine protease [Oryza sativa Japonica Group] gi|51854402|gb|AAU10782.1| putative serine protease [Oryza sativa Japonica Group] gi|113579111|dbj|BAF17474.1| Os05g0417100 [Oryza sativa Japonica Group] gi|215706483|dbj|BAG93339.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242051074|ref|XP_002463281.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor] gi|241926658|gb|EER99802.1| hypothetical protein SORBIDRAFT_02g041140 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357133665|ref|XP_003568444.1| PREDICTED: protease Do-like 10, mitochondrial-like isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449477786|ref|XP_004155122.1| PREDICTED: protease Do-like 10, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
TAIR|locus:2167468586 DEG10 "degradation of periplas 0.805 0.810 0.794 1.2e-202
TAIR|locus:2018476559 DEG3 "degradation of periplasm 0.776 0.819 0.611 3.5e-146
TAIR|locus:2173727592 DEG9 "degradation of periplasm 0.784 0.782 0.501 8.2e-115
DICTYBASE|DDB_G0281081647 DDB_G0281081 "Protease degS" [ 0.769 0.701 0.454 1.4e-103
TAIR|locus:2043403607 DEG2 "degradation of periplasm 0.784 0.762 0.434 1.2e-95
TAIR|locus:2008286219 DEG6 "degradation of periplasm 0.289 0.780 0.482 5.9e-41
TAIR|locus:504954966198 DEG16 "degradation of periplas 0.138 0.414 0.566 6e-41
UNIPROTKB|Q74GB5464 degP "Periplasmic trypsin-like 0.449 0.571 0.318 3.6e-21
TIGR_CMR|GSU_0331464 GSU_0331 "trypsin domain/PDZ d 0.449 0.571 0.318 3.6e-21
UNIPROTKB|Q9Z6T0488 htrA "Probable periplasmic ser 0.455 0.551 0.322 7.6e-21
TAIR|locus:2167468 DEG10 "degradation of periplasmic proteins 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1961 (695.4 bits), Expect = 1.2e-202, P = 1.2e-202
 Identities = 378/476 (79%), Positives = 421/476 (88%)

Query:   108 AIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLV 167
             A++LALDSVVKIFTVS+SP+Y LPWQNKSQRE+ GSGFVI G+KI+TNAHVVAD +FVLV
Sbjct:   107 AVDLALDSVVKIFTVSTSPSYFLPWQNKSQRESMGSGFVISGRKIITNAHVVADHSFVLV 166

Query:   168 RKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGG 227
             RKHGS  K+RA+V+AVGHECDLAIL+V+S+ FWEGM+ LELGDIPFLQ+AVAVVGYPQGG
Sbjct:   167 RKHGSSIKHRAEVQAVGHECDLAILVVDSEVFWEGMNALELGDIPFLQEAVAVVGYPQGG 226

Query:   228 DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA 287
             DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA
Sbjct:   227 DNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGNKVAGVAFQNLSGA 286

Query:   288 ENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNK 347
             ENIGYIIP PVIKHFI GV E GKY+GFCS+G+SCQ  EN +LR+ F M SE+TGVLV+K
Sbjct:   287 ENIGYIIPTPVIKHFINGVEECGKYIGFCSMGVSCQPMENGELRSGFQMSSEMTGVLVSK 346

Query:   348 INPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLR 407
             INPLSDAH+ILKKDD++LAFDGVPIANDGTV FRNRERITFDHLVSMKKP+E +LV+VLR
Sbjct:   347 INPLSDAHKILKKDDVLLAFDGVPIANDGTVPFRNRERITFDHLVSMKKPDETALVKVLR 406

Query:   408 DGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRL 467
             +GKEHEFSITLR LQPLVPVHQFD+LPSYYIFAG VF+PLTQPYLHEYGEDWYNTSPR L
Sbjct:   407 EGKEHEFSITLRPLQPLVPVHQFDQLPSYYIFAGFVFVPLTQPYLHEYGEDWYNTSPRTL 466

Query:   468 CERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENC 527
             C RAL++LPKKAG+QLVI+SQVLMDDIN GYER A+LQV KVNGVE+ NL+HLCQL+ENC
Sbjct:   467 CHRALKDLPKKAGQQLVIVSQVLMDDINTGYERLAELQVNKVNGVEVNNLRHLCQLIENC 526

Query:   528 SSEXXXXXXXXXXXXXXXXX-XAKIATSKILKRHRIPSAMSGDLNGEQISEIELAS 582
             ++E                   AKIATS ILKRHRI SA+S DL  EQ  E ELAS
Sbjct:   527 NTEKLRIDLDDESRVIVLNYQSAKIATSLILKRHRIASAISSDLLIEQNLETELAS 582
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS
TAIR|locus:2018476 DEG3 "degradation of periplasmic proteins 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173727 DEG9 "degradation of periplasmic proteins 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281081 DDB_G0281081 "Protease degS" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2043403 DEG2 "degradation of periplasmic proteins 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008286 DEG6 "degradation of periplasmic proteins 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954966 DEG16 "degradation of periplasmic proteins 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q74GB5 degP "Periplasmic trypsin-like serine protease DegP" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0331 GSU_0331 "trypsin domain/PDZ domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z6T0 htrA "Probable periplasmic serine endoprotease DegP-like" [Chlamydia pneumoniae (taxid:83558)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIV6DGP10_ARATH3, ., 4, ., 2, 1, ., -0.79830.83890.8447yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VIII.1400.1
hypothetical protein (492 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 4e-35
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 8e-30
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 3e-15
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 2e-14
pfam00089218 pfam00089, Trypsin, Trypsin 1e-13
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-10
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-08
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provision 2e-07
PRK10139455 PRK10139, PRK10139, serine endoprotease; Provision 8e-07
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provision 8e-06
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  135 bits (341), Expect = 4e-35
 Identities = 89/339 (26%), Positives = 146/339 (43%), Gaps = 34/339 (10%)

Query: 92  RRRLAKTCGKTTNAYAAIELALDSVVKIFTVSSSPNYGLPWQNKSQRET--TGSGFVIPG 149
            R L    G+  +   A+E    +VV I T  ++        +   R     GSGF+I  
Sbjct: 22  GRALTSAAGQRLSFATAVEKVAPAVVSIATGLTAKLRSFFPSDPPLRSAEGLGSGFIISS 81

Query: 150 K-KILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLEL 208
              I+TN HV+A +  + V       +  A++       DLA+L ++       +     
Sbjct: 82  DGYIVTNNHVIAGAEEITVTLADG-REVPAKLVGKDPISDLAVLKIDGAGGLPVIAL-GD 139

Query: 209 GDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGG 268
            D   +   V  +G P G    +VT G+VS +  T        +  IQ DAAINPGNSGG
Sbjct: 140 SDKLRVGDVVVAIGNPFGLGQ-TVTSGIVSALGRTGVGSAGGYVNFIQTDAAINPGNSGG 198

Query: 269 PAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVIKHFITGVVEHGK----YVGFCSLGL 320
           P + +  +V G+    ++   G+  IG+ IPV ++   +  ++  GK    Y+G      
Sbjct: 199 PLVNIDGEVVGINTAIIAPSGGSSGIGFAIPVNLVAPVLDELISKGKVVRGYLGVIG--- 255

Query: 321 SCQTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEI-LKKDDIILAFDGVPIANDGTVA 379
                E +      G+     G +V  + P S A +  +K  DII A +G P+A+     
Sbjct: 256 -----EPLTADIALGL-PVAAGAVVLGVLPGSPAAKAGIKAGDIITAVNGKPVAS--LSD 307

Query: 380 FRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITL 418
                       V+  +P ++  +++LR GKE E ++TL
Sbjct: 308 LVAA--------VASNRPGDEVALKLLRGGKERELAVTL 338

Length = 347
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 590
PRK10139455 serine endoprotease; Provisional 100.0
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
PRK10942473 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10898353 serine endoprotease; Provisional 100.0
KOG1320473 consensus Serine protease [Posttranslational modif 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 100.0
KOG1421 955 consensus Predicted signaling-associated protein ( 100.0
KOG1320473 consensus Serine protease [Posttranslational modif 99.92
KOG1421955 consensus Predicted signaling-associated protein ( 99.83
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.78
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.69
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.52
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.41
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.38
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.34
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 99.24
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.23
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.07
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 99.03
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.01
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.97
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.81
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.78
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.77
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.74
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.69
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 98.63
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.59
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.54
PRK10139455 serine endoprotease; Provisional 98.47
KOG3627256 consensus Trypsin [Amino acid transport and metabo 98.42
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.41
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.38
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.36
KOG3209984 consensus WW domain-containing protein [General fu 98.35
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.33
PRK10942473 serine endoprotease; Provisional 98.31
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.3
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.29
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.29
PRK10898353 serine endoprotease; Provisional 98.24
PRK10779449 zinc metallopeptidase RseP; Provisional 98.21
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.2
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.19
PF1281278 PDZ_1: PDZ-like domain 98.13
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.12
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.1
PLN00049389 carboxyl-terminal processing protease; Provisional 98.09
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.0
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 97.98
KOG3209984 consensus WW domain-containing protein [General fu 97.97
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.93
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.91
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 97.89
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.83
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 97.83
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.83
KOG3580 1027 consensus Tight junction proteins [Signal transduc 97.79
PRK09681276 putative type II secretion protein GspC; Provision 97.72
COG3480342 SdrC Predicted secreted protein containing a PDZ d 97.66
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 97.64
KOG3580 1027 consensus Tight junction proteins [Signal transduc 97.59
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.57
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 97.5
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.48
COG5640413 Secreted trypsin-like serine protease [Posttransla 97.46
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 97.39
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.37
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.36
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.29
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 97.27
COG3975558 Predicted protease with the C-terminal PDZ domain 97.17
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.15
PRK11186 667 carboxy-terminal protease; Provisional 97.11
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.9
COG0265347 DegQ Trypsin-like serine proteases, typically peri 96.77
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 96.64
COG3031275 PulC Type II secretory pathway, component PulC [In 96.61
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.58
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 96.56
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 96.48
KOG3605829 consensus Beta amyloid precursor-binding protein [ 96.39
PRK11186 667 carboxy-terminal protease; Provisional 95.88
PF1281278 PDZ_1: PDZ-like domain 95.45
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 95.36
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 95.19
PRK09681276 putative type II secretion protein GspC; Provision 95.08
KOG3129231 consensus 26S proteasome regulatory complex, subun 94.75
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 94.62
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 94.45
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 94.41
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 94.39
PF10459 698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 94.14
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 93.97
KOG3532 1051 consensus Predicted protein kinase [General functi 93.91
COG3975558 Predicted protease with the C-terminal PDZ domain 93.09
KOG3532 1051 consensus Predicted protein kinase [General functi 92.85
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 92.8
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 92.26
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 91.76
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 90.16
KOG2921 484 consensus Intramembrane metalloprotease (sterol-re 89.64
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 89.6
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 88.86
COG0750375 Predicted membrane-associated Zn-dependent proteas 88.62
KOG3571626 consensus Dishevelled 3 and related proteins [Gene 88.35
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 87.61
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 87.47
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 87.43
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 86.52
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 85.2
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 84.76
COG3031275 PulC Type II secretory pathway, component PulC [In 84.63
PF03510105 Peptidase_C24: 2C endopeptidase (C24) cysteine pro 84.59
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 84.08
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 83.6
KOG3551 506 consensus Syntrophins (type beta) [Extracellular s 82.94
KOG3605829 consensus Beta amyloid precursor-binding protein [ 82.92
KOG3651 429 consensus Protein kinase C, alpha binding protein 82.87
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 82.47
PF05416535 Peptidase_C37: Southampton virus-type processing p 82.06
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 80.7
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 80.61
COG0750 375 Predicted membrane-associated Zn-dependent proteas 80.18
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-57  Score=486.39  Aligned_cols=390  Identities=21%  Similarity=0.310  Sum_probs=317.9

Q ss_pred             cHHHHHHHhCCCcEEEEeeecCC----------CCC---CCccCCCCCCceEEEEEEe--CCeEEEcCcccCCCcEEEEE
Q 007765          104 NAYAAIELALDSVVKIFTVSSSP----------NYG---LPWQNKSQRETTGSGFVIP--GKKILTNAHVVADSTFVLVR  168 (590)
Q Consensus       104 ~~~~~~~~~~~sVV~I~~~~~~~----------~~~---~p~~~~~~~~~~GsGfiI~--~g~IlT~aHvv~~~~~i~V~  168 (590)
                      ++.++++++.||||.|.+.....          .++   .||+......+.||||||+  +||||||+|||++++.+.|+
T Consensus        41 ~~~~~~~~~~pavV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~~a~~i~V~  120 (455)
T PRK10139         41 SLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVINQAQKISIQ  120 (455)
T ss_pred             cHHHHHHHhCCcEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhCCCCEEEEE
Confidence            68999999999999999865321          011   2444444456899999997  58999999999999999999


Q ss_pred             EcCCCcEEEEEEEEecCCCCeEEEEecCCcccCcceeEEcCCCC--CCCCeEEEEecCCCCCCceEEEeEEecccccccc
Q 007765          169 KHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIP--FLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYV  246 (590)
Q Consensus       169 ~~~~~~~~~a~vv~~d~~~DlAlLkv~~~~~~~~~~~~~l~~~~--~~G~~V~~iG~p~g~~~~~v~~G~Vs~~~~~~~~  246 (590)
                      +. |+++++|++++.|+.+||||||++.+.   .+++++|+++.  .+|++|+++|||++.. .+++.|+|+.+.+....
T Consensus       121 ~~-dg~~~~a~vvg~D~~~DlAvlkv~~~~---~l~~~~lg~s~~~~~G~~V~aiG~P~g~~-~tvt~GivS~~~r~~~~  195 (455)
T PRK10139        121 LN-DGREFDAKLIGSDDQSDIALLQIQNPS---KLTQIAIADSDKLRVGDFAVAVGNPFGLG-QTATSGIISALGRSGLN  195 (455)
T ss_pred             EC-CCCEEEEEEEEEcCCCCEEEEEecCCC---CCceeEecCccccCCCCEEEEEecCCCCC-CceEEEEEccccccccC
Confidence            97 899999999999999999999998653   68999999876  5699999999999976 58999999998775332


Q ss_pred             cCcceeeEEEEcccccCCCCCceEE-eCCEEEEEEeeecC---CCCceeEEeehHHHHHHHHHHHHcCccccccccccce
Q 007765          247 HGATQLMAIQIDAAINPGNSGGPAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSC  322 (590)
Q Consensus       247 ~~~~~~~~i~~~~~i~~G~SGGPl~-~~G~vVGI~~~~~~---~~~~~~~aip~~~i~~~l~~l~~~g~~~~~~~lGi~~  322 (590)
                      . ..+..++++|+++++|||||||+ .+|+||||+++...   +..+++|+||++.+++++++|.++|++. ++|||+.+
T Consensus       196 ~-~~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~~g~v~-r~~LGv~~  273 (455)
T PRK10139        196 L-EGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIK-RGLLGIKG  273 (455)
T ss_pred             C-CCcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhhcCccc-ccceeEEE
Confidence            2 22346899999999999999999 99999999998765   3468999999999999999999999998 99999999


Q ss_pred             eeeccHhhhhhcCCCCCcCceEEEEeCCCChhhhc-cCCCCEEEEECCEEecCCCcccccccccchHHHHhhccCCCCEE
Q 007765          323 QTTENVQLRNNFGMRSEVTGVLVNKINPLSDAHEI-LKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKS  401 (590)
Q Consensus       323 ~~~~~~~~~~~lgl~~~~~gv~V~~V~~~s~A~~a-L~~GD~Il~VnG~~v~~~~~v~~~~~~~~~~~~~~~~~~~g~~v  401 (590)
                      +++ ++++++.+|++. ..|++|..|.++|||+++ ||+||+|++|||++|.+|.++.          ..+.....|+++
T Consensus       274 ~~l-~~~~~~~lgl~~-~~Gv~V~~V~~~SpA~~AGL~~GDvIl~InG~~V~s~~dl~----------~~l~~~~~g~~v  341 (455)
T PRK10139        274 TEM-SADIAKAFNLDV-QRGAFVSEVLPNSGSAKAGVKAGDIITSLNGKPLNSFAELR----------SRIATTEPGTKV  341 (455)
T ss_pred             EEC-CHHHHHhcCCCC-CCceEEEEECCCChHHHCCCCCCCEEEEECCEECCCHHHHH----------HHHHhcCCCCEE
Confidence            999 899999999975 579999999999999999 9999999999999999998764          556555788999


Q ss_pred             EEEEEeCCEEEEEEEEEecCCCCCCCccCCCCCcceeeccEEEeeCCHHHHHHhCCCccCCChhhhHHHHHhcCCccCCc
Q 007765          402 LVRVLRDGKEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGE  481 (590)
Q Consensus       402 ~l~V~R~g~~~~~~v~l~~~~~l~~~~~~~~~p~~~~~~Gl~~~~l~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  481 (590)
                      .++|+|+|+.+++++++.......... ....|   .+.|+.+.+.                            ..+...
T Consensus       342 ~l~V~R~G~~~~l~v~~~~~~~~~~~~-~~~~~---~~~g~~l~~~----------------------------~~~~~~  389 (455)
T PRK10139        342 KLGLLRNGKPLEVEVTLDTSTSSSASA-EMITP---ALQGATLSDG----------------------------QLKDGT  389 (455)
T ss_pred             EEEEEECCEEEEEEEEECCCCCccccc-ccccc---cccccEeccc----------------------------ccccCC
Confidence            999999999999988875432210000 00000   1123322210                            001123


Q ss_pred             ceEEEEEEeeccccccccccCCceEEeeCCeecCCHHHHHHHHHhcCCCceEEEeCCC-eEEEEE
Q 007765          482 QLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSSENLRFDLDDD-RVVVLN  545 (590)
Q Consensus       482 ~~vvl~~V~~~s~a~g~~~~~gd~I~~VNG~~v~~~~~l~~~v~~~~~~~v~l~~~r~-~~i~l~  545 (590)
                      .+++|..|.++++|+.+|+++||+|++|||++|.+|++|.+++++++ +.+.+.+.|+ +.+.+.
T Consensus       390 ~Gv~V~~V~~~spA~~aGL~~GD~I~~Ing~~v~~~~~~~~~l~~~~-~~v~l~v~R~g~~~~~~  453 (455)
T PRK10139        390 KGIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEMRKVLAAKP-AIIALQIVRGNESIYLL  453 (455)
T ss_pred             CceEEEEeCCCChHHHcCCCCCCEEEEECCEEcCCHHHHHHHHHhCC-CeEEEEEEECCEEEEEE
Confidence            57899999999999999999999999999999999999999999865 7888888885 444443

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3627 consensus Trypsin [Amino acid transport and metabolism] Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05416 Peptidase_C37: Southampton virus-type processing peptidase; InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
4fln_A539 Crystal Structure Of Plant Protease Deg2 Length = 5 1e-103
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 6e-12
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 1e-11
3pv2_A451 Structure Of Legionella Fallonii Degq (Wt) Length = 2e-11
3pv4_A354 Structure Of Legionella Fallonii Degq (Delta-Pdz2 V 3e-11
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 4e-11
3pv3_A451 Structure Of Legionella Fallonii Degq (S193a Varian 5e-11
3qo6_A348 Crystal Structure Analysis Of The Plant Protease De 2e-09
3pv5_A451 Structure Of Legionella Fallonii Degq (N189gP190G V 2e-09
2zle_A448 Cryo-Em Structure Of Degp12OMP Length = 448 3e-09
3mh5_A456 Htra Proteases Are Activated By A Conserved Mechani 4e-09
3otp_A459 Crystal Structure Of The Degp Dodecamer With A Mode 8e-09
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 9e-09
3mh4_A456 Htra Proteases Are Activated By A Conserved Mechani 9e-09
4a8d_A448 Degp Dodecamer With Bound Omp Length = 448 1e-08
1lcy_A325 Crystal Structure Of The Mitochondrial Serine Prote 1e-08
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 2e-08
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 4e-08
3cs0_A448 Crystal Structure Of Degp24 Length = 448 4e-08
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 7e-08
3mh7_A456 Htra Proteases Are Activated By A Conserved Mechani 7e-08
1ky9_A448 Crystal Structure Of Degp (Htra) Length = 448 9e-08
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 5e-07
1soz_A314 Crystal Structure Of Degs Protease In Complex With 6e-07
3stj_A345 Crystal Structure Of The Protease + Pdz1 Domain Of 1e-06
4a8a_A436 Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 3e-06
1y8t_A324 Crystal Structure Of Rv0983 From Mycobacterium Tube 5e-06
1sot_A320 Crystal Structure Of The Degs Stress Sensor Length 2e-05
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 2e-04
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 2e-04
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 2e-04
3k6y_A237 Crystal Structure Of Rv3671c Protease From M. Tuber 4e-04
3k6z_A219 Crystal Structure Of Rv3671c Protease, Inactive For 6e-04
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure 
Iteration: 1

 Score =  371 bits (953), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 280/461 (60%), Gaps = 7/461 (1%)
Query: 113 LDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGS 172
           L++VVK++   ++P+Y LPWQ + Q  +TGS F+I   K+LTNAH V   T V V++ G 
Sbjct: 47  LNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGD 106
Query: 173 PTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISV 232
             KY A+V   G +CD+A+L VES++FW+G   L LG +P LQ +V VVGYP GGD ISV
Sbjct: 107 DRKYVAKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISV 166
Query: 233 TKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGN-KVAGVAFQNLSG--AEN 289
           TKGVVSR+E T Y HG++ L+ IQIDAAINPGNSGGPA     +  GVAFQ       EN
Sbjct: 167 TKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETEN 226
Query: 290 IGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNKIN 349
           IGY+IP  V+ HF+T    +GKY G+  LG+  Q  EN  LR    + +   GVLV ++ 
Sbjct: 227 IGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPTN-EGVLVRRVE 285
Query: 350 PLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDG 409
           P SDA ++LK+ D+I++FD + +  +GTV FR+ ERI F +L+S K   + + + ++R G
Sbjct: 286 PTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAG 345
Query: 410 KEHEFSITLRLLQPLVPVHQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCE 469
           +  +  + LR    LVP H     PSY I AGLVF PL++P + E  ED   T   +L  
Sbjct: 346 EHKKVQVVLRPRVHLVPYHIDGGQPSYIIVAGLVFTPLSEPLIEEECED---TIGLKLLT 402
Query: 470 RALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVKKVNGVEIENLKHLCQLVENCSS 529
           +A   + +  GEQ+VILSQVL +++N GYE   + QV K NG+ I N+ HL  L++ C  
Sbjct: 403 KARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVLKFNGIPIRNIHHLAHLIDMCKD 462
Query: 530 EXXXXXXXXXXXXXXXXXXAKIATSKILKRHRIPSAMSGDL 570
           +                  +  A+  ILK + IPS  S DL
Sbjct: 463 KYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADL 503
>pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 Back     alignment and structure
>pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 Back     alignment and structure
>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure
>pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 Back     alignment and structure
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 Back     alignment and structure
>pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure
>pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 Back     alignment and structure
>pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 Back     alignment and structure
>pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 Back     alignment and structure
>pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 Back     alignment and structure
>pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3K6Y|A Chain A, Crystal Structure Of Rv3671c Protease From M. Tuberculosis, Active Form Length = 237 Back     alignment and structure
>pdb|3K6Z|A Chain A, Crystal Structure Of Rv3671c Protease, Inactive Form Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 8e-62
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 8e-56
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 1e-51
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 5e-39
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 7e-39
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 2e-36
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 6e-36
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 6e-36
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 2e-35
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 3e-34
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-34
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 4e-33
3k6y_A237 Serine protease, possible membrane-associated seri 8e-33
2w5e_A163 Putative serine protease; coiled coil, transmembra 8e-28
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 8e-27
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 5e-23
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 2e-22
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 1e-20
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 3e-19
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 1e-18
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 2e-16
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 7e-16
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 2e-13
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 2e-11
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 2e-11
2kl1_A94 YLBL protein; structure genomics, structural genom 3e-11
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 2e-10
2o8l_A274 V8 protease, taphylococcal serine; serine protease 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 1e-08
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 2e-07
2hga_A125 Conserved protein MTH1368; GFT structural genomics 3e-07
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 6e-07
1hpg_A187 Glutamic acid specific protease; serine protease, 8e-07
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 3e-06
4fgm_A597 Aminopeptidase N family protein; structural genomi 8e-06
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 2e-05
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 2e-04
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 4e-04
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 6e-04
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
 Score =  202 bits (515), Expect = 8e-62
 Identities = 47/224 (20%), Positives = 79/224 (35%), Gaps = 38/224 (16%)

Query: 114 DSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTF-VLVRKHGS 172
            +V ++           P+          +GFVI    I+TN HV  D      +  H +
Sbjct: 3   KNVTQV-----KDTNNFPYNGVVSF-KDATGFVIGKNTIITNKHVSKDYKVGDRITAHPN 56

Query: 173 PTKYR------AQVEAVGHECDLAILIVESD---------EFWEGMHFLELGDIPFLQQA 217
             K          +     + D++++ +E            F E +          +   
Sbjct: 57  GDKGNGGIYKIKSISDYPGDEDISVMNIEEQAVERGPKGFNFNENVQAFNFAKDAKVDDK 116

Query: 218 VAVVGYPQGGDNI---SVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAI-MG 273
           + V+GYP    N      + G + R++             +  DA I PGNSG P +   
Sbjct: 117 IKVIGYPLPAQNSFKQFESTGTIKRIKDN----------ILNFDAYIEPGNSGSPVLNSN 166

Query: 274 NKVAGVAFQNLS--GAENIGYIIPVPVIKHFITGVVEHGKYVGF 315
           N+V GV +  +   G+E  G +   P IK FI   +E   +   
Sbjct: 167 NEVIGVVYGGIGKIGSEYNGAVYFTPQIKDFIQKHIEQHHHHHH 210
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 100.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 100.0
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 100.0
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.97
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.97
3k6y_A237 Serine protease, possible membrane-associated seri 99.95
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.88
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.87
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.82
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.82
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.79
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.78
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.77
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.77
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.76
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.75
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.72
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.71
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.7
1hpg_A187 Glutamic acid specific protease; serine protease, 99.7
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.7
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.67
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.67
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.67
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.63
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.61
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.61
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.61
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.57
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.51
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.5
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.5
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.49
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.48
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.48
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.48
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.47
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.47
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.47
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.47
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.47
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.46
1a7s_A225 Heparin binding protein; serine protease homolog, 99.46
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.46
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.46
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.45
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.45
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.45
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.44
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.44
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.44
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.44
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.44
2aiq_A231 Protein C activator; snake venom serine proteinase 99.44
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.44
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.43
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.43
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.43
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.42
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.42
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.42
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.41
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.41
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.41
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.41
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.41
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.41
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.39
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.39
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.39
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.39
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.39
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.38
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.37
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.37
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.37
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.37
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.37
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.37
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.36
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.36
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.36
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.36
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.35
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.35
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.35
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.35
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.34
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.34
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.34
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.34
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.33
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.33
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.33
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.32
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.32
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.31
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.31
1md8_A329 C1R complement serine protease; innate immunity, a 99.31
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.31
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.3
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.3
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.3
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.29
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.29
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.29
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.29
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.28
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.28
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.28
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.27
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.26
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.26
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.25
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.24
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.23
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.22
1elv_A333 Complement C1S component; trypsin-like serin prote 99.21
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 99.21
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.2
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 99.19
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 99.18
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.17
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.16
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.14
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.12
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.12
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.09
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.08
3hrz_D741 Complement factor B; serine protease, glycosilated 99.06
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.02
2kl1_A94 YLBL protein; structure genomics, structural genom 98.99
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 98.98
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.98
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.96
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.96
2odp_A509 Complement C2; C3/C5 convertase, complement serin 98.95
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 98.94
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.94
2xrc_A565 Human complement factor I; immune system, hydrolas 98.9
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.87
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.83
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.83
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.82
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.81
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.8
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.79
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.79
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.78
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.74
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.74
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.74
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.73
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.73
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.72
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.71
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.71
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.71
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.7
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.68
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.68
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.67
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.66
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.66
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.64
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.64
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.64
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.64
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.63
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.63
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.63
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.63
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.63
2kl1_A94 YLBL protein; structure genomics, structural genom 98.62
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.62
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.61
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 98.61
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.61
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.6
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.6
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.59
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.58
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.57
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.56
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.56
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.56
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.55
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.54
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.54
2awx_A105 Synapse associated protein 97; membrane protein, s 98.54
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.54
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.53
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.53
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.53
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.52
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.52
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.52
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.51
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.51
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.5
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.5
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.5
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.5
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.5
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.49
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.49
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.49
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.48
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.48
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.47
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.47
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.47
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.47
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.46
2v90_A96 PDZ domain-containing protein 3; membrane, protein 98.45
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.44
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.44
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.43
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.43
2ego_A96 General receptor for phosphoinositides 1- associat 98.43
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.43
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.42
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.41
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.41
2d90_A102 PDZ domain containing protein 1; structural genomi 98.41
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.41
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.41
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.4
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.4
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.4
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.4
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.4
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.4
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.4
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.39
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.39
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.39
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.39
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.39
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.38
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.38
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.38
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.38
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.38
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.38
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.38
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.38
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.37
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.37
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.37
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.37
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.37
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.36
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.36
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.36
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.36
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.36
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.36
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.35
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.35
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.35
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.35
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.34
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.34
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.34
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.34
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.34
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.33
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.33
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.33
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.33
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.32
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.32
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.32
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.31
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.31
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.31
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.31
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.3
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.29
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.29
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.29
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.29
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.29
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.29
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.29
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.28
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.28
2ego_A96 General receptor for phosphoinositides 1- associat 98.28
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.28
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.27
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.27
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.27
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.26
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.26
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.26
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.26
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.26
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.25
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.25
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.25
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.25
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.25
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.24
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.24
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.24
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.23
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.23
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.23
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.23
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.23
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.23
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.22
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.22
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.22
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.22
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.22
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.22
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.21
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.21
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.21
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.21
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.21
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.21
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.2
2d90_A102 PDZ domain containing protein 1; structural genomi 98.2
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.2
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.2
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.2
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.19
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.19
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.19
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.19
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.18
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.18
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.18
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.18
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.18
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.18
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.17
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.17
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.17
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.17
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.17
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.17
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.16
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 98.16
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.16
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.16
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.16
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.16
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.15
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.15
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.15
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.15
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.15
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.14
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.14
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.14
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.14
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.14
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.14
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.14
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.14
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.14
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.13
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.13
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.13
2awx_A105 Synapse associated protein 97; membrane protein, s 98.13
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.12
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.12
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.12
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.12
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.12
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.11
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.11
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.11
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.1
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.1
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.1
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.1
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.09
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.08
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.08
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.08
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.08
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.08
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.08
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.08
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.08
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.07
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.07
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.07
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.07
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.06
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.06
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.05
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.05
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.05
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.05
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.05
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.05
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 98.05
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.04
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.04
2b0f_A182 Picornain 3C (protease 3C) (P3C); beta barrel, hyd 98.04
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.04
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.03
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.03
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.03
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.03
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.02
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.02
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.02
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.01
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.01
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.01
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.01
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.01
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.0
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.0
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.0
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.0
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.0
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.0
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.99
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 97.99
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 97.99
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 97.99
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 97.99
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 97.98
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 97.98
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 97.97
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 97.97
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 97.97
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 97.96
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 97.96
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 97.95
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.95
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 97.94
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 97.94
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 97.94
1cqq_A180 Type 2 rhinovirus 3C protease; viral protein, hydr 97.93
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 97.92
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 97.92
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.91
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.91
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 97.91
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.91
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 97.91
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 97.89
3k1r_A192 Harmonin; protein-protein complex, alternative spl 97.89
2eei_A106 PDZ domain-containing protein 1; regulatory factor 97.88
3k50_A403 Putative S41 protease; structural genomics, joint 97.88
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 97.87
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 97.87
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.09
4dcd_A190 Protease 3C, genome polyprotein; antiviral inhibit 97.87
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.84
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 97.83
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 97.82
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 97.82
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.81
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.8
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 97.8
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 97.79
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 97.73
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.73
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.72
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 97.67
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 97.67
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.66
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 97.66
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 97.64
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 97.63
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 97.63
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.59
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 96.75
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.51
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=3.7e-79  Score=664.03  Aligned_cols=461  Identities=45%  Similarity=0.746  Sum_probs=429.5

Q ss_pred             HhCCCcEEEEeeecCCCCCCCccCCCCCCceEEEEEEeCCeEEEcCcccCCCcEEEEEEcCCCcEEEEEEEEecCCCCeE
Q 007765          111 LALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVIPGKKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLA  190 (590)
Q Consensus       111 ~~~~sVV~I~~~~~~~~~~~p~~~~~~~~~~GsGfiI~~g~IlT~aHvv~~~~~i~V~~~~~~~~~~a~vv~~d~~~DlA  190 (590)
                      ...+|||+|++....++|+.||+...+..+.||||||++||||||+|||++++.+.|++.+|++.|+|++++.|+.+|||
T Consensus        45 ~~~~sVV~I~~~~~~~~~~~Pw~~~~~~~s~GSGfiI~dG~IlTN~HVV~~a~~i~V~~~~dg~~~~A~vv~~D~~~DLA  124 (539)
T 4fln_A           45 SFLNAVVKVYCTHTAPDYSLPWQKQRQFTSTGSAFMIGDGKLLTNAHCVEHDTQVKVKRRGDDRKYVAKVLVRGVDCDIA  124 (539)
T ss_dssp             HHHTTEEEEEEEECCBCSSSTTSBCCCEEEEEEEEEEETTEEEECGGGGTTEEEEEEECTTCCCCEEEEEEEEETTTTEE
T ss_pred             ccCCCeEEEEEEecCCCCCCccccCCccceEEEEEEEECCEEEEChHHcCCCCeEEEEEccCCEEEEEEEEEECCCCCEE
Confidence            45699999999999999999999999999999999999999999999999999999999779999999999999999999


Q ss_pred             EEEecCCcccCcceeEEcCCCCCCCCeEEEEecCCCCCCceEEEeEEecccccccccCcceeeEEEEcccccCCCCCceE
Q 007765          191 ILIVESDEFWEGMHFLELGDIPFLQQAVAVVGYPQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPA  270 (590)
Q Consensus       191 lLkv~~~~~~~~~~~~~l~~~~~~G~~V~~iG~p~g~~~~~v~~G~Vs~~~~~~~~~~~~~~~~i~~~~~i~~G~SGGPl  270 (590)
                      |||++.+.++..++++.+++.+.+|++|+++|||.++...+++.|+|+++++..+..+.....+||+|+++++|||||||
T Consensus       125 vLkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~~~~tvT~GIVSa~~r~~~~~~~~~~~~IQtDAaInpGnSGGPL  204 (539)
T 4fln_A          125 LLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGGDTISVTKGVVSRIEVTSYAHGSSDLLGIQIDAAINPGNSGGPA  204 (539)
T ss_dssp             EEEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSSCCCEEEEEEEEEEEEEECTTSCCEEEEEEESSCCCTTTTTSEE
T ss_pred             EEEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCCCCCcEEeEEECcccccccCCCCcceeEEEEEeEecCCCccchh
Confidence            99999876666788899999889999999999999887679999999999887766666666789999999999999999


Q ss_pred             E-eCCEEEEEEeeecC--CCCceeEEeehHHHHHHHHHHHHcCccccccccccceeeeccHhhhhhcCCCCCcCceEEEE
Q 007765          271 I-MGNKVAGVAFQNLS--GAENIGYIIPVPVIKHFITGVVEHGKYVGFCSLGLSCQTTENVQLRNNFGMRSEVTGVLVNK  347 (590)
Q Consensus       271 ~-~~G~vVGI~~~~~~--~~~~~~~aip~~~i~~~l~~l~~~g~~~~~~~lGi~~~~~~~~~~~~~lgl~~~~~gv~V~~  347 (590)
                      + .+|+||||+++.+.  +.++++||||++.+++++++|.++|++.++|||||.++++.++.+++.+||+. ..|++|..
T Consensus       205 vn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~~G~~~~r~~LGv~~~~~~~~~~~~~~~l~~-~~Gv~V~~  283 (539)
T 4fln_A          205 FNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYERNGKYTGYPCLGVLLQKLENPALRECLKVPT-NEGVLVRR  283 (539)
T ss_dssp             ECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHTTTSCCCCCBCCEEEEECCCHHHHHHHTCSS-SBCEEEEE
T ss_pred             ccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHHcCeEEeeeecceEEEecCCHHHHHhcCCCC-cCceeeec
Confidence            9 99999999998764  56789999999999999999999999988999999999998999999999986 58999999


Q ss_pred             eCCCChhhhccCCCCEEEEECCEEecCCCcccccccccchHHHHhhccCCCCEEEEEEEeCCEEEEEEEEEecCCCCCCC
Q 007765          348 INPLSDAHEILKKDDIILAFDGVPIANDGTVAFRNRERITFDHLVSMKKPNEKSLVRVLRDGKEHEFSITLRLLQPLVPV  427 (590)
Q Consensus       348 V~~~s~A~~aL~~GD~Il~VnG~~v~~~~~v~~~~~~~~~~~~~~~~~~~g~~v~l~V~R~g~~~~~~v~l~~~~~l~~~  427 (590)
                      |.|+|||+++||+||+|++|||++|.+.+++.++..++++|.+++..+.+|++++|+|+|+|+++++++++...+.+.+.
T Consensus       284 V~~~spA~~al~~GDvI~~idg~~V~~~g~~~~~~~~~~~l~~~v~~~~~Gd~v~l~v~R~Gk~~~v~Vtl~~~~~~~~~  363 (539)
T 4fln_A          284 VEPTSDASKVLKEGDVIVSFDDLHVGCEGTVPFRSSERIAFRYLISQKFAGDIAEIGIIRAGEHKKVQVVLRPRVHLVPY  363 (539)
T ss_dssp             ECTTSGGGGTCCTTCEEEEETTEECBSSSEEECSTTCEEETHHHHHTSCTTCEEEEEEEETTEEEEEEEECBCCCCSSCS
T ss_pred             ccCCChHHhCccCCCEEEEECCEEeCcCCeeccccchhHHHHHHHHcCCCCCEEEEEEEECCEEEEEEEEEccCcccccc
Confidence            99999998889999999999999999999999988999999999999999999999999999999999999999888888


Q ss_pred             ccCCCCCcceeeccEEEeeCCHHHHHHhCCCccCCChhhhHHHHHhcCCccCCcceEEEEEEeeccccccccccCCceEE
Q 007765          428 HQFDKLPSYYIFAGLVFIPLTQPYLHEYGEDWYNTSPRRLCERALRELPKKAGEQLVILSQVLMDDINAGYERFADLQVK  507 (590)
Q Consensus       428 ~~~~~~p~~~~~~Gl~~~~l~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~vvl~~V~~~s~a~g~~~~~gd~I~  507 (590)
                      +..+..|+|++++||+|.+|+++++++++.+   ..+.+++..+.....+.+++++|+|++|+++++|++|++++||+|+
T Consensus       364 ~~~~~~p~~~~~~Gl~f~~Lt~~~~~~~~~~---~~~~~l~~~~~~~~~~~~~~~gVvvs~V~~~s~a~~~g~~~gdiI~  440 (539)
T 4fln_A          364 HIDGGQPSYIIVAGLVFTPLSEPLIEEECED---TIGLKLLTKARYSVARFRGEQIVILSQVLANEVNIGYEDMNNQQVL  440 (539)
T ss_dssp             CTTSSCCCCCCSTTEEEEECCHHHHTTSCSS---SSCHHHHHHHHHCCCSSTTCCCEEEEEECCCGGGTTCSSCCSEEEE
T ss_pred             ccccCCCccccccceEEeeCCHHHHHhhccc---ccCceeeehhhhhhhccCCceEEEEEEecCCchhhhcCCCCCCEEE
Confidence            8888899999999999999999999986654   5677888888888888899999999999999999999999999999


Q ss_pred             eeCCeecCCHHHHHHHHHhcCCCceEEEeCCCeEEEEEechhhhhhHHHhhhcCCCcCCCCCCCCccc
Q 007765          508 KVNGVEIENLKHLCQLVENCSSENLRFDLDDDRVVVLNYDVAKIATSKILKRHRIPSAMSGDLNGEQI  575 (590)
Q Consensus       508 ~VNG~~v~~~~~l~~~v~~~~~~~v~l~~~r~~~i~l~~~~~~~~~~~i~~~~~i~~~~s~~l~~~~~  575 (590)
                      +|||++|+|++||.+++++++++++.|++++++.++|+.+..++++.+|+++|+|+..+|.||.+++.
T Consensus       441 ~vNg~~V~s~~~l~~~l~~~k~~~l~~~~~~~~~ivL~~~~~~~~~~~Il~~~~I~~~~S~dl~~~~~  508 (539)
T 4fln_A          441 KFNGIPIRNIHHLAHLIDMCKDKYLVFEFEDNYVAVLEREASNSASLCILKDYGIPSERSADLLEPYV  508 (539)
T ss_dssp             EETTEECCSHHHHHHHHHTCCSSEEEEEETTSCEEEEEHHHHHHHHHHHHTTTTCSCSSCGGGGSCCC
T ss_pred             eECCEEcCCHHHHHHHHHHcCCCeEEEEECCCEEEEEEHHHHHHhHHHHHHhcCCCcccCcchhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999987654
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 590
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 1e-21
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 8e-21
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 5e-19
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 6e-19
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 3e-18
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 1e-17
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 1e-16
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 2e-16
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 5e-15
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 2e-14
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 7e-14
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 6e-12
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 9e-12
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 1e-11
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 4e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-06
d1sota199 b.36.1.4 (A:255-353) Stress sensor protease DegS, 7e-06
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-05
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 1e-05
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-05
d1cqqa_180 b.47.1.4 (A:) 3C cysteine protease (picornain 3C) 9e-05
d1ky9a194 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-t 0.001
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease PepD
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 91.6 bits (226), Expect = 1e-21
 Identities = 54/230 (23%), Positives = 86/230 (37%), Gaps = 39/230 (16%)

Query: 107 AAIELALDSVVKIFTVSSSPNYGLPWQNKSQRETTGSGFVI-PGKKILTNAHVVADSTFV 165
                 + SVV + T            +  ++   GSG ++     ILTN HV+A +   
Sbjct: 5   QVAAKVVPSVVMLET------------DLGRQSEEGSGIILSAEGLILTNNHVIAAAAKP 52

Query: 166 LVRK--------HGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIPFLQQA 217
            +                    V       D+A++ V+       +      D+   Q  
Sbjct: 53  PLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTPISLGSSSDLRVGQPV 112

Query: 218 VAVVGYPQGGDNISVTKGVVSRVE-----PTQYVHGATQLMAIQIDAAINPGNSGGPAIM 272
           +A+      G   +VT G+VS +        +  +  T L AIQ DAAINPGNSGG  + 
Sbjct: 113 LAI--GSPLGLEGTVTTGIVSALNRPVSTTGEAGNQNTVLDAIQTDAAINPGNSGGALVN 170

Query: 273 GN-KVAGVAFQNLS----------GAENIGYIIPVPVIKHFITGVVEHGK 311
            N ++ GV     +          G+  +G+ IPV   K     ++  GK
Sbjct: 171 MNAQLVGVNSAIATLGADSADAQSGSIGLGFAIPVDQAKRIADELISTGK 220
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Length = 180 Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.98
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.97
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.96
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.96
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.95
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.8
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.79
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.74
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.64
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.61
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.59
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.58
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.55
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.53
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.53
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.52
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.45
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.44
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.42
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.33
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.31
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.29
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.24
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.23
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.22
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.22
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.21
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.19
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.19
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.19
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.18
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.17
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.17
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.15
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.15
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.14
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.13
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.13
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.12
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.11
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.11
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.11
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 99.1
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.1
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.08
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.06
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.06
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.05
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.05
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.04
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.03
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.03
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.02
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.02
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 98.99
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 98.99
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 98.97
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 98.97
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 98.96
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.96
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 98.95
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.94
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 98.94
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 98.93
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 98.92
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.92
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 98.91
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 98.91
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.9
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 98.88
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.87
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.81
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 98.8
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 98.77
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.74
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.74
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.72
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 98.67
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.6
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.57
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.53
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.53
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.51
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.48
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.48
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.35
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.32
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.3
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.28
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.27
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.26
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 98.22
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.22
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.22
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.22
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.18
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.18
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.16
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.16
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.15
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.15
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.14
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.14
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.13
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.13
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.12
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.11
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.11
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.1
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.1
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.09
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.09
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.08
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.08
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.06
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.06
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.06
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.05
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.04
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.04
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.04
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.04
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.01
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.01
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.01
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.01
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.0
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.0
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 97.95
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 97.95
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 97.95
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.95
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 97.94
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 97.93
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.92
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.89
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.89
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 97.89
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 97.88
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 97.86
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 97.85
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.83
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 97.83
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.82
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 97.8
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 97.78
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 97.78
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 97.77
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 97.77
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 97.76
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 97.76
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 97.76
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.74
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 97.74
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.72
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 97.72
d1y7na179 Amyloid beta A4 precursor protein-binding family A 97.72
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 97.71
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 97.7
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.7
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 97.68
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 97.67
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1rzxa_98 GTPase-binding domain of the cell polarity protein 97.67
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 97.66
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 97.65
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 97.65
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 97.64
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 97.62
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 97.62
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 97.61
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.6
d1x45a185 Amyloid beta A4 precursor protein-binding family A 97.59
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.58
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 97.56
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.55
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.55
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 97.54
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 97.52
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 97.51
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 97.51
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.47
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.47
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 97.45
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 97.38
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 97.34
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.33
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 97.3
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 97.3
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 97.26
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.19
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 96.5
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 87.54
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 87.07
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 86.55
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 85.6
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 83.94
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=99.98  E-value=3.2e-32  Score=268.97  Aligned_cols=202  Identities=27%  Similarity=0.409  Sum_probs=163.6

Q ss_pred             cHHHHHHHhCCCcEEEEeeecC-------CCCCC--------------C---------------ccCCCCCCceEEEEEE
Q 007765          104 NAYAAIELALDSVVKIFTVSSS-------PNYGL--------------P---------------WQNKSQRETTGSGFVI  147 (590)
Q Consensus       104 ~~~~~~~~~~~sVV~I~~~~~~-------~~~~~--------------p---------------~~~~~~~~~~GsGfiI  147 (590)
                      +++++++++.||||.|.+....       +..+.              |               +.......+.||||+|
T Consensus         4 s~a~~ve~v~PaVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~GSG~iI   83 (249)
T d1ky9a2           4 SLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVII   83 (249)
T ss_dssp             CSHHHHHHHGGGEEEEEEEEEEEECCCCSSCCTTCCCC---------------------------CEEEEEEEEEEEEEE
T ss_pred             ChHHHHHHhCCceEEEEEEEEEeecCCcCcchhhhccccCCcccccccccccccccccccccccccccccccccccEEEE
Confidence            5789999999999999875421       00000              0               0011112467999999


Q ss_pred             e-C-CeEEEcCcccCCCcEEEEEEcCCCcEEEEEEEEecCCCCeEEEEecCCcccCcceeEEcCCCC--CCCCeEEEEec
Q 007765          148 P-G-KKILTNAHVVADSTFVLVRKHGSPTKYRAQVEAVGHECDLAILIVESDEFWEGMHFLELGDIP--FLQQAVAVVGY  223 (590)
Q Consensus       148 ~-~-g~IlT~aHvv~~~~~i~V~~~~~~~~~~a~vv~~d~~~DlAlLkv~~~~~~~~~~~~~l~~~~--~~G~~V~~iG~  223 (590)
                      + + ||||||+|||+++..+.|.+. +++.+.|+++..|+..|+|+|+++.+.   ++++++|+++.  ++|++|+++||
T Consensus        84 ~~~~g~IlTn~HVv~~~~~~~v~~~-~~~~~~a~~~~~d~~~dlavl~i~~~~---~~~~~~l~~~~~~~~G~~v~aiG~  159 (249)
T d1ky9a2          84 DADKGYVVTNNHVVDNATVIKVQLS-DGRKFDAKMVGKDPRSDIALIQIQNPK---NLTAIKMADSDALRVGDYTVAIGN  159 (249)
T ss_dssp             ETTTTEEEEEHHHHTTEEEEEEEET-TSCEEEEEEEEEETTTTEEEEEESSCC---SCCCCCBCCGGGCCTTCEEEEEEC
T ss_pred             eccCceEEeeccccccceeeeeeec-ccccccceeeEeccchhhceeeecccc---cceEEEcCCcCcCCcCCEEEEEec
Confidence            8 4 899999999999999999987 899999999999999999999998764   68999999865  56999999999


Q ss_pred             CCCCCCceEEEeEEecccccccccCcceeeEEEEcccccCCCCCceEE-eCCEEEEEEeeecC---CCCceeEEeehHHH
Q 007765          224 PQGGDNISVTKGVVSRVEPTQYVHGATQLMAIQIDAAINPGNSGGPAI-MGNKVAGVAFQNLS---GAENIGYIIPVPVI  299 (590)
Q Consensus       224 p~g~~~~~v~~G~Vs~~~~~~~~~~~~~~~~i~~~~~i~~G~SGGPl~-~~G~vVGI~~~~~~---~~~~~~~aip~~~i  299 (590)
                      |.+.. .+++.++++...+.... ......+|++|+++++|||||||+ .+|+||||+++...   ...+++||||++.+
T Consensus       160 P~g~~-~tvt~~~~~~~~~~~~~-~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~~~  237 (249)
T d1ky9a2         160 PFGLG-ETVTSGIVSALGRSGLN-AENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMV  237 (249)
T ss_dssp             TTSSS-CEEEEEEEEEESSCC------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHHHH
T ss_pred             ccccC-Cceeecceeeccccccc-CccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHHHH
Confidence            99987 49999999877664332 223345799999999999999999 99999999998765   34679999999999


Q ss_pred             HHHHHHHHHcCc
Q 007765          300 KHFITGVVEHGK  311 (590)
Q Consensus       300 ~~~l~~l~~~g~  311 (590)
                      ++++++|.++|+
T Consensus       238 ~~~~~~l~~~G~  249 (249)
T d1ky9a2         238 KNLTSQMVEYGQ  249 (249)
T ss_dssp             HHHHHHHHHHSS
T ss_pred             HHHHHHHHHhCc
Confidence            999999998774
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure