Citrus Sinensis ID: 007778

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590
MIMEKQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRKAESRSRSFSMSVASDQEILNSEYKRMYAL
cccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHccccEEEEEEcccccccccccccccccHHHHHHccHHHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHccccHHHHHHHHccccccHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccc
ccHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHcccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHcHHHHHHHHccccHHHHHccccHHHHHHHcccHHHHHHHHHccccEEEEEEEcccccccccccccccccEEEEcccHHHEEEEEHHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccccEEEEc
MIMEKQSSFRARTMEKQQSIrsvtfekqpsIRRVMEKQqsfngestdkppsalgpmekqqsfhgvtidkqpstrgvmeKQKSFRGFIEKQKSFRVVMERQLsfigggerkknkdspgkrgdLQLHLAARAGNLSRVMEILQSCDANEAKDLLSkknqegetplyvAAESGHALIVEEMLQHMnletasiparngydsfhVAAKQGHLEVLKELLGefpnlvmttdlscsTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVskdpstgfrtdkkgqTALHMAVKGQNEDIVLELirpdpsvlklednkgnTALHIAIKKgrtqeagaahskdhgkppsatkQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIftvpgqyveektegfslGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRkaesrsrsfsmsvASDQEILNSEYKRMYAL
mimekqssfrartmekqqsirsvtfekqpsirRVMEkqqsfngestdkppsalgpmekqqsfhgvtidkqpstrgvMEKQKSFRGfiekqksfrVVMERQlsfigggerkknkdspgkrgDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALvskdpstgfrtdkkgqtALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAahskdhgkppsaTKQLKQTVSDIKHDVQSqlqqsrqtgfkVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNirkaesrsrsfsmsvasdqeilnseykrmyal
MIMEKQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFkvhkiakklkklhiSGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAvvvvqtsvvvIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRKAEsrsrsfsmsvasDQEILNSEYKRMYAL
*************************************************************************************FI****SFRVVMERQLSF****************************NLSRVMEILQ*********************LYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALV*****************LHMAVKGQNEDIVLELIRPD**VL*********ALHI**************************************************FKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEA*************************************
MIMEKQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGER*KNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKI********ISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEA****************************SEYKRMYAL
*********************SVTFEKQPSIRRVMEKQ*************ALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIG*************RGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKK*********************************************GFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRN***************ASDQEILNSEYKRMYAL
MIM*KQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKL***********************LNSEYKRMYA*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMEKQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRKAESRSRSFSMSVASDQEILNSEYKRMYAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query590 2.2.26 [Sep-21-2011]
Q6AWW5524 Ankyrin repeat-containing no no 0.789 0.889 0.464 1e-120
Q9C7A2590 Ankyrin repeat-containing no no 0.803 0.803 0.404 2e-99
Q9ZU96532 Ankyrin repeat-containing no no 0.730 0.810 0.399 1e-95
Q9ULH0 1771 Kinase D-interacting subs yes no 0.371 0.123 0.353 1e-18
Q9EQG6 1762 Kinase D-interacting subs yes no 0.364 0.122 0.356 6e-18
Q4UMH61179 Putative ankyrin repeat p yes no 0.342 0.171 0.360 1e-17
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.350 0.110 0.334 1e-17
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.350 0.105 0.325 1e-16
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.350 0.053 0.341 2e-16
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.350 0.052 0.341 2e-16
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score =  432 bits (1110), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 245/527 (46%), Positives = 337/527 (63%), Gaps = 61/527 (11%)

Query: 113 KDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHA 172
           K    +R D  LH A R G    ++E++   D  E K+LL+++NQ GET LYVAAE G+ 
Sbjct: 10  KQMTARRDDTPLHTAVREGKTDLLLEMIGEHDGVELKELLAEQNQSGETALYVAAEYGYT 69

Query: 173 LIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTAL 232
            +V+ +++H +   A   A+NG+D+FH+AAK G+L+VL  L+   P L  T D S +TAL
Sbjct: 70  DMVKILMKHSDSVLAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTFDSSKTTAL 129

Query: 233 HTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRT 292
           HTAA+QGH ++V FLL+   +LA IAR+NGKT LHSAAR GH  +VK L+ K      R 
Sbjct: 130 HTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIEKKAGMVTRV 189

Query: 293 DKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRT--------- 343
           DKKGQTALHMAVKGQN +IV  L+  D S++   DNKGNT LHIA++K R          
Sbjct: 190 DKKGQTALHMAVKGQNTEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRAEIVQTVLKY 249

Query: 344 ------------------------------------QEAGAAHSKDHGKPPSATKQLKQT 367
                                               Q A +    +  +P  ++++LK+T
Sbjct: 250 CEVSRVAVNKSGETALDIAEKTGLHEIVPLLQKIGMQNARSIKPAEKVEPSGSSRKLKET 309

Query: 368 VSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIF 427
           VS+I H+V +QL+Q+ +T  ++  IAK++ K+H  GLNNAINS+T+VA+LIATVAFAAIF
Sbjct: 310 VSEIGHEVHTQLEQTGRTRREIQGIAKRVNKMHTEGLNNAINSTTLVAILIATVAFAAIF 369

Query: 428 TVPGQYVEEKTE---GFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEK 484
            VPGQY ++  +   G+SLG+A  A    F+IF VFDS ALFISLAVVVVQTSVVVIE +
Sbjct: 370 NVPGQYTDDPKDVPPGYSLGEARAAPRPEFLIFVVFDSFALFISLAVVVVQTSVVVIERR 429

Query: 485 AKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCY 544
           AK+Q++ +INKLMW+AC+ IS+AF+SL++VVVGE  + LAV  T IG  IM++T+G+MCY
Sbjct: 430 AKKQMMAIINKLMWMACIMISVAFVSLSFVVVGEKEKPLAVGVTAIGALIMVSTLGTMCY 489

Query: 545 CVILHRMEAKKLRNIRKAESRSRSFSMSVASDQEILNSEYKR-MYAL 590
            VI +R+E             S+S   S+ SD E+ +S++ R +YA+
Sbjct: 490 WVIANRIEG------------SKSSPASMMSDPELADSKHNRKLYAV 524

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 Back     alignment and function description
>sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
359478231595 PREDICTED: ankyrin repeat-containing pro 0.940 0.932 0.722 0.0
255576418606 ankyrin repeat-containing protein, putat 0.957 0.932 0.718 0.0
356506136566 PREDICTED: ankyrin repeat-containing pro 0.879 0.916 0.761 0.0
15225141662 ankyrin repeats-containing protein [Arab 0.988 0.880 0.667 0.0
449444933574 PREDICTED: ankyrin repeat-containing pro 0.9 0.925 0.714 0.0
356573310558 PREDICTED: ankyrin repeat-containing pro 0.877 0.928 0.690 0.0
296084361534 unnamed protein product [Vitis vinifera] 0.837 0.925 0.747 0.0
224141131522 predicted protein [Populus trichocarpa] 0.816 0.923 0.743 0.0
15220595627 ankyrin repeats-containing protein [Arab 0.976 0.918 0.630 0.0
356506142522 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.801 0.906 0.734 0.0
>gi|359478231|ref|XP_002279889.2| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/617 (72%), Positives = 496/617 (80%), Gaps = 62/617 (10%)

Query: 14  MEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPST 73
           MEK  S R VT EKQ S R VMEKQQSF G            MEKQQSF           
Sbjct: 1   MEKPTSSRGVTMEKQQSFRGVMEKQQSFRG-----------VMEKQQSF----------- 38

Query: 74  RGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNL 133
           RG+MEKQKSFRGF+EKQKSFR+ MERQLSF G  ERKK K+SPGKRGD  LHLAARAGNL
Sbjct: 39  RGLMEKQKSFRGFMEKQKSFRIAMERQLSFGGSSERKKVKESPGKRGDSHLHLAARAGNL 98

Query: 134 SRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARN 193
           +RV EI++ C+++E + LLSK+NQEGETPLYVA+E+GHAL+V E+L+H++L+TASI A N
Sbjct: 99  TRVKEIIEKCESSELQALLSKQNQEGETPLYVASENGHALVVSELLEHVDLQTASIKANN 158

Query: 194 GYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSN 253
           GYD FHVA KQGHLEVLKELL  FPNLVMTTD S STALHTAAAQGHIDVV+ LLE D N
Sbjct: 159 GYDPFHVATKQGHLEVLKELLRFFPNLVMTTDSSNSTALHTAAAQGHIDVVHLLLETDPN 218

Query: 254 LAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVL 313
           LAKIARNNGKTVLHSAARMGHLEV+KALVSKDPS  FRTDKKGQTALHMAVKGQN +IV 
Sbjct: 219 LAKIARNNGKTVLHSAARMGHLEVLKALVSKDPSIVFRTDKKGQTALHMAVKGQNVEIVH 278

Query: 314 ELIRPDPSVLKLEDNKGNTALHIAIKKGRTQ----------------------------- 344
            L++PDPSV+ LEDNKGNTALHIA +KGR+Q                             
Sbjct: 279 ALLKPDPSVMSLEDNKGNTALHIATRKGRSQFVQCLLSVEGIKMNATNKAGETPLDIAEK 338

Query: 345 -----------EAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIA 393
                      EAGA +S DHGKPP+A KQLKQTVSDIKHDVQSQLQQ+RQTG +V  IA
Sbjct: 339 FGTQEIASILREAGATNSADHGKPPNAAKQLKQTVSDIKHDVQSQLQQTRQTGVRVQHIA 398

Query: 394 KKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAA 453
           K+LKKLHISGLNNAINS+TVVAVLIATVAFAAIFTVPGQYVE  T+G SLGQAHIA+ AA
Sbjct: 399 KRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEVPTKGASLGQAHIARTAA 458

Query: 454 FIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTY 513
           F+IFFVFDSLALFISLAVVVVQTSVVVIE+KAK+QLVFVINKLMW+ACLFISIAFISLTY
Sbjct: 459 FLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFISIAFISLTY 518

Query: 514 VVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRKAESRSRSFSMSV 573
           VVVG H+RWLAV ATVIG  IMLTTIG+MCYCVI++R+   K RNIRKAESRSRSFS+S+
Sbjct: 519 VVVGSHARWLAVCATVIGSVIMLTTIGAMCYCVIVNRIAEAKKRNIRKAESRSRSFSVSM 578

Query: 574 ASDQEILNSEYKRMYAL 590
           AS+ E+LNSEY+RMYAL
Sbjct: 579 ASESELLNSEYRRMYAL 595

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255576418|ref|XP_002529101.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223531452|gb|EEF33285.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356506136|ref|XP_003521843.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine max] Back     alignment and taxonomy information
>gi|15225141|ref|NP_180741.1| ankyrin repeats-containing protein [Arabidopsis thaliana] gi|4887754|gb|AAD32290.1| ankyrin-like protein [Arabidopsis thaliana] gi|330253495|gb|AEC08589.1| ankyrin repeats-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444933|ref|XP_004140228.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis sativus] gi|449490552|ref|XP_004158638.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356573310|ref|XP_003554805.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine max] Back     alignment and taxonomy information
>gi|296084361|emb|CBI24749.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224141131|ref|XP_002323928.1| predicted protein [Populus trichocarpa] gi|222866930|gb|EEF04061.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15220595|ref|NP_172055.1| ankyrin repeats-containing protein [Arabidopsis thaliana] gi|4836914|gb|AAD30616.1|AC007153_8 Hypothetical protein [Arabidopsis thaliana] gi|332189749|gb|AEE27870.1| ankyrin repeats-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356506142|ref|XP_003521846.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At5g02620-like, partial [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.572 0.510 0.675 1.8e-117
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.610 0.574 0.606 6.8e-111
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.788 0.856 0.421 1e-84
TAIR|locus:2181768524 ANK1 "ankyrin-like1" [Arabidop 0.761 0.856 0.374 3.3e-70
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.762 0.762 0.366 8.5e-65
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.718 0.698 0.375 2.4e-60
TAIR|locus:2065434532 AT2G01680 "AT2G01680" [Arabido 0.783 0.868 0.318 5.9e-57
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.345 0.339 0.302 1.4e-26
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.698 0.614 0.251 1.1e-23
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.384 0.335 0.272 2e-23
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1157 (412.3 bits), Expect = 1.8e-117, P = 1.8e-117
 Identities = 239/354 (67%), Positives = 280/354 (79%)

Query:     1 MIMEKQSSFRARTMEKQQSIRSVTFEKQPSIRRVMEKQQSFNGESTDK-PPSALG-PMEK 58
             +I+ +    + ++MEKQQS R V  E QP   R +EKQ SF G + +    S LG  MEK
Sbjct:    23 IIINQTQENQTKSMEKQQSFRCVV-ENQPRKARALEKQVSFQGVNVENYQQSRLGRSMEK 81

Query:    59 QQSFHGVTID--------KQPST-RGVMEKQKSFRG-FIEKQKSFRVVMERQLSFIGGGE 108
             QQSF GV ++        K PS  R  ME+QKSFRG F+EKQKSFRVVMERQLSFIG  E
Sbjct:    82 QQSFRGVNVENHKRGVMEKLPSFGRATMERQKSFRGGFLEKQKSFRVVMERQLSFIG--E 139

Query:   109 RKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAE 168
             R+K  +SPGKRGD  LH+AAR GNLS+V E+++ C  +E K+LLSK+N EGETPLY AAE
Sbjct:   140 RRKKNESPGKRGDSSLHIAARTGNLSKVKELIRGC-GDELKELLSKQNLEGETPLYTAAE 198

Query:   169 SGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSC 228
             +GH+++VEEML+HM+LETASI ARNG+D FHVAAKQGHLEVLK LL  FPNL MTTDLSC
Sbjct:   199 NGHSIVVEEMLKHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLETFPNLAMTTDLSC 258

Query:   229 STALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPST 288
             +TALHTAA QGHIDVVN LLE DSNLAKIA+NNGKT LHSAARMGH+EVVK+L+ KDPS 
Sbjct:   259 TTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGKDPSI 318

Query:   289 GFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGR 342
             GFRTDKKGQTALHMAVKGQN+ IV+EL++PD +VL +EDNKGNT LHIA  KGR
Sbjct:   319 GFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGR 372
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065434 AT2G01680 "AT2G01680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT2G31820
ankyrin repeat family protein; ankyrin repeat family protein; FUNCTIONS IN- protein binding; LOCATED IN- plasma membrane; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Ankyrin (InterPro-IPR002110); BEST Arabidopsis thaliana protein match is- ankyrin repeat family protein (TAIR-AT1G05640.1); Has 55766 Blast hits to 22319 proteins in 769 species- Archae - 46; Bacteria - 3999; Metazoa - 28933; Fungi - 4871; Plants - 2904; Viruses - 619; Other Eukaryotes - 14394 (source- NCBI BLink). (662 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
pfam13962114 pfam13962, PGG, Domain of unknown function 5e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-16
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-09
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-04
smart0024830 smart00248, ANK, ankyrin repeats 8e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
COG1914416 COG1914, MntH, Mn2+ and Fe2+ transporters of the N 0.002
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score =  116 bits (293), Expect = 5e-31
 Identities = 40/114 (35%), Positives = 58/114 (50%), Gaps = 3/114 (2%)

Query: 403 GLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKN-AAFIIFFVFD 461
            L    NS  VVA LIATV FAA FT PG Y ++   G   G   +A     F  FFV +
Sbjct: 3   WLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQD-DGGHHAGTPILAGKPRRFKAFFVSN 61

Query: 462 SLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVV 515
           ++A   SL  V++   +V    +   +L   +  L+WL+ L + +AF + +Y V
Sbjct: 62  TIAFVASLVAVILLLYIVPSFSRRLPRL-LALLTLLWLSLLSLMVAFAAGSYRV 114

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|224826 COG1914, MntH, Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 590
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
KOG0510 929 consensus Ankyrin repeat protein [General function 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02989494 ankyrin repeat protein; Provisional 99.95
PHA02798489 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
PHA02917 661 ankyrin-like protein; Provisional 99.94
PHA02730 672 ankyrin-like protein; Provisional 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PHA02795437 ankyrin-like protein; Provisional 99.92
PHA02792631 ankyrin-like protein; Provisional 99.92
PF13962113 PGG: Domain of unknown function 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PHA02792631 ankyrin-like protein; Provisional 99.92
PHA02730672 ankyrin-like protein; Provisional 99.91
PHA02795437 ankyrin-like protein; Provisional 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.82
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.81
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.81
PHA02741169 hypothetical protein; Provisional 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.78
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.77
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.76
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.76
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.73
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.65
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.63
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.47
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.41
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.28
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.27
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.27
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.26
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.26
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.26
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.25
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.24
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.24
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.24
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.18
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.62
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.58
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.53
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.51
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.44
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.41
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.39
PF1360630 Ank_3: Ankyrin repeat 98.39
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.35
PF1360630 Ank_3: Ankyrin repeat 98.28
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.24
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.23
KOG0522 560 consensus Ankyrin repeat protein [General function 98.16
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.16
KOG0522560 consensus Ankyrin repeat protein [General function 98.13
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.09
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.01
KOG0520975 consensus Uncharacterized conserved protein, conta 97.95
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.91
KOG0520975 consensus Uncharacterized conserved protein, conta 97.83
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.67
KOG0511516 consensus Ankyrin repeat protein [General function 97.62
KOG0511516 consensus Ankyrin repeat protein [General function 97.54
KOG2384223 consensus Major histocompatibility complex protein 97.43
KOG2384223 consensus Major histocompatibility complex protein 97.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.86
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.35
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.68
KOG2505591 consensus Ankyrin repeat protein [General function 94.29
KOG2505591 consensus Ankyrin repeat protein [General function 94.23
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.2
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.32
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.85
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.5
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.48
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.8e-36  Score=264.78  Aligned_cols=209  Identities=33%  Similarity=0.430  Sum_probs=188.0

Q ss_pred             CChHHHHHHHcCCHHHHHHHHhcCCchhhhHhhcccCCCCCcHHHHHHHhCCHHHHHHHHhcCCccccccCCCCCCcHHH
Q 007778          120 GDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFH  199 (590)
Q Consensus       120 g~t~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~~l~~~n~~g~TpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~~g~t~Lh  199 (590)
                      +.++.+.+++......++++++..+    +.+.-..|++|+||||+||..|+.+|+.+|+.. .+..++-+|..|+||||
T Consensus         3 ~~~~~~~~~~~~~~~kveel~~s~~----kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq-~nv~~ddkDdaGWtPlh   77 (226)
T KOG4412|consen    3 YASLGKAICENCEEFKVEELIQSDP----KSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQ-PNVKPDDKDDAGWTPLH   77 (226)
T ss_pred             ccchHHHHHhhchHHHHHHHHhcCh----hhhhccccccCCceeeeeeecCchhHHHHHHhc-CCCCCCCccccCCchhh
Confidence            4678899999999999999998765    233344455999999999999999999999985 45667777899999999


Q ss_pred             HHHHcCCHHHHHHHhcc-CCCCccccCCCCCcHHHHHHHcCChhHHHHhhhcCCchhhhhccCCchHHHHHHHcCCHHHH
Q 007778          200 VAAKQGHLEVLKELLGE-FPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVV  278 (590)
Q Consensus       200 ~Aa~~g~~~iv~~LL~~-~~~~~~~~d~~g~TpLh~Aa~~g~~eiv~~LL~~g~~~~~~~d~~g~tpLh~Aa~~g~~eiv  278 (590)
                      +|+..|+.++|+.|+.+ +++ ++..+..|.||||||+..|+.|++++|++.|+.+ +.+|..|.||||-||..|+.+++
T Consensus        78 ia~s~g~~evVk~Ll~r~~ad-vna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i-~~kD~~~qtplHRAAavGklkvi  155 (226)
T KOG4412|consen   78 IAASNGNDEVVKELLNRSGAD-VNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALI-RIKDKQGQTPLHRAAAVGKLKVI  155 (226)
T ss_pred             hhhhcCcHHHHHHHhcCCCCC-cceecCCCcceehhhhcCChhhHHHHHHhcCCCC-cccccccCchhHHHHhccchhhH
Confidence            99999999999999998 666 7788899999999999999999999999999887 88999999999999999999999


Q ss_pred             HHHHhcCCCCccccCCCCCCHHHHHHhCCCHHHHHHHhcCCCcccccccCCCCCHHHHHH
Q 007778          279 KALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAI  338 (590)
Q Consensus       279 ~~Ll~~~~~~~~~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~G~TpLh~A~  338 (590)
                      ++|+..++.++. +|+.|+||||.|..-|+.++..+|++.|++. ...|++| ||+..|.
T Consensus       156 e~Li~~~a~~n~-qDk~G~TpL~~al~e~~~d~a~lLV~~gAd~-~~edke~-t~~~~a~  212 (226)
T KOG4412|consen  156 EYLISQGAPLNT-QDKYGFTPLHHALAEGHPDVAVLLVRAGADT-DREDKEG-TALRIAC  212 (226)
T ss_pred             HHHHhcCCCCCc-ccccCccHHHHHHhccCchHHHHHHHhccce-eeccccC-chHHHHH
Confidence            999999998887 4999999999998889999999999999887 8889988 9988775

>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-16
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-13
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-13
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-10
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-04
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-05
1uoh_A226 Human Gankyrin Length = 226 1e-10
1uoh_A226 Human Gankyrin Length = 226 4e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-09
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 3e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 5e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 7e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 7e-07
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 8e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 8e-07
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 9e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 9e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 9e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-06
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-06
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-06
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 8e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 4e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 9e-06
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 6e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 9e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 8e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 8e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 1e-04
1ycs_B239 P53-53bp2 Complex Length = 239 1e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 6e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 6e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 114/225 (50%), Gaps = 16/225 (7%)
Query: 124 LHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMN 183
           LH+A+  G+L  V  +LQ   +          N + ETPL++AA +GH  + + +LQ  N
Sbjct: 18  LHVASFMGHLPIVKNLLQRGASPNVS------NVKVETPLHMAARAGHTEVAKYLLQ--N 69
Query: 184 LETASIPARNGYDSFHVAAKQGHLEVLKELL--GEFPNLVMTTDLSCSTALHTAAAQGHI 241
               +  A++     H AA+ GH  ++K LL     PNL  T   +  T LH AA +GH+
Sbjct: 70  KAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATT---AGHTPLHIAAREGHV 126
Query: 242 DVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALH 301
           + V  LLE +++ A + +  G T LH AA+ G + V + L+ +D        K G T LH
Sbjct: 127 ETVLALLEKEASQACMTK-KGFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLH 184
Query: 302 MAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQEA 346
           +AV   N DIV +L+ P           G T LHIA K+ + + A
Sbjct: 185 VAVHHNNLDIV-KLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVA 228
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-48
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-29
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-37
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-35
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-45
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-36
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-44
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-44
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-40
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-44
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-37
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-43
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-39
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-39
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-31
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-27
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-41
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-41
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-38
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-41
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-39
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-38
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-34
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-39
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-38
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-39
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-39
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-36
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-36
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-31
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-39
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-33
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-25
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-39
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-36
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-25
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-37
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-34
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-37
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-35
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-36
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-34
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-34
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-34
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-32
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-34
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-10
2pnn_A273 Transient receptor potential cation channel subfa 9e-34
2pnn_A273 Transient receptor potential cation channel subfa 3e-28
2pnn_A273 Transient receptor potential cation channel subfa 4e-27
2pnn_A273 Transient receptor potential cation channel subfa 6e-24
2pnn_A273 Transient receptor potential cation channel subfa 2e-18
2pnn_A273 Transient receptor potential cation channel subfa 4e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-33
2rfa_A232 Transient receptor potential cation channel subfa 4e-33
2rfa_A232 Transient receptor potential cation channel subfa 2e-24
2etb_A256 Transient receptor potential cation channel subfam 4e-33
2etb_A256 Transient receptor potential cation channel subfam 6e-25
2etb_A256 Transient receptor potential cation channel subfam 2e-22
2etb_A256 Transient receptor potential cation channel subfam 4e-16
2etb_A256 Transient receptor potential cation channel subfam 2e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-25
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-32
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-29
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-26
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-31
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-27
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-29
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-28
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-26
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-27
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-25
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-21
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-24
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-04
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
 Score =  171 bits (434), Expect = 4e-48
 Identities = 54/261 (20%), Positives = 100/261 (38%), Gaps = 37/261 (14%)

Query: 111 KNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESG 170
            +    G + ++   +AA  G  S + + L     ++   ++     E      +AAE+G
Sbjct: 83  SDAHKKGIKSEVICFVAAITGCSSAL-DTLCLLLTSDE--IVKVIQAENYQAFRLAAENG 139

Query: 171 HALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLV-MTTDLSCS 229
           H  ++  + +    E  ++     Y +F +AA+ GHL VL  L    P            
Sbjct: 140 HLHVLNRLCELAPTEIMAMIQAENYHAFRLAAENGHLHVLNRLCELAPTEATAMIQAENY 199

Query: 230 TALHTAAAQ-GHIDVVNFLLEIDSNLAK-----------------IARNNGKTVLHSAAR 271
            A   AA   GH +V+NFLL+    LA                      N    +H A +
Sbjct: 200 YAFRWAAVGRGHHNVINFLLDCPVMLAYAEIHEFEYGEKYVNPFIARHVNRLKEMHDAFK 259

Query: 272 MGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLE----- 326
           + + + V  LV+K          +G   L   ++ +N++++L+ IR   S+  ++     
Sbjct: 260 LSNPDGVFDLVTKSEC------LQGFYMLRNLIR-RNDEVLLDDIRFLLSIPGIKALAPT 312

Query: 327 ---DNKGNTALHIAIKKGRTQ 344
                  N  L +A++ G   
Sbjct: 313 ATIPGDANELLRLALRLGNQG 333
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.98
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.77
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.62
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
Probab=100.00  E-value=1.7e-39  Score=322.38  Aligned_cols=231  Identities=16%  Similarity=0.199  Sum_probs=182.0

Q ss_pred             CCCCCCCCCChHHHHHHHcC-------------CHHHHHHHHhcCCchhhhHhhcccCCCCCcHHHHHHHhCCHHHHHHH
Q 007778          112 NKDSPGKRGDLQLHLAARAG-------------NLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEM  178 (590)
Q Consensus       112 ~~~~~~~~g~t~Lh~Aa~~G-------------~~~~v~~Ll~~~~~~~~~~~l~~~n~~g~TpLh~Aa~~g~~~iv~~L  178 (590)
                      +++.+|.+|.||||+|+..|             +.++++.|++.+.+.     .+..|..|.||||+|+..|+.+++++|
T Consensus         2 dvn~~d~~g~tpL~~A~~~g~~~~~~~~~~~~~~~~~v~~Ll~~g~~~-----~~~~d~~g~t~L~~A~~~g~~~~v~~L   76 (253)
T 1yyh_A            2 DVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL-----HNQTDRTGETALHLAARYSRSDAAKRL   76 (253)
T ss_dssp             -------------------------------------------------------CCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             CCCCCCCCCCcHHHHHHhccccccccchhhcCCChHHHHHHHHccCCc-----ccccCCCCCcHHHHHHHcCCHHHHHHH
Confidence            46778999999999999988             899999999987642     355689999999999999999999999


Q ss_pred             HhcCCccccccCCCCCCcHHHHHHHcCCHHHHHHHhccCCCCccccCCCCCcHHHHHHHcCChhHHHHhhhcCCchhhhh
Q 007778          179 LQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIA  258 (590)
Q Consensus       179 l~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~iv~~LL~~~~~~~~~~d~~g~TpLh~Aa~~g~~eiv~~LL~~g~~~~~~~  258 (590)
                      ++.  +.+++..+..|.||||+|+..|+.+++++|++.++...+..|..|.||||+|+..|+.+++++|++.|+++ +..
T Consensus        77 l~~--g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~-~~~  153 (253)
T 1yyh_A           77 LEA--SADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADV-NAV  153 (253)
T ss_dssp             HHT--TCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHSTTSCTTCCCTTCCCHHHHHHHHTCSSHHHHHHHTTCCT-TCB
T ss_pred             HHc--CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCCcHHHHHHHcChHHHHHHHHHcCCCC-CCc
Confidence            997  66788889999999999999999999999999998667888999999999999999999999999999997 778


Q ss_pred             ccCCchHHHHHHHcCCHHHHHHHHhcCCCCccccCCCCCCHHHHHHhCCCHHHHHHHhcCCCcccccccCCCCCHHHHHH
Q 007778          259 RNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAI  338 (590)
Q Consensus       259 d~~g~tpLh~Aa~~g~~eiv~~Ll~~~~~~~~~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~G~TpLh~A~  338 (590)
                      |..|.||||+|+..|+.+++++|+++|++++. .|..|+||||+|+..|+.+++++|+++|+++ +.+|..|+||||+|+
T Consensus       154 d~~g~t~L~~A~~~~~~~~v~~Ll~~ga~~~~-~~~~g~tpL~~A~~~~~~~~v~~Ll~~ga~~-~~~d~~g~tpl~~A~  231 (253)
T 1yyh_A          154 DDLGKSALHWAAAVNNVDAAVVLLKNGANKDM-QNNREETPLFLAAREGSYETAKVLLDHFANR-DITDHMDRLPRDIAQ  231 (253)
T ss_dssp             CTTSCBHHHHHHHHTCHHHHHHHHHTTCCTTC-CCTTSCCHHHHHHHHTCHHHHHHHHHTTCCT-TCCCTTCCCHHHHHH
T ss_pred             CCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCC-cCCCCCCHHHHHHHCCCHHHHHHHHHcCCCc-cccccCCCCHHHHHH
Confidence            99999999999999999999999999999887 4999999999999999999999999999887 899999999999999


Q ss_pred             HcCCchhhhccccc
Q 007778          339 KKGRTQEAGAAHSK  352 (590)
Q Consensus       339 ~~g~~~~~~~l~~~  352 (590)
                      .+|+.+.+..+...
T Consensus       232 ~~g~~~i~~~l~~~  245 (253)
T 1yyh_A          232 ERMHHDIVRLLDLE  245 (253)
T ss_dssp             HTTCHHHHHHHHC-
T ss_pred             HcCCHHHHHHHHHH
Confidence            99999988777543
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 590
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-26
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-20
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-20
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-16
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 8e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 4e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  112 bits (281), Expect = 2e-27
 Identities = 69/256 (26%), Positives = 104/256 (40%), Gaps = 49/256 (19%)

Query: 124 LHLAARAGNLSRVMEILQS-CDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHM 182
           LH+A+  G+L  V  +LQ     N         N + ETPL++AA +GH  + + +LQ+ 
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNV-------SNVKVETPLHMAARAGHTEVAKYLLQN- 55

Query: 183 NLETASIPARN--GYDSFHVAAKQGHLEVLKELLGEFPNL-------------------- 220
               A + A+        H AA+ GH  ++K LL    N                     
Sbjct: 56  ---KAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHV 112

Query: 221 ------------VMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHS 268
                                T LH AA  G + V   LLE D++    A  NG T LH 
Sbjct: 113 ETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP-NAAGKNGLTPLHV 171

Query: 269 AARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDN 328
           A    +L++VK L+ +  S        G T LH+A K    ++   L++   S    E  
Sbjct: 172 AVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSA-NAESV 229

Query: 329 KGNTALHIAIKKGRTQ 344
           +G T LH+A ++G  +
Sbjct: 230 QGVTPLHLAAQEGHAE 245
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=6.4e-35  Score=286.55  Aligned_cols=231  Identities=21%  Similarity=0.184  Sum_probs=179.0

Q ss_pred             CCCCCCChHHHHHHHcCCHHHHHHHHhcCCchhhhHhhcccCCCCCcHHHHHHHhCCHHHHHHHHhcCCccccccCCCCC
Q 007778          115 SPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNG  194 (590)
Q Consensus       115 ~~~~~g~t~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~~l~~~n~~g~TpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~~g  194 (590)
                      -.+++|+||||+||+.|+.+++++|++.+.+.   ..++.+|..|+||||+|+..|+.+++++|++.  +.+++..|.+|
T Consensus         4 ~i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~---~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~--ga~i~~~d~~g   78 (255)
T d1oy3d_           4 YVTEDGDTALHLAVIHQHEPFLDFLLGFSAGH---EYLDLQNDLGQTALHLAAILGEASTVEKLYAA--GAGVLVAERGG   78 (255)
T ss_dssp             CCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTS---GGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHT--TCCSSCCCTTS
T ss_pred             cCCcCCCCHHHHHHHcCCHHHHHHHHHcCCCc---ccccCcCCCCCCccchHHhhcccccccccccc--ccccccccccc
Confidence            45789999999999999999999999987542   44788999999999999999999999999998  67788899999


Q ss_pred             CcHHHHHHHcCCHHHHHHHhccCCCCccccC---------CCCCcH---HHHHHHcCC-hhHHHHhhhcCCchhhhhccC
Q 007778          195 YDSFHVAAKQGHLEVLKELLGEFPNLVMTTD---------LSCSTA---LHTAAAQGH-IDVVNFLLEIDSNLAKIARNN  261 (590)
Q Consensus       195 ~t~Lh~Aa~~g~~~iv~~LL~~~~~~~~~~d---------~~g~Tp---Lh~Aa~~g~-~eiv~~LL~~g~~~~~~~d~~  261 (590)
                      .||||+|+..++.++++.|++..........         ..+.+.   +........ ......+...+.++ +..|.+
T Consensus        79 ~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i-n~~d~~  157 (255)
T d1oy3d_          79 HTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQL-EAENYD  157 (255)
T ss_dssp             CCHHHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGT-TCCCTT
T ss_pred             chhhhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCccc-cccccc
Confidence            9999999999999999999987654221111         011111   111111111 11222222334443 567888


Q ss_pred             CchHHHHHHHcCCHHHHHHHHhcCCCCccccCCCCCCHHHHHHhCCCHHHHHHHhcCCCcccccccCCCCCHHHHHHHcC
Q 007778          262 GKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKG  341 (590)
Q Consensus       262 g~tpLh~Aa~~g~~eiv~~Ll~~~~~~~~~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~G~TpLh~A~~~g  341 (590)
                      |.||||+|+..|+.+++++|++.+++.+...+..|.||||+|++.|+.+++++|+++|+++ +.+|+.|+||||+|+.+|
T Consensus       158 g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadi-n~~d~~g~t~L~~A~~~~  236 (255)
T d1oy3d_         158 GHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADP-TARMYGGRTPLGSALLRP  236 (255)
T ss_dssp             SCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHTSS
T ss_pred             CcccccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCC-CCCCCCCCCHHHHHHHCC
Confidence            9999999999999999999999998888777888999999999999999999999988776 889999999999999999


Q ss_pred             Cchhhhccccc
Q 007778          342 RTQEAGAAHSK  352 (590)
Q Consensus       342 ~~~~~~~l~~~  352 (590)
                      +.+.++.+...
T Consensus       237 ~~~i~~~Ll~~  247 (255)
T d1oy3d_         237 NPILARLLRAH  247 (255)
T ss_dssp             CHHHHHHHHHT
T ss_pred             CHHHHHHHHHc
Confidence            99988877644
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure