Citrus Sinensis ID: 007790

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MPFPAIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVHENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFVTVGRKSVDIIPSAALPRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFTPLSSPRHFVKGSSEDDQKSETHYSPFPSSSSSSSMMASTWLRRNSSQSASKQQQQQQQQQRNSSSSSSSSVGHQQWSDPFAIPIGYTWSSIDDKSSKMKRSKSSRKSK
cccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHccccccccccccccccccHHHHcccccccccccccccccccEEccccEEEEEccccccccccccEEEEEEcccHHHHHHHHHccccccHHHHHHHHHcccccccccccccEEEEccccccccccccccccEEEEEEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHccHHHHHHHHHHHHHccccccccEEEEcccccEEEEEEEEccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEcccccccHHHHccccccccc
cccccccHHHHccccHHHHHHHccHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHcccHHHHHHccccccccccEEEEEcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHcccEEEEEEEEEEcccHHHHHcccccccEEEEEcccEEEEEEEEEcccccEEEEccEEEEEEcccccccccccEEEEEEccccHHHHHHHHcccccccHHHHHHHHccccEEEccEcccEEEEEEccccEccccEEEEccEEEEEEEEccEEEEEEEccccHHHHHccHccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEEEEccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHcHHHcccccccccccEcccccEEEcHHHccccccccccccccc
mpfpaikpedyshspvhYAIVLGDHTTLTRIIStlprlaadpskihtesdslsQERVADQIASVldrrdvpfretpLHLAVRLNDAFAARSLASAgadvslqnaagwnplqeaVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFessvipfvgkiapsdtykiwkrdgnlradtslagfdglkiqradqsflflgdgdqthnvscgsllvlnhdDRKIFDAfenagapmsesdiagfcaqssvyrpgmdvtkaelvgrtnwrrqektESVGEWKARVYELHNVVFSFrsrkvhendvagseqvlpleldedddgflvaenpsfgfnvrnndrrrhssfvreerdfvtvgrksvdiipsaalprrstavmaappptkekefvkslrpsiwlteqfplkteelIPLLDILANKVKAVRRLRELLttkfppgtfpvkvaipvvpTVRVVVTFTKFVELqsteqfftplssprhfvkgsseddqksethyspfpsssssssmmASTWLRRNSSQSASKQQQQQQqqqrnssssssssvghqqwsdpfaipigytwssiddksskmkrskssrksk
mpfpaikpedyshsPVHYAIVLGDHTTLTRIISTLprlaadpskihtesdslsqerVADQIAsvldrrdvpfrETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLhhrsawakwrrrlprVISVLRRMRDFYMEISFHfessvipfvgkIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKaelvgrtnwrrqektesvgewkaRVYELHNVVFSFRSRKVHENDVAGSEQVLPLELDEDDDGFLVAenpsfgfnvrnndrrrhssfvreerdfvtvgrksvdiipsaalprrstavmaappptkekefvkslrpsiWLTEQFPLKTEELIPLLDILANKVKAVRRLRELlttkfppgtfpvkvaipvvPTVRVVVTFTKFVElqsteqfftplssprhFVKGsseddqksethyspfpssssssSMMASTWLRRNSSQSASKQQQQQQQQQRNSSSSSSSSVGHQQWSDPFAIPIGYTwssiddksskmkrskssrksk
MPFPAIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDafaarslasagaDVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVHENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFVTVGRKSVDIIPSAALPRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFpvkvaipvvptvrvvvtftkfvELQSTEQFFTPLSSPRHFVKGSSEDDQKSETHYspfpsssssssmmasTWLRRNssqsaskqqqqqqqqqrnssssssssvghqqwsDPFAIPIGYTWssiddksskmkrskssrksk
**************PVHYAIVLGDHTTLTRIISTLPRL**********************IASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVHENDV*****VLPLEL****DGFLVAENPSFGFNV****************DFVTVGRKSVDII************************VKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFT****************************************************************************SDPFAIPIGYTWS*******************
******KPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDG******SCGSLLVLNHDDRKIFDAFE*********************RPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSF*****************************************************************************************************WLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFTPLSS***************************************************************************FAIPIGYTWS*******************
MPFPAIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPS************RVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWR********GEWKARVYELHNVVFSFRSRKVHENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFVTVGRKSVDIIPSAALPRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFTPLSSP*********************************************************************QWSDPFAIPIGYTWSSID****************
****AIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVH****AG********************************************************************VMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFT*************************FPSSSSSSSMMASTWLRRN******KQQQQQQQQQRNSSSSSSSSVGHQQWSDPFAIPIGYTWSSID****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFPAIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVHENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFVTVGRKSVDIIPSAALPRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFFTPLSSPRHFVKGSSEDDQKSETHYSPFPSSSSSSSMMASTWLRRNSSQSASKQQQQQQQQQRNSSSSSSSSVGHQQWSDPFAIPIGYTWSSIDDKSSKMKRSKSSRKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query589 2.2.26 [Sep-21-2011]
Q86YJ7626 Ankyrin repeat domain-con yes no 0.667 0.627 0.305 1e-40
Q5F259626 Ankyrin repeat domain-con yes no 0.667 0.627 0.305 2e-40
Q6NRD0510 Ankyrin repeat domain-con N/A no 0.629 0.727 0.299 2e-40
Q8N6S4541 Ankyrin repeat domain-con no no 0.611 0.665 0.302 2e-40
Q7ZYD9513 Ankyrin repeat domain-con N/A no 0.628 0.721 0.306 4e-40
Q28C34509 Ankyrin repeat domain-con yes no 0.629 0.728 0.297 8e-40
Q3UX43541 Ankyrin repeat domain-con no no 0.609 0.663 0.309 2e-39
Q7ZUV0488 Ankyrin repeat domain-con yes no 0.626 0.756 0.305 3e-38
Q80UP5588 Ankyrin repeat domain-con no no 0.631 0.632 0.282 5e-30
Q8IZ07590 Ankyrin repeat domain-con no no 0.685 0.684 0.253 4e-28
>sp|Q86YJ7|AN13B_HUMAN Ankyrin repeat domain-containing protein 13B OS=Homo sapiens GN=ANKRD13B PE=2 SV=4 Back     alignment and function desciption
 Score =  168 bits (426), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 136/445 (30%), Positives = 204/445 (45%), Gaps = 52/445 (11%)

Query: 46  HTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAA 105
           H     L +E  A Q+   +++ D P   TPLHLA  L     AR L + GADV  +N +
Sbjct: 24  HNRHRELEKEVRAGQVD--IEQLD-PRGRTPLHLATTLGHLECARVLLAHGADVGRENRS 80

Query: 106 GWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESS 165
           GW  LQEAV  R+ ++  ++L+        K    +P ++  LR+ +DFY+E+ + F +S
Sbjct: 81  GWTVLQEAVSTRDLELVQLVLRYRDYQRVVKRLAGIPVLLEKLRKAQDFYVEMKWEF-TS 139

Query: 166 VIPFVGKIAPSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLG--------DGDQ 217
            +P V KI PSDTYK+WK   NLR DT+L GFD +  QR ++SF+F G        + D 
Sbjct: 140 WVPLVSKICPSDTYKVWKSGQNLRVDTTLLGFDHMTWQRGNRSFVFRGQDTSAVVMEIDH 199

Query: 218 THNVSCGSLLVLNHDDRKIFDAFENAGAPMSESDIAGFCAQSSVYRPGMDVTKAEL---- 273
              V     L L   DR++  A   A  P  E  ++   A   V    +D          
Sbjct: 200 DRRVVYTETLALAGQDRELLLA---AAQPTEEQVLSRLTA--PVVTTQLDTKNISFERNK 254

Query: 274 VGRTNWRRQEKTESVGEWKARVYELHNVVFSFRSR-----KVHENDVAGSEQVLP--LEL 326
            G   W R EKTE V  ++A+VY   NV    R+R     + H+  V G +  L   L +
Sbjct: 255 TGILGW-RSEKTEMVNGYEAKVYGASNVELITRTRTEHLSEQHKGKVKGCKTPLQSFLGI 313

Query: 327 DEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFVTVGRKSVDIIPSAALPRRSTAV 386
            E   G      P  G  +     + + + +  E  F           P+  L  R    
Sbjct: 314 AEQHGG------PQNGTLITQTLSQANPTAITAEEYFN----------PNFELGNRD--- 354

Query: 387 MAAPPPTKEKEFVKSLRPSIWLTEQFPLK-TEELIPLLDILANKVKAVRRLRELLTTKFP 445
           M  P     K   +  +  +WL E+ PL   E++ P++D++A       +LR+ +T + P
Sbjct: 355 MGRPMELTTK--TQKFKAKLWLCEEHPLSLCEQVAPIIDLMAVSNALFAKLRDFITLRLP 412

Query: 446 PGTFPVKVAIPVVPTVRVVVTFTKF 470
           PG FPVK+ IP+   +   +TF   
Sbjct: 413 PG-FPVKIEIPIFHILNARITFGNL 436

Homo sapiens (taxid: 9606)
>sp|Q5F259|AN13B_MOUSE Ankyrin repeat domain-containing protein 13B OS=Mus musculus GN=Ankrd13b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRD0|A13CA_XENLA Ankyrin repeat domain-containing protein 13C-A OS=Xenopus laevis GN=ankrd13c-a PE=2 SV=1 Back     alignment and function description
>sp|Q8N6S4|AN13C_HUMAN Ankyrin repeat domain-containing protein 13C OS=Homo sapiens GN=ANKRD13C PE=2 SV=2 Back     alignment and function description
>sp|Q7ZYD9|A13CB_XENLA Ankyrin repeat domain-containing protein 13C-B OS=Xenopus laevis GN=ankrd13c-b PE=2 SV=1 Back     alignment and function description
>sp|Q28C34|AN13C_XENTR Ankyrin repeat domain-containing protein 13C OS=Xenopus tropicalis GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q3UX43|AN13C_MOUSE Ankyrin repeat domain-containing protein 13C OS=Mus musculus GN=Ankrd13c PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUV0|AN13C_DANRE Ankyrin repeat domain-containing protein 13C OS=Danio rerio GN=ankrd13c PE=2 SV=1 Back     alignment and function description
>sp|Q80UP5|AN13A_MOUSE Ankyrin repeat domain-containing protein 13A OS=Mus musculus GN=Ankrd13a PE=1 SV=2 Back     alignment and function description
>sp|Q8IZ07|AN13A_HUMAN Ankyrin repeat domain-containing protein 13A OS=Homo sapiens GN=ANKRD13A PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query589
255554869600 protein binding protein, putative [Ricin 0.955 0.938 0.777 0.0
225444489586 PREDICTED: ankyrin repeat domain-contain 0.954 0.959 0.741 0.0
449479465603 PREDICTED: ankyrin repeat domain-contain 0.952 0.930 0.749 0.0
356564488 703 PREDICTED: ankyrin repeat domain-contain 0.935 0.783 0.738 0.0
449433958602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.940 0.920 0.720 0.0
79368544624 ankyrin repeat-containing protein [Arabi 0.920 0.868 0.660 0.0
297837221613 hypothetical protein ARALYDRAFT_475131 [ 0.918 0.882 0.671 0.0
302144132651 unnamed protein product [Vitis vinifera] 0.870 0.788 0.688 0.0
356532283579 PREDICTED: ankyrin repeat domain-contain 0.949 0.965 0.708 0.0
356555672589 PREDICTED: ankyrin repeat domain-contain 0.962 0.962 0.720 0.0
>gi|255554869|ref|XP_002518472.1| protein binding protein, putative [Ricinus communis] gi|223542317|gb|EEF43859.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/579 (77%), Positives = 513/579 (88%), Gaps = 16/579 (2%)

Query: 4   PAIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIAS 63
           P IKPE YSHSPVHYA+VLGDHTTL+R++STLPRL+ DPS+IHTESDSL+QERV+DQI++
Sbjct: 15  PTIKPEHYSHSPVHYAVVLGDHTTLSRLVSTLPRLS-DPSQIHTESDSLAQERVSDQISA 73

Query: 64  VLDRRDVPFRETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIAL 123
           VLDRRDVP+RETPLHLAVRL+D FAAR+LA+AGADVSLQN+AGWNPLQEA+CRR+S+IA 
Sbjct: 74  VLDRRDVPYRETPLHLAVRLSDTFAARALAAAGADVSLQNSAGWNPLQEALCRRSSEIAS 133

Query: 124 ILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWK 183
           +LL+LHHRSAWAKWRRRLPRV++VLRRMRDFYMEISFHFESSVIPFVGKIAPSDTY+IWK
Sbjct: 134 VLLRLHHRSAWAKWRRRLPRVVAVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYRIWK 193

Query: 184 RDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENA 243
           RDGNLRADTSLAGFDGLKIQRADQSFLFLGDGD+ H+V  GSLLV+N D+ KIFDAFENA
Sbjct: 194 RDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDELHSVPAGSLLVVNRDEHKIFDAFENA 253

Query: 244 GAPMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVF 303
           G PMSESDI+GFCAQ+SVYRPGMDVTKAELVGRTNWRRQEKTES+GEWKA+VYE+ NVVF
Sbjct: 254 GGPMSESDISGFCAQTSVYRPGMDVTKAELVGRTNWRRQEKTESIGEWKAKVYEVQNVVF 313

Query: 304 SFRSRKV---HENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREE 360
           SFRSRKV   +ENDVAGSEQVLPLELDEDDDGFLVAENP+FGFN  N+DRRRHSSFVRE 
Sbjct: 314 SFRSRKVTAHNENDVAGSEQVLPLELDEDDDGFLVAENPNFGFNNSNSDRRRHSSFVREG 373

Query: 361 RDFVTVGRKSVDIIPSAAL---PRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTE 417
           R++V+VGRKSVDIIPS+++   PRRS   +A  P TKEKE+V+SLRPS+WLTEQFPLKT+
Sbjct: 374 REWVSVGRKSVDIIPSSSISAPPRRSAVTLAPTPQTKEKEYVRSLRPSVWLTEQFPLKTD 433

Query: 418 ELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTE 477
           EL+PLLDILANKVKAVRR+RELLTTKFP GTFPVK+AIPVVPTVRVV+TFTKFVEL  TE
Sbjct: 434 ELLPLLDILANKVKAVRRMRELLTTKFPAGTFPVKLAIPVVPTVRVVITFTKFVELHPTE 493

Query: 478 QFFTPLSSPRHFVKGSS-EDDQKSET-HYSPFPSSSSSSSMMASTWLRRNSSQSASKQQQ 535
           QF+TPLSSPRHF  G   E+D++S+T  YS   SSSSS S +++ WLRRN+SQSASK QQ
Sbjct: 494 QFYTPLSSPRHFANGGRVEEDKRSDTAFYSSSSSSSSSMSSLSTGWLRRNNSQSASKHQQ 553

Query: 536 QQQQQQRNSSSSSSSSVGHQQWSDPFAIPIGYTWSSIDD 574
           Q+                    +DPFAIP GYTW++ DD
Sbjct: 554 QRCPPPPGVQQQQQQ-------ADPFAIPSGYTWANADD 585

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444489|ref|XP_002273433.1| PREDICTED: ankyrin repeat domain-containing protein 13C-A [Vitis vinifera] Back     alignment and taxonomy information
>gi|449479465|ref|XP_004155606.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356564488|ref|XP_003550486.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Glycine max] Back     alignment and taxonomy information
>gi|449433958|ref|XP_004134763.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 13C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|79368544|ref|NP_564790.3| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|14334426|gb|AAK59411.1| unknown protein [Arabidopsis thaliana] gi|27754742|gb|AAO22814.1| unknown protein [Arabidopsis thaliana] gi|332195798|gb|AEE33919.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297837221|ref|XP_002886492.1| hypothetical protein ARALYDRAFT_475131 [Arabidopsis lyrata subsp. lyrata] gi|297332333|gb|EFH62751.1| hypothetical protein ARALYDRAFT_475131 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|302144132|emb|CBI23237.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532283|ref|XP_003534703.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Glycine max] Back     alignment and taxonomy information
>gi|356555672|ref|XP_003546154.1| PREDICTED: ankyrin repeat domain-containing protein 13C-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query589
TAIR|locus:2036863624 AT1G62050 "AT1G62050" [Arabido 0.675 0.637 0.727 8.6e-160
TAIR|locus:2010597664 AT1G04780 "AT1G04780" [Arabido 0.507 0.450 0.534 2.8e-117
TAIR|locus:2100900640 AT3G04470 "AT3G04470" [Arabido 0.604 0.556 0.5 2.4e-116
TAIR|locus:2093741607 AT3G24210 [Arabidopsis thalian 0.599 0.581 0.482 3.5e-115
UNIPROTKB|F1NWB4432 ANKRD13C "Uncharacterized prot 0.407 0.555 0.312 2e-36
UNIPROTKB|F1P6U9398 ANKRD13C "Uncharacterized prot 0.407 0.603 0.312 2.1e-36
UNIPROTKB|A5PK24546 ANKRD13C "ANKRD13C protein" [B 0.407 0.439 0.312 8.3e-34
RGD|1595074540 Ankrd13c "ankyrin repeat domai 0.407 0.444 0.312 1.1e-33
ZFIN|ZDB-GENE-030131-3892488 ankrd13c "ankyrin repeat domai 0.417 0.504 0.320 1.4e-33
MGI|MGI:2139746541 Ankrd13c "ankyrin repeat domai 0.407 0.443 0.312 1.6e-33
TAIR|locus:2036863 AT1G62050 "AT1G62050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1517 (539.1 bits), Expect = 8.6e-160, Sum P(2) = 8.6e-160
 Identities = 297/408 (72%), Positives = 341/408 (83%)

Query:     5 AIKPEDYSHSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASV 64
             AI+PEDYSHSPVHYA+VLGDH  LTR++S+LP+L  DP +I TESDSLSQERVADQI++V
Sbjct:    12 AIRPEDYSHSPVHYAVVLGDHGALTRLLSSLPKLG-DPEQIRTESDSLSQERVADQISAV 70

Query:    65 LDRRDVPFRETPLHLAVRLNDXXXXXXXXXXXXDVSLQNAAGWNPLQEAVCRRNSDIALI 124
             LDRRDVP RETPLHLAVRL+D            D+SLQNA+GWNPLQEA CRRNS++  +
Sbjct:    71 LDRRDVPSRETPLHLAVRLDDLFAARAISSAGGDISLQNASGWNPLQEAFCRRNSEVMKV 130

Query:   125 LLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKR 184
             LL+ HHR AW KWRRRLPR+I+VLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKR
Sbjct:   131 LLRHHHRLAWCKWRRRLPRLIAVLRRMRDFYMEISFHFESSVIPFVGKIAPSDTYKIWKR 190

Query:   185 DGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAG 244
             DGNLRADT+LAGFDGLKIQRADQSFLFLGDGD++ ++S GSLLVLN DDRKI DAFE+AG
Sbjct:   191 DGNLRADTTLAGFDGLKIQRADQSFLFLGDGDESLDISPGSLLVLNRDDRKILDAFESAG 250

Query:   245 APMSESDIAGFCAQSSVYRPGMDVTKAELVGRTNWRRQEKTESVGEWKARVYELHNVVFS 304
             AP+S+SDIAGFC+QSS+YRPGMDVTKAELVGRTNWRRQEK E+VGEWKARVYE+  V FS
Sbjct:   251 APISDSDIAGFCSQSSLYRPGMDVTKAELVGRTNWRRQEKMENVGEWKARVYEIQKVTFS 310

Query:   305 FRSRKVHENDVAGSEQVLPLELDEDDDGFLVAENPSFGFNVRNNDRRRHSSFVREERDFV 364
             FRSRK+   D  GSEQVLPLELDEDD+GFLVAENPSF        +RRHSSFV+E+RD++
Sbjct:   311 FRSRKIVTGD--GSEQVLPLELDEDDEGFLVAENPSF-LAPPPRSQRRHSSFVKEDRDWI 367

Query:   365 TVGRKSVDIIPSAALP--RRSTA----VMAAPPPTKEKEFVKSLRPSI 406
             +VGRKSVD+ PSAA P  R+S +    V    PP +    V+  R S+
Sbjct:   368 SVGRKSVDVYPSAAPPPPRQSQSPRRSVSQFQPPRRSMAQVQPPRRSV 415
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0048046 "apoplast" evidence=IDA
TAIR|locus:2010597 AT1G04780 "AT1G04780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100900 AT3G04470 "AT3G04470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093741 AT3G24210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWB4 ANKRD13C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6U9 ANKRD13C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5PK24 ANKRD13C "ANKRD13C protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1595074 Ankrd13c "ankyrin repeat domain 13C" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3892 ankrd13c "ankyrin repeat domain 13C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2139746 Ankrd13c "ankyrin repeat domain 13c" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query589
pfam11904290 pfam11904, GPCR_chapero_1, GPCR-chaperone 2e-84
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-04
>gnl|CDD|221304 pfam11904, GPCR_chapero_1, GPCR-chaperone Back     alignment and domain information 
 Score =  264 bits (677), Expect = 2e-84
 Identities = 103/299 (34%), Positives = 152/299 (50%), Gaps = 31/299 (10%)

Query: 189 RADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMS 248
           R DT+LAGFDG+K QR D+SFLF G+         GSL+ ++HDD+++++A E       
Sbjct: 1   RVDTTLAGFDGMKWQRGDRSFLFKGEESDA-----GSLIEVDHDDKEVYNALEELSDAEE 55

Query: 249 ESDIAGFCAQSSVYRPGMDVTKAELVGR---TNWRRQEKTESVGEWKARVYELHNVVFSF 305
           + ++A     S +   G+D T+           WRR EKTE+VG ++A+VY+  NV    
Sbjct: 56  DEEVAALL-TSPIVSTGLDTTQIGFERSKSILGWRRSEKTETVGGYEAKVYDASNVELIT 114

Query: 306 RSRKVHENDVAGSEQVLPLELDEDDDG-FLVAENPSFGFNVRNNDRRRHSSFVREERDFV 364
           ++R    ++    E    L+  +   G  L AE         +       S        +
Sbjct: 115 KTR----SEHLSEEDQQKLKSGKTSLGSGLGAEQD---GGPTSRQGPVEQSATAPNPTAL 167

Query: 365 TV---GRKSVDIIPSAALPRRSTAVMAAPPPTKEKEFVKSLRPSIWLTEQFPLKTEELIP 421
           T     +    +     + R          P +E E  K  + ++WL+E FPL  E+L+P
Sbjct: 168 TPEEYFKPEFKLKKGRDIGR----------PKEESEKKKKFKATLWLSEDFPLSLEQLLP 217

Query: 422 LLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVELQSTEQFF 480
           +LD+LANK K  RRLRE +TTK PPG FPVK+ IP+ PT+  VVTFT F EL + E+  
Sbjct: 218 ILDLLANKNKHFRRLREFVTTKLPPG-FPVKIEIPLFPTINAVVTFTNFEELDAAEEEC 275

This domain, and the associated ANK family repeat pfam00023 domain, together act as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2. Length = 290
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 589
KOG0522560 consensus Ankyrin repeat protein [General function 100.0
PF11904307 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR02183 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.87
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.8
PHA02791284 ankyrin-like protein; Provisional 99.79
PHA02791284 ankyrin-like protein; Provisional 99.77
KOG0514452 consensus Ankyrin repeat protein [General function 99.76
PHA02875413 ankyrin repeat protein; Provisional 99.75
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.75
PHA02878477 ankyrin repeat protein; Provisional 99.75
PHA02878477 ankyrin repeat protein; Provisional 99.74
PHA02946446 ankyin-like protein; Provisional 99.73
PHA02874434 ankyrin repeat protein; Provisional 99.73
PHA02874434 ankyrin repeat protein; Provisional 99.71
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.71
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.71
PHA03100480 ankyrin repeat protein; Provisional 99.71
KOG0510929 consensus Ankyrin repeat protein [General function 99.7
KOG0508615 consensus Ankyrin repeat protein [General function 99.7
PHA02875413 ankyrin repeat protein; Provisional 99.7
PHA02741169 hypothetical protein; Provisional 99.7
PHA02795437 ankyrin-like protein; Provisional 99.69
PHA03095471 ankyrin-like protein; Provisional 99.69
PHA03100480 ankyrin repeat protein; Provisional 99.69
PHA02798489 ankyrin-like protein; Provisional 99.67
PHA02989494 ankyrin repeat protein; Provisional 99.67
PLN03192823 Voltage-dependent potassium channel; Provisional 99.67
PHA02859209 ankyrin repeat protein; Provisional 99.66
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.66
PHA02946446 ankyin-like protein; Provisional 99.66
PHA02884300 ankyrin repeat protein; Provisional 99.66
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.65
PHA03095471 ankyrin-like protein; Provisional 99.65
PHA02743166 Viral ankyrin protein; Provisional 99.65
PHA02736154 Viral ankyrin protein; Provisional 99.65
PHA02876682 ankyrin repeat protein; Provisional 99.65
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.65
PHA02917661 ankyrin-like protein; Provisional 99.63
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.62
PHA02795437 ankyrin-like protein; Provisional 99.62
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.62
PHA02876682 ankyrin repeat protein; Provisional 99.61
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.61
PHA02989494 ankyrin repeat protein; Provisional 99.6
KOG0508615 consensus Ankyrin repeat protein [General function 99.59
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.59
KOG0510 929 consensus Ankyrin repeat protein [General function 99.58
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.57
PHA02741169 hypothetical protein; Provisional 99.57
PHA02798489 ankyrin-like protein; Provisional 99.57
PHA02730672 ankyrin-like protein; Provisional 99.56
TIGR00870743 trp transient-receptor-potential calcium channel p 99.55
PLN03192823 Voltage-dependent potassium channel; Provisional 99.53
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.5
PHA02917661 ankyrin-like protein; Provisional 99.45
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.44
PHA02884300 ankyrin repeat protein; Provisional 99.44
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.41
PHA02730672 ankyrin-like protein; Provisional 99.38
PHA02743166 Viral ankyrin protein; Provisional 99.38
TIGR00870743 trp transient-receptor-potential calcium channel p 99.37
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.35
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.31
KOG0514452 consensus Ankyrin repeat protein [General function 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.29
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.27
PHA02792631 ankyrin-like protein; Provisional 99.27
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.26
PHA02736154 Viral ankyrin protein; Provisional 99.26
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.24
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.22
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.21
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.2
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.2
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.18
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.18
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.15
PHA02792631 ankyrin-like protein; Provisional 99.14
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.11
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.1
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.08
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.01
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.96
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.89
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.72
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.7
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.7
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.66
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.65
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.55
PF1360630 Ank_3: Ankyrin repeat 98.5
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.48
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.43
PF1360630 Ank_3: Ankyrin repeat 98.41
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.26
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.1
KOG2384223 consensus Major histocompatibility complex protein 97.94
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.93
KOG0818669 consensus GTPase-activating proteins of the GIT fa 97.84
KOG0522560 consensus Ankyrin repeat protein [General function 97.82
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.79
KOG0511516 consensus Ankyrin repeat protein [General function 97.59
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.56
KOG0511516 consensus Ankyrin repeat protein [General function 97.44
KOG0520975 consensus Uncharacterized conserved protein, conta 97.35
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.33
KOG2384223 consensus Major histocompatibility complex protein 96.95
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.88
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.53
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.39
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.36
KOG2505591 consensus Ankyrin repeat protein [General function 96.17
KOG0520975 consensus Uncharacterized conserved protein, conta 95.58
KOG2505591 consensus Ankyrin repeat protein [General function 94.92
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=5e-110  Score=878.38  Aligned_cols=480  Identities=39%  Similarity=0.615  Sum_probs=373.4

Q ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCccchhhhhhHHHHHHHHHhhcCCCCCCCCCCHHHHHHHcCCHHHHHHHH
Q 007790           14 SPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSLA   93 (589)
Q Consensus        14 TPLH~Aa~~G~~e~vk~LL~~Gadin~~~~~l~tAl~~~~~e~~~~lI~a~ln~~D~~~G~TPLHlAv~~g~~e~vklLL   93 (589)
                      .|||+++...+.+.+..++...+                         ...++.+|. .|+||||+||++||.++++.||
T Consensus        22 ~~lh~~~~~~~~~sl~~el~~~~-------------------------~~~id~~D~-~g~TpLhlAV~Lg~~~~a~~Ll   75 (560)
T KOG0522|consen   22 KPLHWAVVTTDSDSLEQELLAKV-------------------------SLVIDRRDP-PGRTPLHLAVRLGHVEAARILL   75 (560)
T ss_pred             cccchhhhccchhhHHHHHhhhh-------------------------hceeccccC-CCCccHHHHHHhcCHHHHHHHH
Confidence            45999999988887776654322                         135788897 8999999999999999999999


Q ss_pred             HCCCCCCcccCCCCCHHHHHHHcCCHHHHHHHHHhcCchhHHhhcCCchhHHHHHhhccchhhccccccccccccccccc
Q 007790           94 SAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRRMRDFYMEISFHFESSVIPFVGKI  173 (589)
Q Consensus        94 ~~GADvn~~d~~G~TPLh~A~~~G~~eiv~lLL~~ga~~~~~~~~g~tPlllA~l~~~~Df~~el~~~f~sswiPlvsri  173 (589)
                      .+|||+..+|..||+|||+|+++|+.+++..++++....++..+..+.|.+++++.+++|||||++|||+| ||||+|||
T Consensus        76 ~a~Adv~~kN~~gWs~L~EAv~~g~~q~i~~vlr~~~~q~~~~~~~~~p~ll~~l~~~~DFYmE~~wdF~S-WvPlvSrI  154 (560)
T KOG0522|consen   76 SAGADVSIKNNEGWSPLHEAVSTGNEQIITEVLRHLKYQAWEKWERRLPRLLAKLSEMPDFYMEMKWDFQS-WIPLLSRI  154 (560)
T ss_pred             hcCCCccccccccccHHHHHHHcCCHHHHHHHHHHhHHHHHHHHHhcchHHHHHHHhCccceEEEEeccee-ehhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999995 99999999


Q ss_pred             CCCccccccccCCceeecccccCCccchhccccccEEEccCCCCCCccCCcceEEEeCCchhHHHHhhhcCCCCC----H
Q 007790          174 APSDTYKIWKRDGNLRADTSLAGFDGLKIQRADQSFLFLGDGDQTHNVSCGSLLVLNHDDRKIFDAFENAGAPMS----E  249 (589)
Q Consensus       174 ~PsD~~kI~K~G~~lR~D~tL~gf~~~~~~Rg~~S~if~g~~~~~~~~~~~~l~~ldh~~~~v~~~~~~~~~~~~----~  249 (589)
                      ||||+|+|||+|++||+||||+||++|+|+|||+||||+|++      +++++|||||++++|++++..+..+++    +
T Consensus       155 ~PSD~~kIyK~G~~lR~DTTL~gF~~m~wqRGd~SFlF~gd~------~~~e~lvl~hdek~v~~~~~r~~~e~se~~~~  228 (560)
T KOG0522|consen  155 LPSDTCKIYKRGSSLRADTTLAGFEGMKWQRGDQSFLFRGDA------NPAELLVLDHDEKVVTNAFQRLRDEESEAEME  228 (560)
T ss_pred             CchhhHHHhhcccceeeeeeeecCCCceEEecceEEEEecCC------CcceeEEEeccchhhHHHHHhcccccchhhhH
Confidence            999999999999999999999999999999999999999987      258999999999999988877666655    4


Q ss_pred             HHHHhhhhcCCcccCCcCcccceee--cccccccccccccccceeeEEEEeeceEEEEEEeccccccccCCc-----ccc
Q 007790          250 SDIAGFCAQSSVYRPGMDVTKAELV--GRTNWRRQEKTESVGEWKARVYELHNVVFSFRSRKVHENDVAGSE-----QVL  322 (589)
Q Consensus       250 ~~v~~~l~~~~i~~~~~d~t~~~~~--~~~~W~r~~k~E~Vg~~~a~vy~~~~v~~~~r~R~~h~~~~~~~~-----~~~  322 (589)
                      +||+.+| +++|+++++| |+.+.|  +++||+|++|+|+||||+||||+|+||.|++|+|+||++++|..+     +..
T Consensus       229 ~eVd~~l-s~~i~~t~l~-tktiaF~~~~~gWrr~ek~E~Vg~y~akvY~v~nv~l~tk~RreHLs~ed~~r~~~~~~~~  306 (560)
T KOG0522|consen  229 EEVDVRL-SQDILYTPLD-TKTIAFERGFLGWRRQEKTETVGGYKAKVYDVSNVHLSTKKRREHLSEEDEKRVIEEAQLT  306 (560)
T ss_pred             HHHHHHh-cCcceecccc-chhHHHHHhhhhhhhhchhhhccCeeeeEEeecceEEEEeecccccchHHHhhhhhhccCC
Confidence            5888776 5788888888 777765  689999999999999999999999999999999999997776322     222


Q ss_pred             CCccccCCCCccccCCCCCCCCCCCCCc--------ccCCCccccc-CCccccCCcccCCCCCCCCcccccccccCCCCc
Q 007790          323 PLELDEDDDGFLVAENPSFGFNVRNNDR--------RRHSSFVREE-RDFVTVGRKSVDIIPSAALPRRSTAVMAAPPPT  393 (589)
Q Consensus       323 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  393 (589)
                      ++|..  --|+....++.  .+..+..+        .++..+.+++ +.|.. .     . . +.        +.|++ .
T Consensus       307 ~~es~--~~~~~~~~~~~--~~~~~~~r~l~~~sls~~pt~i~p~~~~~~~~-a-----~-~-g~--------~~GR~-~  365 (560)
T KOG0522|consen  307 PLESN--LLSIKETMFGP--KTAECANRDLYTSSLSAPPTAITPPEYENYEG-A-----L-I-GK--------DPGRP-K  365 (560)
T ss_pred             hhhhh--hhhhhhhcCCC--ccccccccchhhcccCCCcccCCCCccccccc-c-----c-c-cC--------CCCCc-h
Confidence            23221  00111111110  00000000        0000111111 11100 0     0 0 11        01223 2


Q ss_pred             cccccccccccEeeeecCCCCCcchhhhHHHHhhhchHHHHHHHhHhhhcCCCCCCceEEEcccceEEEEEEEecccccc
Q 007790          394 KEKEFVKSLRPSIWLTEQFPLKTEELIPLLDILANKVKAVRRLRELLTTKFPPGTFPVKVAIPVVPTVRVVVTFTKFVEL  473 (589)
Q Consensus       394 ~~~~~~k~~ka~lwls~~fPLs~e~llpildvla~~~k~~~kLr~fi~~klp~g~FPVKi~IPl~~tv~a~vTF~~f~~l  473 (589)
                      .+++++|+|||+||||+||||++|||||||||||+.+|||+|||||||+||||| |||||+|||||||+|+||||||+++
T Consensus       366 ~~k~~~k~fkA~lwmseefPLsldqllpildlmA~~~khf~rLReFitlkLPpG-FPVKieIPi~~tv~a~vTFqkf~~~  444 (560)
T KOG0522|consen  366 EEKEKKKKFKATLWMSEEFPLSLDQLLPILDLMANPSKHFARLREFITLKLPPG-FPVKIEIPIFPTVTAVVTFQKFESL  444 (560)
T ss_pred             hhhhhhhhhhhheeecccCCccHHHHHHHHHHHcccHHHHHHHHHHHhhcCCCC-CceeEeecccceEEEEEEeeccccC
Confidence            468899999999999999999999999999999999999999999999999999 9999999999999999999999999


Q ss_pred             CCC-CCcccCCCCcccccCCCCCccccccCCCCCCCCCCCCcccccccceecccCCchh----hHHHHHHHhhccCCCCC
Q 007790          474 QST-EQFFTPLSSPRHFVKGSSEDDQKSETHYSPFPSSSSSSSMMASTWLRRNSSQSAS----KQQQQQQQQQRNSSSSS  548 (589)
Q Consensus       474 ~~~-~~f~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~  548 (589)
                      ++. ++|+||+|+|. |.+...    ..-.+      +..-++   .||+.|+++-.+.    ....+|+          
T Consensus       445 ~~i~~~~~tipss~~-~E~~~d----~~r~~------d~~~~s---~s~~~~~~~~~~~~n~~~~~~~yq----------  500 (560)
T KOG0522|consen  445 DPIDDENVTIPSSYG-YEIDDD----VRRFQ------DLDRSS---RSNRSWVRSARGLGNSYSDDMLYQ----------  500 (560)
T ss_pred             CCCccccccCCcccc-cccccc----ccccc------cccccc---cccHhhhcccccCCCCCCchhhhh----------
Confidence            765 78999999991 221111    00000      111111   3677777632211    1123333          


Q ss_pred             CCCCCCCCCCCCcccCCCCeeeccccchhhhhh
Q 007790          549 SSSVGHQQWSDPFAIPIGYTWSSIDDKSSKMKR  581 (589)
Q Consensus       549 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  581 (589)
                             ..+|||+||++|+|.+..+++.|++.
T Consensus       501 -------~~~d~sl~ps~~~~~~~~~~~~r~~s  526 (560)
T KOG0522|consen  501 -------YAIDPSLLPSTYKWPSSAQSYVRISS  526 (560)
T ss_pred             -------hhcCcccCCCcccCCCchhhcccccc
Confidence                   68999999999999999888777653

>PF11904 GPCR_chapero_1: GPCR-chaperone; InterPro: IPR021832 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query589
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 3e-07
2rfa_A232 Transient receptor potential cation channel subfa 3e-06
2rfa_A232 Transient receptor potential cation channel subfa 4e-05
2rfa_A232 Transient receptor potential cation channel subfa 7e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-06
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-04
2pnn_A273 Transient receptor potential cation channel subfa 7e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 6e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
2etb_A256 Transient receptor potential cation channel subfam 9e-05
2etb_A256 Transient receptor potential cation channel subfam 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 56.4 bits (137), Expect = 4e-09
 Identities = 27/115 (23%), Positives = 43/115 (37%), Gaps = 26/115 (22%)

Query: 14  SPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFR 73
           S +H AI+  +      +I  +    A                        L+ ++   +
Sbjct: 10  SFLHLAIIHEEKALTMEVIRQVKGDLAF-----------------------LNFQNN-LQ 45

Query: 74  ETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNS-DIALILLK 127
           +TPLHLAV  N    A +L  AG D  L++  G  PL  A C +       +L +
Sbjct: 46  QTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLA-CEQGCLASVGVLTQ 99
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query589
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.89
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.88
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.86
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.86
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.85
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.85
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.84
3hra_A201 Ankyrin repeat family protein; structural protein; 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.84
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.84
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.84
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.84
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.84
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.83
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.83
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.83
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.83
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.83
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.83
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.83
2rfa_A232 Transient receptor potential cation channel subfa 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.82
2etb_A256 Transient receptor potential cation channel subfam 99.82
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.82
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.82
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.82
2rfa_A232 Transient receptor potential cation channel subfa 99.82
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.82
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.81
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.81
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.81
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.81
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.81
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.81
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.81
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.81
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.81
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.81
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.8
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.8
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.79
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.79
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.79
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.79
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.79
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.79
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.79
2etb_A256 Transient receptor potential cation channel subfam 99.79
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.79
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.79
2pnn_A273 Transient receptor potential cation channel subfa 99.78
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.78
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.78
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.78
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.78
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.77
2pnn_A273 Transient receptor potential cation channel subfa 99.77
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.77
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.77
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.77
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.77
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.77
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.77
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.77
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.76
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.76
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.76
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.76
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.76
3hra_A201 Ankyrin repeat family protein; structural protein; 99.75
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.75
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.75
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.75
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.74
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.74
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.74
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.74
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.74
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.73
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.72
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.69
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.67
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.66
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.66
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.64
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.62
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.62
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.61
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.61
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.6
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.6
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.6
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.6
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.58
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.56
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.54
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.52
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.5
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.45
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.42
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.41
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.41
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.28
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.89  E-value=9.3e-23  Score=193.25  Aligned_cols=136  Identities=20%  Similarity=0.201  Sum_probs=123.7

Q ss_pred             hHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCccchhhhhhHH----HHHHHHH--hhcCCCCCCCCCCHHHHHHHcCCHH
Q 007790           14 SPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQE----RVADQIA--SVLDRRDVPFRETPLHLAVRLNDAF   87 (589)
Q Consensus        14 TPLH~Aa~~G~~e~vk~LL~~Gadin~~~~~l~tAl~~~~~e----~~~~lI~--a~ln~~D~~~G~TPLHlAv~~g~~e   87 (589)
                      ++|+.||..|+.++|+.||++|+++|..+..+.++++.+...    .+..++.  ++++.+|. .|+||||+||..|+.+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~-~g~TpLh~A~~~g~~~   84 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS-DGRTPLHHAAENGHKE   84 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHTTCHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhcc-CCCCHHHHHHHcCCHH
Confidence            479999999999999999999999999998888887665544    4455555  67889998 9999999999999999


Q ss_pred             HHHHHHHCCCCCCcccCCCCCHHHHHHHcCCHHHHHHHHHhcCchhHHhhcCCchhHHHHHhh
Q 007790           88 AARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVISVLRR  150 (589)
Q Consensus        88 ~vklLL~~GADvn~~d~~G~TPLh~A~~~G~~eiv~lLL~~ga~~~~~~~~g~tPlllA~l~~  150 (589)
                      ++++||++|+|+|.+|..|+||||+|+..|+.+++++|+++|++++..+..|.||+++|+...
T Consensus        85 ~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g  147 (169)
T 4gpm_A           85 VVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHG  147 (169)
T ss_dssp             HHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTT
T ss_pred             HHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcC
Confidence            999999999999999999999999999999999999999999999999999999999997653
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 589
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.003
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Lin-12
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 57.4 bits (137), Expect = 1e-09
 Identities = 13/54 (24%), Positives = 20/54 (37%)

Query: 74  ETPLHLAVRLNDAFAARSLASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLK 127
           +TP+ LA +         L   GA V   +A      Q A    + +I  I  +
Sbjct: 222 KTPIMLAAQEGRIEVVMYLIQQGASVEAVDATDHTARQLAQANNHHNIVDIFDR 275
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query589
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.81
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.79
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.78
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.76
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.76
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.74
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.74
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.73
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.73
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.72
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.72
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.72
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.71
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.7
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.67
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.59
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.58
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.58
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.58
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.57
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.55
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.55
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.49
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.48
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.46
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.35
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.82  E-value=2.9e-21  Score=169.88  Aligned_cols=106  Identities=17%  Similarity=0.119  Sum_probs=100.6

Q ss_pred             ChHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCccchhhhhhHHHHHHHHHhhcCCCCCCCCCCHHHHHHHcCCHHHHHHH
Q 007790           13 HSPVHYAIVLGDHTTLTRIISTLPRLAADPSKIHTESDSLSQERVADQIASVLDRRDVPFRETPLHLAVRLNDAFAARSL   92 (589)
Q Consensus        13 ~TPLH~Aa~~G~~e~vk~LL~~Gadin~~~~~l~tAl~~~~~e~~~~lI~a~ln~~D~~~G~TPLHlAv~~g~~e~vklL   92 (589)
                      .|||++||..|+.++|+.||++|+++                           +.+|. .|+||||+|+..|+.+++++|
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d~---------------------------n~~~~-~g~t~lh~A~~~~~~~~~~~l   54 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGEDV---------------------------NRTLE-GGRKPLHYAADCGQLEILEFL   54 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCCC---------------------------CCCSS-SSCCTTHHHHHHSTTTHHHHH
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhcc---------------------------ccccc-ccccccccccccccccccccc
Confidence            58999999999999999999999887                           44555 899999999999999999999


Q ss_pred             HHCCCCCCcccCCCCCHHHHHHHcCCHHHHHHHHHhcCchhHHhhcCCchhHHH
Q 007790           93 ASAGADVSLQNAAGWNPLQEAVCRRNSDIALILLKLHHRSAWAKWRRRLPRVIS  146 (589)
Q Consensus        93 L~~GADvn~~d~~G~TPLh~A~~~G~~eiv~lLL~~ga~~~~~~~~g~tPlllA  146 (589)
                      +++|+|++.+|..|+||||+|+..|+.+++++|+++|++++..+..|.||+++|
T Consensus        55 l~~g~din~~d~~g~tpLh~A~~~~~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a  108 (118)
T d1myoa_          55 LLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEAT  108 (118)
T ss_dssp             HHSSCTTTCCSSSCSCHHHHHHTTTCCHHHHHHHTTCCCSSSSSSSTCCCCCTC
T ss_pred             ccccceeeecccccccchhhhhhcCchhhhhhhhcccccceeeCCCCCCHHHHH
Confidence            999999999999999999999999999999999999999999999999999876
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure