Citrus Sinensis ID: 007820
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 588 | 2.2.26 [Sep-21-2011] | |||||||
| P28724 | 449 | NADP-specific glutamate d | N/A | no | 0.676 | 0.886 | 0.475 | 1e-111 | |
| Q8RQP4 | 447 | NADP-specific glutamate d | yes | no | 0.653 | 0.859 | 0.493 | 1e-107 | |
| P31026 | 447 | NADP-specific glutamate d | yes | no | 0.654 | 0.861 | 0.489 | 1e-107 | |
| P28998 | 523 | NADP-specific glutamate d | N/A | no | 0.653 | 0.734 | 0.478 | 1e-106 | |
| P95544 | 444 | NAD(P)-specific glutamate | no | no | 0.670 | 0.887 | 0.452 | 1e-106 | |
| P43793 | 449 | NADP-specific glutamate d | yes | no | 0.676 | 0.886 | 0.455 | 1e-106 | |
| P15111 | 447 | NADP-specific glutamate d | yes | no | 0.666 | 0.876 | 0.464 | 1e-105 | |
| Q8Z6F6 | 447 | NADP-specific glutamate d | N/A | no | 0.666 | 0.876 | 0.464 | 1e-105 | |
| P00370 | 447 | NADP-specific glutamate d | N/A | no | 0.654 | 0.861 | 0.465 | 1e-103 | |
| P94598 | 444 | Glutamate dehydrogenase O | yes | no | 0.670 | 0.887 | 0.454 | 1e-103 |
| >sp|P28724|DHE4_GIAIN NADP-specific glutamate dehydrogenase OS=Giardia intestinalis PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 402 bits (1033), Expect = e-111, Method: Compositional matrix adjust.
Identities = 191/402 (47%), Positives = 268/402 (66%), Gaps = 4/402 (0%)
Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRV 249
++T ++ +RD H EF Q+V+E + +L+ + + Y+ I ER+LEPER+I+FRV
Sbjct: 3 AQTIEELIAVIKQRDGHMTEFRQAVEEVVDSLKVIFEREPKYIPIFERMLEPERVIIFRV 62
Query: 250 PWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG 309
PW+DD G +VNRGFRVQ++ ALGP +GGLRFHPS+NLSI KFLGFEQ LKN+L+ +G
Sbjct: 63 PWMDDAGRINVNRGFRVQYNSALGPYKGGLRFHPSVNLSILKFLGFEQILKNSLTTLPMG 122
Query: 310 GAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRR 369
G GGSDFDPKGKSDNE+MRFCQSFM E+ R++G D D+P+ ++GVG RE+GYL+GQY+R
Sbjct: 123 GGKGGSDFDPKGKSDNEVMRFCQSFMTELQRHVGADTDVPAGDIGVGAREIGYLYGQYKR 182
Query: 370 LAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM 429
L F G TG + W GS +R EATGYG V+F + + D N ++G ++SGSG +A
Sbjct: 183 LRNEFTGVLTGKNVKWGGSFIRPEATGYGAVYFLEEMCKDNNTVIRGKNVLLSGSGNVAQ 242
Query: 430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRS-LRDYSKTYARSKY 488
EKLI GA ++ SD+ G +VD+DGF+ K++ L +K+++R + ++ Y Y
Sbjct: 243 FACEKLIQLGAKVLTFSDSNGTIVDKDGFNEEKLAHLMYLKNEKRGRVSEFKDKYPSVAY 302
Query: 489 YDEAKPW---NERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKK 545
Y+ KPW + D PCA+QNE+ DA LV G + + EG+NMP T EAV V
Sbjct: 303 YEGKKPWECFEGQMDCIMPCATQNEVSGDDATRLVGLGLKFVAEGANMPSTAEAVHVYHA 362
Query: 546 ANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQ 587
V+ PA A+ AGGV LE++Q + W+ E+ + KL+
Sbjct: 363 KGVMYGPAKASNAGGVSVSGLEMSQNSVRLQWTAEEVDQKLR 404
|
Giardia intestinalis (taxid: 5741) EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 4 |
| >sp|Q8RQP4|DHE4_COREF NADP-specific glutamate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gdh PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P31026|DHE4_CORGL NADP-specific glutamate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gdh PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P28998|DHE4_CHLSO NADP-specific glutamate dehydrogenase (Fragment) OS=Chlorella sorokiniana PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P95544|DHE4_PRERU NAD(P)-specific glutamate dehydrogenase OS=Prevotella ruminicola GN=gdhA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P43793|DHE4_HAEIN NADP-specific glutamate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gdhA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P15111|DHE4_SALTY NADP-specific glutamate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gdhA PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q8Z6F6|DHE4_SALTI NADP-specific glutamate dehydrogenase OS=Salmonella typhi GN=gdhA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P00370|DHE4_ECOLI NADP-specific glutamate dehydrogenase OS=Escherichia coli (strain K12) GN=gdhA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P94598|DHE3_BACTN Glutamate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gdhA PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 588 | ||||||
| 449458193 | 637 | PREDICTED: NADP-specific glutamate dehyd | 0.998 | 0.921 | 0.913 | 0.0 | |
| 255549662 | 636 | glutamate dehydrogenase, putative [Ricin | 0.998 | 0.922 | 0.916 | 0.0 | |
| 225442347 | 635 | PREDICTED: NADP-specific glutamate dehyd | 0.994 | 0.921 | 0.925 | 0.0 | |
| 356526047 | 637 | PREDICTED: NADP-specific glutamate dehyd | 0.998 | 0.921 | 0.882 | 0.0 | |
| 356522684 | 637 | PREDICTED: NADP-specific glutamate dehyd | 0.998 | 0.921 | 0.877 | 0.0 | |
| 30695050 | 637 | glutamate dehydrogenase (NADP+) [Arabido | 0.998 | 0.921 | 0.848 | 0.0 | |
| 224128524 | 621 | predicted protein [Populus trichocarpa] | 0.971 | 0.919 | 0.886 | 0.0 | |
| 297847546 | 624 | hypothetical protein ARALYDRAFT_474290 [ | 0.976 | 0.919 | 0.857 | 0.0 | |
| 12321666 | 624 | NADP-specific glutatamate dehydrogenase, | 0.976 | 0.919 | 0.853 | 0.0 | |
| 147768438 | 638 | hypothetical protein VITISV_043645 [Viti | 0.972 | 0.896 | 0.854 | 0.0 |
| >gi|449458193|ref|XP_004146832.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] gi|449527615|ref|XP_004170805.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 1109 bits (2868), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 537/588 (91%), Positives = 574/588 (97%), Gaps = 1/588 (0%)
Query: 1 MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
MLLPVGGLGMN++MDDMNLIQQAQRHHLVVRELGEEIDLEIG GDDDPSFA+ P++GGP
Sbjct: 1 MLLPVGGLGMNTSMDDMNLIQQAQRHHLVVRELGEEIDLEIGHGDDDPSFASTPIIGGPV 60
Query: 60 REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKE 119
REPSAE+HD++K + +VSQL NDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVK+
Sbjct: 61 REPSAEDHDESKHVVLVSQLSNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKD 120
Query: 120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
GTARIFCSVC+EYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKII
Sbjct: 121 GTARIFCSVCKEYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIV 180
Query: 180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
DKPIYVKALMSKTAGSI+EAALKRDP+E+EFIQ+VQE++HALERVIAKNSHYVNIMERLL
Sbjct: 181 DKPIYVKALMSKTAGSIIEAALKRDPNEVEFIQAVQEAVHALERVIAKNSHYVNIMERLL 240
Query: 240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
EPERM++FRVPWVDDRGETHVNRGFRVQF+QALGPCRGGLRFHPSMNLSI KFLGFEQTL
Sbjct: 241 EPERMVLFRVPWVDDRGETHVNRGFRVQFNQALGPCRGGLRFHPSMNLSITKFLGFEQTL 300
Query: 300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSF+NEI+RYLGPDKDLPSEEMGVGTRE
Sbjct: 301 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFINEIYRYLGPDKDLPSEEMGVGTRE 360
Query: 360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
MGYLFGQYRRLAGHF+GSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC
Sbjct: 361 MGYLFGQYRRLAGHFEGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 420
Query: 420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
VSGSGKIAMHVLEKLIAYGA+P++VSD+KGYLVDEDGFDYMKISFLRDIK+QQRSLRDY
Sbjct: 421 AVSGSGKIAMHVLEKLIAYGALPITVSDSKGYLVDEDGFDYMKISFLRDIKAQQRSLRDY 480
Query: 480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
SKTYARSKYYDE KPWNERCDVAFPCA NEIDQ+DAINL++SGCRIL+EGSNMPCTPEA
Sbjct: 481 SKTYARSKYYDEGKPWNERCDVAFPCAYHNEIDQADAINLISSGCRILIEGSNMPCTPEA 540
Query: 540 VDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQ 587
VDVL+KAN+LIAPAMAAGAGGVVAGELELN CN++HWSPEDFESKLQ
Sbjct: 541 VDVLRKANILIAPAMAAGAGGVVAGELELNHACNLMHWSPEDFESKLQ 588
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255549662|ref|XP_002515882.1| glutamate dehydrogenase, putative [Ricinus communis] gi|223544787|gb|EEF46302.1| glutamate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225442347|ref|XP_002281123.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356526047|ref|XP_003531631.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356522684|ref|XP_003529976.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30695050|ref|NP_175583.2| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] gi|332194586|gb|AEE32707.1| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224128524|ref|XP_002329025.1| predicted protein [Populus trichocarpa] gi|222839696|gb|EEE78019.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297847546|ref|XP_002891654.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] gi|297337496|gb|EFH67913.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|12321666|gb|AAG50868.1|AC025294_6 NADP-specific glutatamate dehydrogenase, putative [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147768438|emb|CAN69269.1| hypothetical protein VITISV_043645 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 588 | ||||||
| TAIR|locus:2017542 | 637 | AT1G51720 [Arabidopsis thalian | 0.998 | 0.921 | 0.809 | 5.7e-265 | |
| GENEDB_PFALCIPARUM|PF14_0286 | 510 | PF14_0286 "glutamate dehydroge | 0.663 | 0.764 | 0.470 | 3.5e-107 | |
| UNIPROTKB|Q8ILF7 | 510 | PF14_0286 "Glutamate dehydroge | 0.663 | 0.764 | 0.470 | 3.5e-107 | |
| GENEDB_PFALCIPARUM|PF14_0164 | 470 | PF14_0164 "NADP-specific gluta | 0.707 | 0.885 | 0.433 | 5.6e-100 | |
| UNIPROTKB|Q8ILT0 | 470 | PF14_0164 "Glutamate dehydroge | 0.707 | 0.885 | 0.433 | 5.6e-100 | |
| UNIPROTKB|Q8RQP4 | 447 | gdh "NADP-specific glutamate d | 0.651 | 0.856 | 0.479 | 2.8e-98 | |
| UNIPROTKB|P31026 | 447 | gdh "NADP-specific glutamate d | 0.654 | 0.861 | 0.474 | 4.5e-98 | |
| UNIPROTKB|P95544 | 444 | gdhA "NAD(P)-specific glutamat | 0.668 | 0.885 | 0.440 | 4.2e-95 | |
| TIGR_CMR|GSU_1305 | 450 | GSU_1305 "Glu/Leu/Phe/Val dehy | 0.663 | 0.866 | 0.465 | 2.3e-94 | |
| UNIPROTKB|P15111 | 447 | gdhA "NADP-specific glutamate | 0.664 | 0.874 | 0.450 | 4.3e-93 |
| TAIR|locus:2017542 AT1G51720 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2549 (902.4 bits), Expect = 5.7e-265, P = 5.7e-265
Identities = 476/588 (80%), Positives = 529/588 (89%)
Query: 1 MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
M P GGLGMN +MDDMNLIQQAQRH LVV LGEEIDLEIGPG+DD +FANN L+GGP
Sbjct: 1 MFGPTGGLGMNPSMDDMNLIQQAQRHQLVVSNLGEEIDLEIGPGEDDAAFANNSLIGGPP 60
Query: 60 REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAXXXXXXXXXXXXXXADTYKWAYVDVKE 119
REPS EHD+ K M +VS LP++DQD+SK PA ADTYKWAYVD+K+
Sbjct: 61 REPSTGEHDETKHMVLVSDLPSEDQDISKGTPAKRKKKVVKRWREEWADTYKWAYVDMKD 120
Query: 120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
GTARIFCS+CREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQ ASKDKI+
Sbjct: 121 GTARIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKDKIVV 180
Query: 180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
DKPIYVK +MSK+AGSIVE ALKRDP+EIEF+QSVQES+HALERVIAKNSHYVNIMERLL
Sbjct: 181 DKPIYVKTVMSKSAGSIVEGALKRDPNEIEFVQSVQESVHALERVIAKNSHYVNIMERLL 240
Query: 240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
EPERMIVFRVPW+DDRGETHVNRGFRVQF+QALGPCRGG+RFHPSMNLSIAKFLGF+QTL
Sbjct: 241 EPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFLGFQQTL 300
Query: 300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
KNALSPYKLGGA+GGSDFDPKGKSDNEIMRFCQSFMNE++RY+GPDKDLPSEE+GVGTRE
Sbjct: 301 KNALSPYKLGGASGGSDFDPKGKSDNEIMRFCQSFMNEMYRYMGPDKDLPSEEVGVGTRE 360
Query: 360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
MGYLFGQYRRLAG FQGSFTGPRI+W+ SSLRTEA+GYG+V+FA+LILADMNKE+KGLRC
Sbjct: 361 MGYLFGQYRRLAGQFQGSFTGPRIYWAASSLRTEASGYGVVYFARLILADMNKEIKGLRC 420
Query: 420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
VVSG GKIAMHV+EKLIA GA PV+VSD+KGYLVD+DGFDYMK++FLRDIKSQQRSLRDY
Sbjct: 421 VVSGCGKIAMHVVEKLIACGAHPVTVSDSKGYLVDDDGFDYMKLAFLRDIKSQQRSLRDY 480
Query: 480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
SKTYAR+KY+DE KPWNERCDVAFPCASQNE+DQ+DAINLVN+GCR+LVEGSNMPCT EA
Sbjct: 481 SKTYARAKYFDELKPWNERCDVAFPCASQNEVDQADAINLVNAGCRLLVEGSNMPCTAEA 540
Query: 540 VDVLKKANVLIAPAMXXXXXXXXXXELELNQECNMVHWSPEDFESKLQ 587
VDV +KANVLIAPA+ E+E+ +E N + WS EDFES+LQ
Sbjct: 541 VDVFRKANVLIAPAIAAGAGGVAAGEIEVLRESNSMQWSAEDFESRLQ 588
|
|
| GENEDB_PFALCIPARUM|PF14_0286 PF14_0286 "glutamate dehydrogenase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8ILF7 PF14_0286 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF14_0164 PF14_0164 "NADP-specific glutamate dehydrogenase" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8ILT0 PF14_0164 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8RQP4 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium efficiens YS-314 (taxid:196164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31026 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium glutamicum ATCC 13032 (taxid:196627)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P95544 gdhA "NAD(P)-specific glutamate dehydrogenase" [Prevotella ruminicola (taxid:839)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1305 GSU_1305 "Glu/Leu/Phe/Val dehydrogenase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15111 gdhA "NADP-specific glutamate dehydrogenase" [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 (taxid:99287)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.4.1 | 0.766 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 588 | |||
| PRK09414 | 445 | PRK09414, PRK09414, glutamate dehydrogenase; Provi | 0.0 | |
| PTZ00079 | 454 | PTZ00079, PTZ00079, NADP-specific glutamate dehydr | 0.0 | |
| PRK14030 | 445 | PRK14030, PRK14030, glutamate dehydrogenase; Provi | 1e-144 | |
| PRK14031 | 444 | PRK14031, PRK14031, glutamate dehydrogenase; Provi | 1e-143 | |
| COG0334 | 411 | COG0334, GdhA, Glutamate dehydrogenase/leucine deh | 1e-126 | |
| cd05313 | 254 | cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain | 1e-110 | |
| pfam02812 | 131 | pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr | 2e-61 | |
| pfam00208 | 237 | pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl | 4e-58 | |
| PLN02477 | 410 | PLN02477, PLN02477, glutamate dehydrogenase | 2e-51 | |
| cd01076 | 227 | cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain | 4e-31 | |
| smart00839 | 102 | smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny | 3e-23 | |
| cd05211 | 217 | cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding | 1e-22 | |
| cd01075 | 200 | cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d | 7e-05 |
| >gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Score = 578 bits (1493), Expect = 0.0
Identities = 205/396 (51%), Positives = 284/396 (71%), Gaps = 7/396 (1%)
Query: 195 SIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWV 252
S++E KR+P + EF Q+V+E L +L V+ KN Y I+ERL+EPER+I+FRVPWV
Sbjct: 9 SVLEQVKKRNPGQPEFHQAVREVLESLWPVLEKNPEYAEAGILERLVEPERVIIFRVPWV 68
Query: 253 DDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAA 312
DD+G+ VNRGFRVQF+ A+GP +GGLRFHPS+NLSI KFLGFEQ KNAL+ +GG
Sbjct: 69 DDKGQVQVNRGFRVQFNSAIGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLPIGGGK 128
Query: 313 GGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAG 372
GGSDFDPKGKSD EIMRFCQSFM E++R++GPD D+P+ ++GVG RE+GYLFGQY+RL
Sbjct: 129 GGSDFDPKGKSDAEIMRFCQSFMTELYRHIGPDTDVPAGDIGVGGREIGYLFGQYKRLTN 188
Query: 373 HFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVL 432
F+G TG + + GS +RTEATGYGLV+FA+ +L +G R VVSGSG +A++ +
Sbjct: 189 RFEGVLTGKGLSFGGSLIRTEATGYGLVYFAEEMLKARGDSFEGKRVVVSGSGNVAIYAI 248
Query: 433 EKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDE 491
EK GA V+ SD+ GY+ DE+G D K L++IK +R + +Y++ + ++Y +
Sbjct: 249 EKAQQLGAKVVTCSDSSGYVYDEEGIDLEK---LKEIKEVRRGRISEYAEEFG-AEYLEG 304
Query: 492 AKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIA 551
PW+ CD+A PCA+QNE+D+ DA L+ +G + + EG+NMP TPEA++V +A VL A
Sbjct: 305 GSPWSVPCDIALPCATQNELDEEDAKTLIANGVKAVAEGANMPSTPEAIEVFLEAGVLFA 364
Query: 552 PAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQ 587
P AA AGGV LE++Q + + W+ E+ +++L
Sbjct: 365 PGKAANAGGVATSGLEMSQNASRLSWTFEEVDARLH 400
|
Length = 445 |
| >gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 588 | |||
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 100.0 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 100.0 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 100.0 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 100.0 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 100.0 | |
| PLN02477 | 410 | glutamate dehydrogenase | 100.0 | |
| KOG2250 | 514 | consensus Glutamate/leucine/phenylalanine/valine d | 100.0 | |
| PTZ00324 | 1002 | glutamate dehydrogenase 2; Provisional | 100.0 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 100.0 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 100.0 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 100.0 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 100.0 | |
| PF02812 | 131 | ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di | 100.0 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 100.0 | |
| smart00839 | 102 | ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali | 99.93 | |
| COG2902 | 1592 | NAD-specific glutamate dehydrogenase [Amino acid t | 99.89 | |
| PF05088 | 1528 | Bac_GDH: Bacterial NAD-glutamate dehydrogenase | 99.81 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 99.16 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 99.06 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 98.64 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 98.58 | |
| PRK06813 | 346 | homoserine dehydrogenase; Validated | 98.2 | |
| PLN02700 | 377 | homoserine dehydrogenase family protein | 98.08 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 97.77 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 97.72 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 97.66 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 97.66 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 97.54 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 97.41 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 97.37 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 97.28 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 97.26 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 97.24 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 97.1 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 97.06 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 97.05 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 97.05 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 96.98 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 96.97 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.97 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 96.9 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 96.86 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 96.76 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 96.73 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 96.72 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 96.7 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 96.7 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 96.67 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.61 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 96.58 | |
| COG0057 | 335 | GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt | 96.53 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 96.51 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 96.49 | |
| PF03447 | 117 | NAD_binding_3: Homoserine dehydrogenase, NAD bindi | 96.45 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 96.45 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 96.44 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 96.41 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 96.41 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 96.4 | |
| smart00597 | 90 | ZnF_TTF zinc finger in transposases and transcript | 96.4 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 96.38 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 96.36 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 96.36 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 96.32 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 96.27 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.24 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 96.21 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 96.15 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 96.12 | |
| PLN02494 | 477 | adenosylhomocysteinase | 96.1 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 96.07 | |
| PLN02928 | 347 | oxidoreductase family protein | 96.06 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 96.0 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 95.96 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 95.95 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 95.95 | |
| PRK15425 | 331 | gapA glyceraldehyde-3-phosphate dehydrogenase A; P | 95.94 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 95.89 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 95.88 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 95.86 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.85 | |
| PRK07403 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 95.81 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 95.8 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 95.76 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 95.74 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 95.68 | |
| PRK08955 | 334 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 95.64 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 95.63 | |
| TIGR01534 | 327 | GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, | 95.62 | |
| PTZ00023 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 95.6 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 95.58 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 95.52 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 95.5 | |
| PRK07729 | 343 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 95.46 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.42 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.41 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.4 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 95.33 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.29 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.25 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 95.13 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 95.13 | |
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 95.09 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 95.08 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 95.02 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 94.97 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 94.96 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 94.91 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 94.91 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.9 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 94.84 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 94.83 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 94.8 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 94.77 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 94.77 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.74 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 94.7 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 94.67 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 94.67 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 94.66 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 94.63 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 94.6 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.58 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 94.57 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.5 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.49 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 94.47 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 94.47 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 94.44 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 94.42 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.41 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.39 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 94.33 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 94.33 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 94.24 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 94.23 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.22 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.22 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 94.2 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.2 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 94.2 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 94.18 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.18 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.12 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 94.06 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 93.98 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 93.97 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 93.94 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.93 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 93.92 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 93.91 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 93.81 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 93.72 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 93.68 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 93.65 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 93.63 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 93.61 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.6 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 93.6 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 93.58 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.53 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 93.52 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.49 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 93.39 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 93.37 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 93.37 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 93.35 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 93.32 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 93.3 | |
| PRK08223 | 287 | hypothetical protein; Validated | 93.29 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.27 | |
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 93.27 | |
| COG1023 | 300 | Gnd Predicted 6-phosphogluconate dehydrogenase [Ca | 93.22 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 93.21 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 93.14 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 93.13 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 93.13 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 92.98 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 92.94 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 92.88 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 92.84 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 92.84 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.79 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 92.75 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 92.71 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 92.66 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 92.63 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 92.59 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.55 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 92.48 | |
| KOG0068 | 406 | consensus D-3-phosphoglycerate dehydrogenase, D-is | 92.41 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.3 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 92.29 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.24 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 92.23 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 92.22 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 92.2 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 92.16 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 92.07 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 92.07 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 92.03 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 92.03 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 92.0 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 91.98 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 91.92 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 91.85 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 91.81 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 91.72 | |
| PTZ00353 | 342 | glycosomal glyceraldehyde-3-phosphate dehydrogenas | 91.67 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 91.29 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 91.25 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 91.2 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 91.17 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 91.06 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 90.96 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 90.93 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 90.6 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 90.53 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 90.45 | |
| KOG1257 | 582 | consensus NADP+-dependent malic enzyme [Energy pro | 90.43 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 90.36 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 90.32 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 90.26 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 90.26 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 90.23 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 90.04 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 89.63 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 89.61 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 89.52 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 89.31 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 89.18 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 89.12 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 89.1 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 89.04 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 88.97 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 88.95 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 88.84 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 88.73 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.64 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 88.61 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 88.59 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.49 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 88.44 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 88.43 | |
| KOG2380 | 480 | consensus Prephenate dehydrogenase (NADP+) [Amino | 88.16 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 88.14 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 88.12 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 88.1 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 88.02 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 87.8 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 87.74 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.52 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 87.52 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 87.49 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.36 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 87.18 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.13 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 87.11 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.06 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.67 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 86.67 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 86.67 | |
| KOG1196 | 343 | consensus Predicted NAD-dependent oxidoreductase [ | 86.66 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.62 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.51 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 86.47 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 86.39 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 86.18 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 86.13 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 86.12 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 86.1 | |
| PLN02712 | 667 | arogenate dehydrogenase | 86.07 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 86.06 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.86 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 85.86 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 85.75 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 85.69 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 85.62 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 85.54 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 85.51 | |
| PRK05717 | 255 | oxidoreductase; Validated | 85.38 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 85.26 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 85.13 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 85.07 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.03 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 84.75 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 84.64 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 84.64 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 84.55 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 84.52 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 84.51 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 84.29 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 84.25 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 84.14 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.12 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 84.06 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 84.02 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 83.92 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 83.69 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 83.6 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 83.45 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 83.28 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 83.16 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 83.09 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 83.08 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 83.03 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 82.99 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.97 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.96 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 82.91 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.73 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 82.64 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 82.63 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.6 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.56 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 82.53 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 82.47 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 82.46 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.42 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.35 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 82.33 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 82.32 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 82.29 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 82.25 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 81.99 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 81.88 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 81.81 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 81.77 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 81.76 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 81.75 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 81.71 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.7 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 81.65 | |
| CHL00073 | 457 | chlN photochlorophyllide reductase subunit N | 81.54 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 81.53 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 81.39 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 81.39 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 81.22 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 81.19 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 81.08 | |
| COG0677 | 436 | WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas | 80.92 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 80.9 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 80.85 | |
| PLN02256 | 304 | arogenate dehydrogenase | 80.77 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 80.63 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 80.62 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 80.56 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 80.48 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 80.33 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 80.18 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 80.15 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 80.05 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 80.03 |
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.4e-130 Score=1046.69 Aligned_cols=399 Identities=50% Similarity=0.947 Sum_probs=389.8
Q ss_pred hhhHHHHHHHHHhhCCCCccHHHHHHHHHHHHHHHHHhCccchHHHHhhcCCCeEEEEEEeEEcCCCCeEEEEEEEEEec
Q 007820 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFS 269 (588)
Q Consensus 190 ~~~~~~~~~~~~~~~p~~~ef~q~v~e~~~~~~~~~~~~p~y~~~~e~L~~Per~i~frvp~~dd~G~v~v~rGyRVqhs 269 (588)
...++.+++.+.+|+|+|+||+|+|+|+++++.|+|+++|+|..++++|++|+|+|+|+|||+||+|++++|+|||||||
T Consensus 11 ~~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~~~~~~~~~~~y~~i~e~l~~Per~i~~~vp~~~D~G~v~v~~GyRVqhn 90 (454)
T PTZ00079 11 AQEMDALRKRVKSRDPNQPEFLQAFHEVMTSLKPLFQKNPKYLGVLERLVEPERVIQFRVPWVDDKGEQRVNRGFRVQYN 90 (454)
T ss_pred HHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHhChhHHHHHHHhccCceEEEEEEEEEECCCCEEEEeeEEEEEc
Confidence 45578999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCeeeecCCCHHHHHHHhHhhhhhhcccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHHhhcCCCCccC
Q 007820 270 QALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLP 349 (588)
Q Consensus 270 ~alGPakGGlRfhp~vt~~evkaLA~~MT~KnAL~gLP~GGaKGGI~~DP~~~S~~El~R~~r~f~~eL~r~IGp~~DVp 349 (588)
+++|||||||||||+||++++++||++|||||||++||||||||||+|||+++|+.|||||||+||++|.+||||++|||
T Consensus 91 ~alGP~kGGlRfhp~v~~~~vk~La~~mt~KnAl~gLP~GGgKGGi~~dPk~~s~~El~r~~r~f~~eL~~~IGp~~Dvp 170 (454)
T PTZ00079 91 SALGPYKGGLRFHPSVNLSILKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELYRHIGPDTDVP 170 (454)
T ss_pred CCCCCCCCCEEeeCCCCHHHHHHHHHHHHHHHHhcCCCCCCcceeeecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCChhHHHHHHHHHhhHhCCCCccccCCcccccCCCCCCCccHHHHHHHHHHHHHHhCCCCCCcEEEEeccchHHH
Q 007820 350 SEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM 429 (588)
Q Consensus 350 ApDiGt~~reM~~i~~~y~~l~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~i~~~l~~~g~~l~GkrVaIQGfGNVG~ 429 (588)
||||||+++||+||+++|+++++++.|++||||+.+|||.+|++||||||+|++++++++++.+++|+||+||||||||+
T Consensus 171 A~DvGt~~rem~~~~~~y~~~~~~~~gv~TGK~~~~GGs~~r~eATG~Gv~~~~~~~l~~~~~~l~Gk~VaVqG~GnVg~ 250 (454)
T PTZ00079 171 AGDIGVGGREIGYLFGQYKKLRNNFEGTLTGKNVKWGGSNIRPEATGYGLVYFVLEVLKKLNDSLEGKTVVVSGSGNVAQ 250 (454)
T ss_pred hhhcCCCHHHHHHHHHHHHHHhCCCCceeCCCCCCCCCCCCCCcccHHHHHHHHHHHHHHcCCCcCCCEEEEECCCHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHCCCeEEEEEcCCCeeeCCCCCCHHHHHHHHHHhhcc-CChhhhhhccCCceEeCCCCccccccceeecCCCc
Q 007820 430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQ 508 (588)
Q Consensus 430 ~aAe~L~e~GAKVVaVSDs~G~IydpdGLDie~L~~L~~~k~~~-gsL~~y~~~~p~a~~i~~~eil~~dcDILIPcA~~ 508 (588)
++|++|.+.|+|||+|||++|+||||+|||+++|..|+++|+.+ +++.+|...++++++++++++|+++||||+|||++
T Consensus 251 ~aa~~L~e~GakVVavSD~~G~iy~~~Gld~~~l~~l~~~k~~~~g~i~~~~~~~~~a~~~~~~~~~~~~cDI~iPcA~~ 330 (454)
T PTZ00079 251 YAVEKLLQLGAKVLTMSDSDGYIHEPNGFTKEKLAYLMDLKNVKRGRLKEYAKHSSTAKYVPGKKPWEVPCDIAFPCATQ 330 (454)
T ss_pred HHHHHHHHCCCEEEEEEcCCCcEECCCCCCHHHHHHHHHHHhhcCCcHHhhhhccCCcEEeCCcCcccCCccEEEecccc
Confidence 99999999999999999999999999999999998889998765 78999876677899999999999999999999999
Q ss_pred CccchhhHHhhhhcCCeEEEecCCCCCCHHHHHHHHHCCceEeccccccccCceeeecccccccccCCCCHHHHHhhhcC
Q 007820 509 NEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQV 588 (588)
Q Consensus 509 n~It~enA~~l~~~~akiVvEgAN~P~T~eA~~iL~~rGI~viPD~laNAGGVivS~~E~~qN~~~~~ws~eeV~~~L~~ 588 (588)
|+||.++|++|++++||+|+||||||+|++|+++|++|||+|+||+++|||||++|||||+||+++++|++|||++||++
T Consensus 331 n~I~~~~a~~l~~~~ak~V~EgAN~p~t~eA~~~L~~~GI~~~PD~~aNAGGV~vS~~E~~Qn~~~~~W~~eeV~~~L~~ 410 (454)
T PTZ00079 331 NEINLEDAKLLIKNGCKLVAEGANMPTTIEATHLFKKNGVIFCPGKAANAGGVAISGLEMSQNAARLQWTAEEVDEKLRE 410 (454)
T ss_pred ccCCHHHHHHHHHcCCeEEEecCCCCCCHHHHHHHHHCCcEEEChhhhcCCCeeeehHHhhhhhcccCCCHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999973
|
|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00324 glutamate dehydrogenase 2; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase | Back alignment and domain information |
|---|
| >COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06813 homoserine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02700 homoserine dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >smart00597 ZnF_TTF zinc finger in transposases and transcription factors | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >CHL00073 chlN photochlorophyllide reductase subunit N | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 588 | ||||
| 3r3j_A | 456 | Kinetic And Structural Characterization Of Plasmodi | 1e-118 | ||
| 2bma_A | 470 | The Crystal Structure Of Plasmodium Falciparum Glut | 1e-104 | ||
| 2yfh_A | 448 | Structure Of A Chimeric Glutamate Dehydrogenase Len | 1e-102 | ||
| 4fcc_A | 450 | Glutamate Dehydrogenase From E. Coli Length = 450 | 1e-101 | ||
| 2yfg_E | 447 | Structural Determinants Of Cofactor Specificity And | 1e-101 | ||
| 3sbo_A | 447 | Structure Of E.Coli Gdh From Native Source Length = | 1e-101 | ||
| 1hrd_A | 449 | Glutamate Dehydrogenase Length = 449 | 9e-93 | ||
| 1k89_A | 449 | K89l Mutant Of Glutamate Dehydrogenase Length = 449 | 2e-92 | ||
| 1aup_A | 449 | Glutamate Dehydrogenase Length = 449 | 3e-92 | ||
| 3aog_A | 440 | Crystal Structure Of Glutamate Dehydrogenase (Gdhb) | 4e-37 | ||
| 3aoe_A | 424 | Crystal Structure Of Hetero-Hexameric Glutamate Deh | 4e-37 | ||
| 3k92_A | 424 | Crystal Structure Of A E93k Mutant Of The Majour Ba | 7e-37 | ||
| 1b3b_A | 415 | Thermotoga Maritima Glutamate Dehydrogenase Mutant | 4e-35 | ||
| 1b26_A | 416 | Glutamate Dehydrogenase Length = 416 | 4e-35 | ||
| 1euz_A | 419 | Glutamate Dehydrogenase From Thermococcus Profundus | 9e-35 | ||
| 3k8z_A | 423 | Crystal Structure Of Gudb1 A Decryptified Secondary | 4e-34 | ||
| 1bvu_A | 418 | Glutamate Dehydrogenase From Thermococcus Litoralis | 8e-33 | ||
| 1l1f_A | 505 | Structure Of Human Glutamate Dehydrogenase-Apo Form | 1e-32 | ||
| 3mw9_A | 501 | Bovine Glutamate Dehydrogenase Complexed With Nadh, | 1e-32 | ||
| 1nr1_A | 496 | Crystal Structure Of The R463a Mutant Of Human Glut | 1e-32 | ||
| 3etd_A | 501 | Structure Of Glutamate Dehydrogenase Complexed With | 3e-32 | ||
| 1nqt_A | 496 | Crystal Structure Of Bovine Glutamate Dehydrogenase | 4e-32 | ||
| 2tmg_A | 415 | Thermotoga Maritima Glutamate Dehydrogenase Mutant | 4e-32 | ||
| 1gtm_A | 419 | Structure Of Glutamate Dehydrogenase Length = 419 | 1e-31 | ||
| 1v9l_A | 421 | L-Glutamate Dehydrogenase From Pyrobaculum Islandic | 1e-30 | ||
| 3aoe_E | 419 | Crystal Structure Of Hetero-Hexameric Glutamate Deh | 1e-30 | ||
| 1hwy_A | 501 | Bovine Glutamate Dehydrogenase Complexed With Nad A | 6e-30 | ||
| 2yfq_A | 421 | Crystal Structure Of Glutamate Dehydrogenase From P | 6e-27 |
| >pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 | Back alignment and structure |
|
| >pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 | Back alignment and structure |
| >pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 | Back alignment and structure |
| >pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 | Back alignment and structure |
| >pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 | Back alignment and structure |
| >pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 | Back alignment and structure |
| >pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 | Back alignment and structure |
| >pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 | Back alignment and structure |
| >pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 | Back alignment and structure |
| >pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 | Back alignment and structure |
| >pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 | Back alignment and structure |
| >pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 | Back alignment and structure |
| >pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 | Back alignment and structure |
| >pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 | Back alignment and structure |
| >pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 | Back alignment and structure |
| >pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 | Back alignment and structure |
| >pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 | Back alignment and structure |
| >pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 | Back alignment and structure |
| >pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 | Back alignment and structure |
| >pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 | Back alignment and structure |
| >pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 | Back alignment and structure |
| >pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 | Back alignment and structure |
| >pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 | Back alignment and structure |
| >pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 | Back alignment and structure |
| >pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 | Back alignment and structure |
| >pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 | Back alignment and structure |
| >pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 | Back alignment and structure |
| >pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 | Back alignment and structure |
|---|
Score = 642 bits (1659), Expect = 0.0
Identities = 190/400 (47%), Positives = 292/400 (73%), Gaps = 1/400 (0%)
Query: 189 MSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFR 248
+ + E + ++ +E EF+Q+ +E L L+ V K++ Y+ ++E + EPER+I FR
Sbjct: 12 VDNQIEELREKVVSKNKNEPEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFR 71
Query: 249 VPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKL 308
VPW++D+GE +NRGFRVQ++ LGP +GGLRFHP++NLS+ KFLGFEQ KN+L+ +
Sbjct: 72 VPWINDKGEHKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPM 131
Query: 309 GGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYR 368
GG GGSDFDPKGKS+NEI++FCQSFM + RY+GP+ D+P+ ++GVG RE+GYLFGQY+
Sbjct: 132 GGGKGGSDFDPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYK 191
Query: 369 RLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIA 428
+L F+G TG I W GS++R EATGYG+V+FA+ +L D+N L+ +C+VSGSG +A
Sbjct: 192 KLKNSFEGVLTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVA 251
Query: 429 MHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSK 487
+++EKLI GAI +++SD+ GY+++ +GF +++++ DIK+ QR L++Y K +K
Sbjct: 252 QYLVEKLIEKGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRLKEYLKYSKTAK 311
Query: 488 YYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKAN 547
Y++ KPWN CD+AFPCA+QNEI+++DA + + C+++VEG+NMP +A+ LK+ N
Sbjct: 312 YFENQKPWNIPCDIAFPCATQNEINENDADLFIQNKCKMIVEGANMPTHIKALHKLKQNN 371
Query: 548 VLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKLQ 587
+++ P+ AA AGGV LE++Q + W+ ++ + KLQ
Sbjct: 372 IILCPSKAANAGGVAVSGLEMSQNSMRLQWTHQETDMKLQ 411
|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 | Back alignment and structure |
|---|
| >2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 588 | |||
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 100.0 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 100.0 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 100.0 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 100.0 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 100.0 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 100.0 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 100.0 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 100.0 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 100.0 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 100.0 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 100.0 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 100.0 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 100.0 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 100.0 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 97.82 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 97.75 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 97.52 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 97.5 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 97.43 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 97.42 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 97.31 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 97.16 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 97.09 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 97.02 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 97.01 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 96.96 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 96.95 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 96.88 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 96.87 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 96.87 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 96.85 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 96.84 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 96.83 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 96.8 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 96.8 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 96.78 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 96.76 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 96.73 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 96.7 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 96.69 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 96.68 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 96.68 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 96.65 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 96.63 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 96.62 | |
| 3c8m_A | 331 | Homoserine dehydrogenase; structural genomics, APC | 96.61 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.61 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 96.59 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 96.55 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 96.54 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 96.51 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 96.51 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 96.51 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 96.43 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 96.42 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 96.41 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 96.4 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 96.39 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 96.38 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 96.37 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 96.36 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 96.34 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 96.3 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 96.3 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 96.29 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 96.28 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 96.28 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 96.27 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 96.26 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 96.26 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 96.24 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 96.21 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 96.19 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 96.17 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 96.17 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 96.16 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 96.16 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 96.14 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 96.14 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 96.13 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 96.13 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 96.12 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 96.1 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 96.1 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.09 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.09 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 96.08 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 96.08 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 96.06 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.05 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 96.05 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 96.03 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 96.03 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.03 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 96.02 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 96.02 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 96.02 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 96.02 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 96.01 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 96.0 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.0 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 95.99 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.99 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 95.98 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 95.98 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 95.98 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.97 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 95.97 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 95.95 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 95.93 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.93 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 95.92 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 95.91 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 95.91 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 95.89 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 95.89 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 95.87 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 95.87 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 95.87 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 95.86 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 95.86 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 95.86 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 95.82 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 95.82 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 95.82 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 95.81 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 95.8 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 95.8 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 95.78 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 95.77 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 95.75 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 95.74 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 95.74 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 95.73 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 95.73 | |
| 1ebf_A | 358 | Homoserine dehydrogenase; dinucleotide, NAD, dimer | 95.72 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 95.71 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 95.7 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 95.69 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 95.69 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 95.68 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 95.68 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 95.65 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 95.64 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 95.6 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 95.59 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 95.55 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 95.54 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 95.48 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 95.48 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 95.46 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 95.46 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 95.46 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 95.45 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 95.41 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 95.37 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 95.37 | |
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 95.33 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 95.31 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 95.29 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 95.29 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 95.26 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 95.22 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 95.21 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 95.21 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 95.2 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 95.19 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 95.18 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 95.18 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 95.18 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 95.1 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 95.08 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 95.06 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 95.06 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 95.05 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 95.01 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 95.01 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 95.01 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 94.97 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.95 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 94.93 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 94.89 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 94.87 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 94.85 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 94.84 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 94.84 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 94.83 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 94.8 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 94.76 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 94.75 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 94.7 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 94.7 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 94.69 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 94.69 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 94.67 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 94.67 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 94.67 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 94.66 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 94.61 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 94.55 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 94.55 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.5 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 94.48 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 94.44 | |
| 3v1y_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 94.44 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 94.4 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 94.34 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 94.3 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 94.3 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 94.28 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 94.25 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 94.22 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 94.17 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.14 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 94.13 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 94.13 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 94.12 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 94.11 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 94.08 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 93.99 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 93.93 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.76 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 93.7 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 93.66 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 93.63 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 93.47 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.39 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.36 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 93.31 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 93.29 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 93.15 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 93.14 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 93.1 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 93.05 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 92.9 | |
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 92.87 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 92.86 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 92.78 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 92.75 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 92.68 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 92.67 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 92.66 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 92.66 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 92.44 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 92.44 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 92.37 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 92.28 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 92.15 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 92.12 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 91.98 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 91.94 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 91.89 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 91.72 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 91.52 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 91.42 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 91.41 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 91.39 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 91.3 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 91.29 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 91.23 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 91.1 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 91.06 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 90.85 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 90.82 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 90.77 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 90.57 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 90.44 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 90.3 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 90.16 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 90.03 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 89.95 | |
| 2yv1_A | 294 | Succinyl-COA ligase [ADP-forming] subunit alpha; C | 89.94 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 89.85 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 89.81 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 89.71 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 89.47 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 89.44 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 89.16 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 89.12 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 89.09 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 89.05 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 89.05 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 89.04 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 88.96 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 88.92 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 88.86 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 88.86 | |
| 1r0k_A | 388 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 88.85 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 88.74 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 88.72 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 88.6 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 88.54 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 88.53 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 88.46 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 88.31 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 88.28 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 88.09 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 88.06 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 87.97 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 87.96 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 87.89 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 87.71 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 87.54 | |
| 2yv3_A | 331 | Aspartate-semialdehyde dehydrogenase; aspartate pa | 87.54 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 87.34 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 87.29 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 87.28 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 87.14 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 86.84 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 86.73 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 86.72 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 86.72 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 86.67 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 86.46 | |
| 2fp4_A | 305 | Succinyl-COA ligase [GDP-forming] alpha-chain, mit | 86.44 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 86.36 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 86.35 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 86.33 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 86.29 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 86.25 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 86.17 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 86.15 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 86.02 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 85.91 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 85.76 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 85.73 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 85.69 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 85.59 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 85.44 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 85.36 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 85.33 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 85.28 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 85.24 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 85.23 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 85.23 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 85.13 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 84.93 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 84.89 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 84.84 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 84.81 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 84.79 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 84.78 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 84.72 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 84.65 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 84.63 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 84.6 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 84.6 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 84.57 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 84.56 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 84.49 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 84.4 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 84.39 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 84.29 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 84.26 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 84.19 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 84.19 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 84.18 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 84.07 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 84.01 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 83.94 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 83.89 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 83.8 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 83.74 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 83.67 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 83.59 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 83.49 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 83.47 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 83.45 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 83.44 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 83.37 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 83.37 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 83.32 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 83.32 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 83.29 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 83.29 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 83.25 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 83.22 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 83.2 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 83.17 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 83.12 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 83.11 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 83.05 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 82.96 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 82.96 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 82.95 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 82.94 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 82.86 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 82.84 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 82.82 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 82.72 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 82.65 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 82.64 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 82.64 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 82.61 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 82.59 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 82.59 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 82.57 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 82.49 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 82.47 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 82.42 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 82.42 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 82.4 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 82.39 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 82.36 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 82.29 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 82.27 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 82.26 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 82.25 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 82.23 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 82.21 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 82.17 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 82.17 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 82.14 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 82.13 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 82.12 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 82.1 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 82.04 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 82.02 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 82.02 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 82.0 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 81.99 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 81.98 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 81.98 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 81.96 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 81.92 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 81.9 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 81.85 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 81.83 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 81.82 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 81.82 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 81.81 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 81.73 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 81.68 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 81.68 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 81.67 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 81.66 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 81.6 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 81.6 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 81.57 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 81.55 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 81.54 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 81.54 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 81.53 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 81.51 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 81.5 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 81.5 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 81.48 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 81.47 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 81.43 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 81.42 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 81.4 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 81.38 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 81.38 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 81.37 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 81.29 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 81.28 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 81.28 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 81.28 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 81.25 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 81.24 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 81.22 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 81.2 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 81.2 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 81.14 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 81.09 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 81.08 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 81.07 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 81.06 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 81.05 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 81.04 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 81.02 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 81.0 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 80.99 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 80.94 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 80.89 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 80.85 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 80.85 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 80.81 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 80.81 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 80.78 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 80.75 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 80.71 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 80.69 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 80.69 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 80.64 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 80.62 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 80.6 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 80.6 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 80.45 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 80.43 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 80.43 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 80.4 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 80.39 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 80.35 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 80.34 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 80.31 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 80.28 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 80.25 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 80.19 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 80.18 |
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-128 Score=1035.72 Aligned_cols=397 Identities=46% Similarity=0.830 Sum_probs=385.1
Q ss_pred hhhHHHHHHHHHhhCCCCccHHHHHHHHHHHHHHHHHhCccch--HHHHhhcCCCeEEEEEEeEEcCCCCeEEEEEEEEE
Q 007820 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQ 267 (588)
Q Consensus 190 ~~~~~~~~~~~~~~~p~~~ef~q~v~e~~~~~~~~~~~~p~y~--~~~e~L~~Per~i~frvp~~dd~G~v~v~rGyRVq 267 (588)
..+++.+++.+++|+|+|+||+|||+|+++++.|+|++||+|. .++|+|++|+|+|+|||||+||+|++++|+|||||
T Consensus 7 ~~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~l~~~~~~~p~y~~~~~~e~l~~PeR~i~~~vp~~~D~G~~~v~~GyRvq 86 (450)
T 4fcc_A 7 TYSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVVWVDDRNQVQVNRAWRVQ 86 (450)
T ss_dssp --CHHHHHHHHHTTCTTCHHHHHHHHHHHHHHHHHHHHCGGGTSTTHHHHHTSCSEEEEEEEEEECTTSCEEEEEEEEEE
T ss_pred hhhHHHHHHHHHhhCcCChHHHHHHHHHHHHHHHHHHhChhhhhhhHHHHHhCCceEEEEEEEEEECCCcEEEEEEEEEE
Confidence 4468999999999999999999999999999999999999998 59999999999999999999999999999999999
Q ss_pred ecCCCCCCCCCeeeecCCCHHHHHHHhHhhhhhhcccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHHhhcCCCCc
Q 007820 268 FSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKD 347 (588)
Q Consensus 268 hs~alGPakGGlRfhp~vt~~evkaLA~~MT~KnAL~gLP~GGaKGGI~~DP~~~S~~El~R~~r~f~~eL~r~IGp~~D 347 (588)
||+++|||||||||||++|++|+++||++|||||||++||||||||||++||+++|+.|+|||||+|+++|.+||||++|
T Consensus 87 hn~alGP~kGG~Rfhp~v~l~ev~~La~~mT~KnAl~gLP~GGgKggi~~DPk~~s~~El~R~~~~f~~eL~~~iG~d~d 166 (450)
T 4fcc_A 87 FSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTD 166 (450)
T ss_dssp EECSSSSEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTSSCCEEEEEESCCCTTCCHHHHHHHHHHHHHHHGGGCBTTTE
T ss_pred ECCCCCCCCCceEecCCCCHHHHHHHHHHHHHHHHHcCCCCCCCceEEecCCCcCCHHHHHHHHHHHHHHhhheecCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCChhHHHHHHHHHhhHhCCCCccccCCcccccCCCCCCCccHHHHHHHHHHHHHHhCCCCCCcEEEEeccchH
Q 007820 348 LPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKI 427 (588)
Q Consensus 348 VpApDiGt~~reM~~i~~~y~~l~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~i~~~l~~~g~~l~GkrVaIQGfGNV 427 (588)
||||||||+++||+||+++|+++.+...+++||||+.+|||.+|++||||||+|++++++++++.+++|+||+|||||||
T Consensus 167 vpa~Dig~~~~em~~~~~~y~~~~~~~~~v~TGk~~~~GGs~~r~~aTg~Gv~~~~~~~~~~~~~~l~Gk~vaVQG~GnV 246 (450)
T 4fcc_A 167 VPAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNV 246 (450)
T ss_dssp EEECBTTBCHHHHHHHHHHHHHHHTCCSCCCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEEECCSHH
T ss_pred CCccceeecchhhhhhhhhhhhccCCCceeecCCCcccCCCCCCCCceeeeHHHHHHHHHHHcCCCcCCCEEEEeCCChH
Confidence 99999999999999999999999999899999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHCCCeEEEEEcCCCeeeCCCCCCHHHHHHHHHHhhc-cCChhhhhhccCCceEeCCCCccccccceeecCC
Q 007820 428 AMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQ-QRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCA 506 (588)
Q Consensus 428 G~~aAe~L~e~GAKVVaVSDs~G~IydpdGLDie~L~~L~~~k~~-~gsL~~y~~~~p~a~~i~~~eil~~dcDILIPcA 506 (588)
|+++|++|++.|+|||+|||++|+||||+|||+++|..+++.+.. ++++.+|.+.+ ++++++++++|+++||||+|||
T Consensus 247 G~~aa~~L~e~GakvVavsD~~G~i~d~~Gid~e~l~~l~e~k~~~~g~v~~~~~~~-g~~~~~~~~i~~~~~DI~iPcA 325 (450)
T 4fcc_A 247 AQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKSSRDGRVADYAKEF-GLVYLEGQQPWSVPVDIALPCA 325 (450)
T ss_dssp HHHHHHHHHHTTCEEEEEEETTEEEECTTCCCHHHHHHHHHHHTSTTCCHHHHHHHH-TCEEEETCCGGGSCCSEEEECS
T ss_pred HHHHHHHHHhcCCeEEEEecCCceEEeCCCCCHHHHHHHHHHhcccCCccccccccC-CcEEecCcccccCCccEEeecc
Confidence 999999999999999999999999999999999999888887765 46788886655 7889999999999999999999
Q ss_pred CcCccchhhHHhhhhcCCeEEEecCCCCCCHHHHHHHHHCCceEeccccccccCceeeecccccccccCCCCHHHHHhhh
Q 007820 507 SQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVVAGELELNQECNMVHWSPEDFESKL 586 (588)
Q Consensus 507 ~~n~It~enA~~l~~~~akiVvEgAN~P~T~eA~~iL~~rGI~viPD~laNAGGVivS~~E~~qN~~~~~ws~eeV~~~L 586 (588)
++|+||.++|++|.+++||+|+||||+|+||||+++|++|||+|+||+++||||||+|||||+||+++++|++|||++||
T Consensus 326 l~~~I~~~~a~~L~a~g~k~IaEgAN~p~t~eA~~iL~~rGIl~~PD~~aNAGGVi~S~~E~~qn~~~~~w~~eeV~~kL 405 (450)
T 4fcc_A 326 TQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARL 405 (450)
T ss_dssp CTTCBCHHHHHHHHHTTCCEEECCSSSCBCHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHHHHTCCCCHHHHHHHH
T ss_pred ccccccHHHHHHHHhcCceEEecCCCCCCCHHHHHHHHHCCCEEEChHHhcCccHhhhHHHHhhhcccCCCCHHHHHHHH
Confidence 99999999999999899999999999999999999999999999999999999999999999999999999999999998
Q ss_pred c
Q 007820 587 Q 587 (588)
Q Consensus 587 ~ 587 (588)
+
T Consensus 406 ~ 406 (450)
T 4fcc_A 406 H 406 (450)
T ss_dssp H
T ss_pred H
Confidence 6
|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 588 | ||||
| d1bgva2 | 194 | c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr | 3e-67 | |
| d1hwxa2 | 208 | c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B | 4e-56 | |
| d1b26a2 | 175 | c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo | 1e-53 | |
| d1v9la2 | 176 | c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba | 5e-53 | |
| d1gtma2 | 178 | c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae | 1e-52 | |
| d1bgva1 | 255 | c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost | 2e-43 | |
| d1hwxa1 | 293 | c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( | 1e-39 | |
| d1b26a1 | 234 | c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm | 1e-37 | |
| d1v9la1 | 242 | c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob | 1e-35 | |
| d1gtma1 | 239 | c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa | 4e-33 | |
| d1leha2 | 134 | c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus | 3e-25 | |
| d1c1da2 | 148 | c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh | 7e-24 | |
| d1leha1 | 230 | c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu | 5e-21 | |
| d1c1da1 | 201 | c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R | 4e-14 |
| >d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Aminoacid dehydrogenase-like, N-terminal domain superfamily: Aminoacid dehydrogenase-like, N-terminal domain family: Aminoacid dehydrogenases domain: Glutamate dehydrogenase species: Clostridium symbiosum [TaxId: 1512]
Score = 214 bits (547), Expect = 3e-67
Identities = 104/194 (53%), Positives = 143/194 (73%), Gaps = 3/194 (1%)
Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHY--VNIMERLLEPERMIVF 247
SK ++ K+ E EF+Q+V+E L +L V+ + Y V ++ER++ PER+I F
Sbjct: 1 SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMVIPERVIEF 60
Query: 248 RVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYK 307
RVPW DD G+ HVN G+RVQF+ A+GP +GGLRF PS+NLSI KFLGFEQ K++L+
Sbjct: 61 RVPWEDDNGKVHVNTGYRVQFNGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLP 120
Query: 308 LGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQY 367
+GGA GGSDFDP GKSD E+MRFCQ+FM E++R++GPD D+P+ ++GVG RE+GY++GQY
Sbjct: 121 MGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDVPAGDLGVGAREIGYMYGQY 180
Query: 368 RRLAGHFQ-GSFTG 380
R++ G F G TG
Sbjct: 181 RKIVGGFYNGVLTG 194
|
| >d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 | Back information, alignment and structure |
|---|
| >d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 | Back information, alignment and structure |
|---|
| >d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 | Back information, alignment and structure |
|---|
| >d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 | Back information, alignment and structure |
|---|
| >d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 | Back information, alignment and structure |
|---|
| >d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 588 | |||
| d1bgva2 | 194 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 100.0 | |
| d1hwxa2 | 208 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 100.0 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 100.0 | |
| d1b26a2 | 175 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 100.0 | |
| d1gtma2 | 178 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 100.0 | |
| d1v9la2 | 176 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 100.0 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 100.0 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 100.0 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 100.0 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 100.0 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 100.0 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 100.0 | |
| d1c1da2 | 148 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 100.0 | |
| d1leha2 | 134 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 99.98 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 97.63 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 97.55 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 97.54 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 97.45 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 97.44 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 97.04 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.99 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.97 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 96.93 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 96.93 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.87 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 96.87 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.81 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 96.7 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.66 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 96.59 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.5 | |
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.49 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.45 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.41 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.41 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.4 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.39 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 96.36 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.3 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 96.27 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.26 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 96.23 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 96.23 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 96.16 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 96.14 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 96.1 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.02 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 96.02 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.95 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 95.94 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 95.84 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.82 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 95.78 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 95.65 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.61 | |
| d1rm4a1 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.56 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 95.55 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 95.53 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 95.48 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 95.47 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 95.45 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.44 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 95.37 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 95.32 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 95.3 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 95.27 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 95.18 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 95.09 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 94.97 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 94.91 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 94.88 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 94.75 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 94.74 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.71 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 94.64 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 94.61 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 94.33 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.23 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 94.09 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 94.03 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.03 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 93.98 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.85 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 93.79 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 93.64 | |
| d1k3ta1 | 190 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 93.58 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 93.46 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 93.4 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 93.32 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 93.14 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.1 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 92.97 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 92.95 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 92.78 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 92.76 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 92.75 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.59 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 92.58 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 92.47 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 92.3 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 92.22 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 92.17 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 92.02 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 91.97 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 91.85 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 91.76 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 91.66 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 91.57 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 91.54 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 91.41 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.29 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 91.07 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 91.05 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 90.9 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 90.88 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 90.8 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 90.71 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 90.68 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 90.51 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 90.36 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 90.27 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 90.25 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.22 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 90.21 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 90.0 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 89.99 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 89.97 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 89.97 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 89.91 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 89.6 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 89.54 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 89.26 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 89.22 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.17 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 88.92 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 88.83 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 88.74 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 88.59 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 88.59 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 88.35 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 88.25 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 88.2 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 88.14 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 88.14 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 88.11 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.05 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 88.0 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 87.95 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 87.7 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 87.68 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 87.65 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 87.63 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 87.6 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 87.58 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 87.55 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 87.5 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 87.2 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 87.09 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 86.98 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 86.97 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 86.88 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 86.68 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 86.55 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 86.49 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 86.27 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 86.12 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 86.0 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 85.98 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 85.94 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 85.93 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 85.87 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 85.69 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 85.65 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 85.65 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 85.48 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 85.47 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 85.43 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 85.37 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 85.37 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 85.36 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 85.31 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 85.29 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 85.21 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 85.21 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 85.04 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 84.63 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 84.59 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 84.52 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 84.45 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 84.2 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 84.2 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 84.04 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 83.75 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 83.56 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 83.55 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 83.45 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 83.25 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 83.04 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 83.01 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 82.95 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 82.94 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 82.92 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 82.61 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 82.48 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 82.4 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 82.32 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 82.23 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 82.23 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 82.06 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 81.85 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 81.84 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 81.77 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 81.66 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 81.3 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 81.09 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 81.04 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 81.02 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 81.02 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 80.54 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 80.51 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 80.45 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 80.04 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 80.02 |
| >d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Aminoacid dehydrogenase-like, N-terminal domain superfamily: Aminoacid dehydrogenase-like, N-terminal domain family: Aminoacid dehydrogenases domain: Glutamate dehydrogenase species: Clostridium symbiosum [TaxId: 1512]
Probab=100.00 E-value=2.6e-67 Score=506.56 Aligned_cols=191 Identities=54% Similarity=1.028 Sum_probs=186.5
Q ss_pred hhhHHHHHHHHHhhCCCCccHHHHHHHHHHHHHHHHHhCccch--HHHHhhcCCCeEEEEEEeEEcCCCCeEEEEEEEEE
Q 007820 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQ 267 (588)
Q Consensus 190 ~~~~~~~~~~~~~~~p~~~ef~q~v~e~~~~~~~~~~~~p~y~--~~~e~L~~Per~i~frvp~~dd~G~v~v~rGyRVq 267 (588)
|++++.+++.+.+|+|+||||+|+|.|++++++|+++++|+|. .++++|++|+|+|+|+|||+||+|++++|+|||||
T Consensus 1 s~~~~~~~~~v~~rnp~EpeF~QaV~Ev~~sl~~~i~~~p~y~~~~i~e~l~~P~r~i~~~~p~~~d~G~~~~~~gyRvq 80 (194)
T d1bgva2 1 SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQ 80 (194)
T ss_dssp CHHHHHHHHHHHHHTTTCHHHHHHHHHHHHTTHHHHHTCHHHHHTTHHHHHTSCSEEEEEEEEEECTTSCEEEEEEEEEE
T ss_pred ChhHHHHHHHHHhhCCCChHHHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHcCCCeEEEEEEEEEecCCcEEEEeeEEEE
Confidence 4578999999999999999999999999999999999999998 59999999999999999999999999999999999
Q ss_pred ecCCCCCCCCCeeeecCCCHHHHHHHhHhhhhhhcccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHHhhcCCCCc
Q 007820 268 FSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKD 347 (588)
Q Consensus 268 hs~alGPakGGlRfhp~vt~~evkaLA~~MT~KnAL~gLP~GGaKGGI~~DP~~~S~~El~R~~r~f~~eL~r~IGp~~D 347 (588)
||+++|||||||||||++|.+|+++||++|||||||++||||||||||++||+.+|++|++|+||+|+++|.++|||++|
T Consensus 81 hn~~lGP~kGGiR~~~~v~~~ev~~La~~MT~K~Al~~lp~GGgKggi~~dP~~~s~~el~r~~r~~~~~l~~~ig~~~D 160 (194)
T d1bgva2 81 FNGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLPMGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDID 160 (194)
T ss_dssp EECSSSSEEEEEEECTTCCHHHHHHHHHHHHHHHHHTSSSCCEEEEEESCCCTTCCHHHHHHHHHHHHHHHGGGCBTTTE
T ss_pred ecCCcCCcCCCeeecCcCCHHHHHHHHHHHHHhhhhcCCCcccccceeccCCCCCCHHHHHHHHHHHHHHhccccCCCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCChhHHHHHHHHHhhHhCCC-CccccC
Q 007820 348 LPSEEMGVGTREMGYLFGQYRRLAGHF-QGSFTG 380 (588)
Q Consensus 348 VpApDiGt~~reM~~i~~~y~~l~g~~-~g~vTG 380 (588)
||||||||+++||+||+|+|+++.|.+ .|++||
T Consensus 161 IpApDvgt~~~eM~wi~d~y~~~~g~~~~gvvTG 194 (194)
T d1bgva2 161 VPAGDLGVGAREIGYMYGQYRKIVGGFYNGVLTG 194 (194)
T ss_dssp EEECBTTBCHHHHHHHHHHHHHHHTSCCGGGSSS
T ss_pred ccCCcCCCCHHHHHHHHHHHHHhcCCCCCeeecC
Confidence 999999999999999999999999976 699997
|
| >d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|