Citrus Sinensis ID: 007838

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MGSTSTISLYSHPKLSHRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAARPEGGRRQRRVYRQSQSDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPSRPSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFTY
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHccccccc
cccccEEEEcccccccccccccccccccccccccccEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHccc
mgststislyshpklshraqpvlsrsfcqardaplsfalpfsgtrrcfRLKRLVVKAaarpeggrrqrRVYRqsqsdnalttapvkQIASFVVPAGVFVSATFVLWKLVEKllmpkpsrpskptaegmnwsvgagtnllsgftgKLFRESKQTLNEFAKELRAFSsvdmsgrnfgdeGLFFLAESlgynqtaeevsfAANGITAAGIKAFDGVLQSNIALktlnlsgnpigdegVKCLCDILvdnagverlqlssVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTirslhlngnyggaLGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDignnsisakGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQnrtittidlggnnihskGASAIARVLkdnsvitsldlaynpigaDGAKALSEVLKFHGnintlklgwcqigaSGAEFVADMLRYNNTISILDLRAnglrdevcsgcnglsFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAfneirvsniiffpffsffty
mgststislyshpklshrAQPVLSRSFCQARDAPLsfalpfsgtrrcfRLKRLvvkaaarpeggrrqrrvyrqsqsdnalttapvKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPSRPSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTIttidlggnnihSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFTY
MGSTSTISLYSHPKLSHRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAARPEGGrrqrrvyrqsqsDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPSRPSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHlngnyggalganalakglegnKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIffpffsffTY
************************RSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAA**********************TTAPVKQIASFVVPAGVFVSATFVLWKLVEKLL***************NWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFT*
***********************************S***********************************************PVKQIASFVVPAGVFVSATFVLWKLV********************WSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFT*
********LYSHPKLSHRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAA*********************TTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKP********EGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFTY
*****TI****HPKL*HRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAARPEGGRRQRRVYRQSQSDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPSRPSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTSTISLYSHPKLSHRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAARPEGGRRQRRVYRQSQSDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPSRPSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFFPFFSFFTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query588 2.2.26 [Sep-21-2011]
Q7RTR21065 Protein NLRC3 OS=Homo sap yes no 0.705 0.389 0.347 3e-46
Q5DU561064 Protein NLRC3 OS=Mus musc yes no 0.610 0.337 0.340 8e-44
P29315456 Ribonuclease inhibitor OS yes no 0.595 0.767 0.271 6e-26
P10775456 Ribonuclease inhibitor OS no no 0.527 0.679 0.303 8e-26
Q91VI7456 Ribonuclease inhibitor OS no no 0.630 0.813 0.265 9e-26
Q647I91098 NACHT, LRR and PYD domain no no 0.585 0.313 0.281 2e-25
Q9LE82535 RAN GTPase-activating pro no no 0.630 0.693 0.262 1e-23
Q0VAA2488 Uncharacterized protein C no no 0.413 0.497 0.310 5e-22
Q9Y239953 Nucleotide-binding oligom no no 0.360 0.222 0.328 5e-22
P13489461 Ribonuclease inhibitor OS no no 0.598 0.763 0.267 1e-21
>sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 Back     alignment and function desciption
 Score =  187 bits (474), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 148/426 (34%), Positives = 220/426 (51%), Gaps = 11/426 (2%)

Query: 150  SKQTLNEFAKELRAFSSVDMSGRNFGDEGLFFLAESL-GYNQTAEEVSFAANGITAAGIK 208
            S+  L     +L     + +    F D  +  L   L G +   +++S A N I+  G K
Sbjct: 625  SQGVLQSLLPQLLYCRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQISNKGAK 684

Query: 209  AFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAE 268
            A    L  N +L +L+L GN IG +G K L D L  N  +  L L    +RD+GA+++AE
Sbjct: 685  ALARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAE 744

Query: 269  LLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEG 328
             L +N  L +L L  N I   G   +A+AL +N +++ L  + N  G  GA ALA+ L+ 
Sbjct: 745  ALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKV 804

Query: 329  NKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKS 388
            N+ L  L L  NSI D G+ ALM  L + +  L+ L +  NSIS +GA  +A  +    +
Sbjct: 805  NQGLESLDLQSNSISDAGVAALMGALCTNQTLLS-LSLRENSISPEGAQAIAHALCANST 863

Query: 389  LLWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSL 448
            L  ++L  N + D+GA  IA A+++NRT+T++ L  N I +  A A+ + L+ N  +TSL
Sbjct: 864  LKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSL 923

Query: 449  DLAYNPIGADGAKALSEVLKFHGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRA 508
            DL  N IG DGA A++  LK +  +  L L    IGASGA+ + + L  N T+ ILDLR 
Sbjct: 924  DLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRG 983

Query: 509  NGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYL--QGAKCLAQSFKVVNEALTSID 566
            N +      G  G     +A+     +   +L  N L   GA C+A +    N  L  I+
Sbjct: 984  NAI------GVAGAKALANALKVNSSLRRLNLQENSLGMDGAICIATALS-GNHRLQHIN 1036

Query: 567  LAFNEI 572
            L  N I
Sbjct: 1037 LQGNHI 1042
May modulate T-cell activation. Decreases the transcription of genes that are normally up-regulated after T-cell stimulation. Delays degradation of NFKBIA/IKBA.
Homo sapiens (taxid: 9606)
>sp|Q5DU56|NLRC3_MOUSE Protein NLRC3 OS=Mus musculus GN=Nlrc3 PE=2 SV=2 Back     alignment and function description
>sp|P29315|RINI_RAT Ribonuclease inhibitor OS=Rattus norvegicus GN=Rnh1 PE=1 SV=2 Back     alignment and function description
>sp|P10775|RINI_PIG Ribonuclease inhibitor OS=Sus scrofa GN=RNH1 PE=1 SV=1 Back     alignment and function description
>sp|Q91VI7|RINI_MOUSE Ribonuclease inhibitor OS=Mus musculus GN=Rnh1 PE=1 SV=1 Back     alignment and function description
>sp|Q647I9|NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus GN=NLRP5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q0VAA2|CN16B_HUMAN Uncharacterized protein C14orf166B OS=Homo sapiens GN=C14orf166B PE=2 SV=2 Back     alignment and function description
>sp|Q9Y239|NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens GN=NOD1 PE=1 SV=1 Back     alignment and function description
>sp|P13489|RINI_HUMAN Ribonuclease inhibitor OS=Homo sapiens GN=RNH1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query588
356501981606 PREDICTED: protein NLRC3-like [Glycine m 0.918 0.891 0.665 0.0
255558382607 leucine rich repeat-containing protein, 0.908 0.879 0.664 0.0
296086512630 unnamed protein product [Vitis vinifera] 0.908 0.847 0.655 0.0
357486129606 Nucleotide-binding oligomerization domai 0.913 0.886 0.659 0.0
356498020606 PREDICTED: protein NLRC3-like [Glycine m 0.918 0.891 0.653 0.0
297843864605 EMB2004 [Arabidopsis lyrata subsp. lyrat 0.913 0.887 0.659 0.0
359473416684 PREDICTED: protein NLRC3-like [Vitis vin 0.887 0.763 0.673 0.0
18391166605 leucine-rich repeats-ribonuclease inhibi 0.913 0.887 0.659 0.0
258678027614 chloroplast envelope protein 1 [Nicotian 0.916 0.877 0.636 0.0
449452044602 PREDICTED: LOW QUALITY PROTEIN: protein 0.908 0.887 0.632 0.0
>gi|356501981|ref|XP_003519801.1| PREDICTED: protein NLRC3-like [Glycine max] Back     alignment and taxonomy information
 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/583 (66%), Positives = 454/583 (77%), Gaps = 43/583 (7%)

Query: 1   MGSTSTISLYSHPKLSHRAQPVLSRSFCQARDAPLSFALPFSGTRRCFRLKRLVVKAAAR 60
           M  TST+S+YSHP++    Q + S  F  A  A  +  LP    RR    +  V + ++ 
Sbjct: 1   MAFTSTLSIYSHPQVRLLNQRLQSLPFTAAGVAQFA-PLPPLNRRRTCSPRSFVFRVSSS 59

Query: 61  PEGGRRQ----RRVYRQSQSDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPK 116
            EG R +    RRVYRQSQ+   L++APVKQIA+ V P   F + TFV+WKLVEKLL+P 
Sbjct: 60  VEGSRARSGGSRRVYRQSQASAPLSSAPVKQIANVVAPVAAFFALTFVIWKLVEKLLVPT 119

Query: 117 PSR------PSKPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMS 170
           P +       S+  ++G+ WS  AGTNLLS    K+ R+SKQ LNEFA+ELR+FSS+DMS
Sbjct: 120 PKQLKSLTVESQSPSQGLKWSFAAGTNLLSQLGEKIERQSKQKLNEFARELRSFSSIDMS 179

Query: 171 GRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPI 230
           GRNFGDEGLFFLAESL +NQTAEEVSFAANGITAAG++AFDGVLQSNI LKTL+LSGN +
Sbjct: 180 GRNFGDEGLFFLAESLAFNQTAEEVSFAANGITAAGLRAFDGVLQSNITLKTLDLSGNLV 239

Query: 231 GDEGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSG 290
           GDEG KCLCDILV+N+ +E+LQL+S DL DEGAKAIAE+LK NS LRVLELNNNMI+YSG
Sbjct: 240 GDEGAKCLCDILVNNSSIEKLQLNSADLGDEGAKAIAEMLKKNSSLRVLELNNNMIEYSG 299

Query: 291 FTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRAL 350
           F+SLA ALLEN++IR++HLNGNYGGALGANALAK LE NKSLRELHLHGNSIGDEGIR+L
Sbjct: 300 FSSLAGALLENNSIRNIHLNGNYGGALGANALAKALESNKSLRELHLHGNSIGDEGIRSL 359

Query: 351 MSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADA 410
           M+GLSS KGKL +LDIGNNS++AKGAFHVAEYIK  KSLLW+NLYMNDIGDEGAEKIA A
Sbjct: 360 MTGLSSHKGKLTLLDIGNNSLTAKGAFHVAEYIKKSKSLLWLNLYMNDIGDEGAEKIAVA 419

Query: 411 LKQNRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFH 470
           LK+NR+I+T+DLGGNNIH  G +AIA+VLKDN VIT+L+L+YNPIG DGAKAL+EVLKFH
Sbjct: 420 LKENRSISTLDLGGNNIHVDGVNAIAQVLKDNLVITTLELSYNPIGPDGAKALAEVLKFH 479

Query: 471 GNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGCNGLSFFHSAIY 530
           GNI TLKLGWCQIGA GAEF+AD L+YN TISILDLRANGLRDE                
Sbjct: 480 GNIKTLKLGWCQIGAKGAEFIADALKYNTTISILDLRANGLRDE---------------- 523

Query: 531 SLKHMLFYSLCINYLQGAKCLAQSFKVVNEALTSIDLAFNEIR 573
                           GA+ LA+S KVVNEALTS+DL FNEIR
Sbjct: 524 ----------------GAQSLARSLKVVNEALTSLDLGFNEIR 550

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255558382|ref|XP_002520218.1| leucine rich repeat-containing protein, putative [Ricinus communis] gi|223540710|gb|EEF42273.1| leucine rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296086512|emb|CBI32101.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486129|ref|XP_003613352.1| Nucleotide-binding oligomerization domain-containing protein [Medicago truncatula] gi|355514687|gb|AES96310.1| Nucleotide-binding oligomerization domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356498020|ref|XP_003517853.1| PREDICTED: protein NLRC3-like [Glycine max] Back     alignment and taxonomy information
>gi|297843864|ref|XP_002889813.1| EMB2004 [Arabidopsis lyrata subsp. lyrata] gi|297335655|gb|EFH66072.1| EMB2004 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359473416|ref|XP_002266381.2| PREDICTED: protein NLRC3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|18391166|ref|NP_563871.1| leucine-rich repeats-ribonuclease inhibitor domain-containing protein [Arabidopsis thaliana] gi|15810395|gb|AAL07085.1| unknown protein [Arabidopsis thaliana] gi|20258921|gb|AAM14154.1| unknown protein [Arabidopsis thaliana] gi|332190466|gb|AEE28587.1| leucine-rich repeats-ribonuclease inhibitor domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|258678027|gb|ACV87735.1| chloroplast envelope protein 1 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|449452044|ref|XP_004143770.1| PREDICTED: LOW QUALITY PROTEIN: protein NLRC3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query588
TAIR|locus:2194604605 emb2004 "embryo defective 2004 0.952 0.925 0.606 1.3e-169
UNIPROTKB|Q7RTR21065 NLRC3 "Protein NLRC3" [Homo sa 0.709 0.391 0.323 9.8e-45
MGI|MGI:24440701064 Nlrc3 "NLR family, CARD domain 0.664 0.367 0.321 3.1e-40
RGD|621398456 Rnh1 "ribonuclease/angiogenin 0.600 0.774 0.267 3.2e-26
RGD|2321956456 LOC100360501 "ribonuclease inh 0.595 0.767 0.266 5.7e-26
UNIPROTKB|P10775456 RNH1 "Ribonuclease inhibitor" 0.617 0.796 0.262 1e-25
MGI|MGI:1195456456 Rnh1 "ribonuclease/angiogenin 0.588 0.758 0.266 1.9e-25
ZFIN|ZDB-GENE-110913-191252 si:dkey-156k2.3 "si:dkey-156k2 0.568 0.266 0.276 5.4e-22
TAIR|locus:2099207535 RANGAP1 "AT3G63130" [Arabidops 0.588 0.646 0.244 1.2e-21
UNIPROTKB|P13489461 RNH1 "Ribonuclease inhibitor" 0.651 0.830 0.254 1.9e-21
TAIR|locus:2194604 emb2004 "embryo defective 2004" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1649 (585.5 bits), Expect = 1.3e-169, P = 1.3e-169
 Identities = 354/584 (60%), Positives = 418/584 (71%)

Query:     3 STSTISLYSHPKLSHRAQPVLSRSFCQARDAPLS----FALPFSGTRRCFRLKRLVVKAA 58
             STS+++L+S PK S       S    +   + +S    F  P     R  RL    +KAA
Sbjct:     5 STSSLNLHSLPKASSGLGQWKSGFRYELLGSSVSRNRLFVSPVVIHHRSPRLP--AIKAA 62

Query:    59 ARPEGGXXXXXXXXXXXXDNALTTAPVKQIASFVVPAGVFVSATFVLWKLVEKLLMPKPS 118
                +GG             +    A V+QIAS V+P G F   TFVLWK+V K + PK  
Sbjct:    63 YNSDGGSKRSRVYKESQAASGFPNAKVQQIASSVLPLGSFAVVTFVLWKVVGKFMSPKSP 122

Query:   119 RPS----KPTAEGMNWSVGAGTNLLSGFTGKLFRESKQTLNEFAKELRAFSSVDMSGRNF 174
             + S      + +G+ WS+GAGTNLL GF  K+ RE+KQ LNEFAKELR+F SVDMSG NF
Sbjct:   123 KTSAGENNSSTQGVKWSIGAGTNLLQGFAAKVDREAKQRLNEFAKELRSFRSVDMSGCNF 182

Query:   175 GDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEG 234
             GDEGLFFLAESLGYNQT EEVSF+ANGITAAG+KAFDGVLQSNI LK LNLSGNPIGDEG
Sbjct:   183 GDEGLFFLAESLGYNQTVEEVSFSANGITAAGVKAFDGVLQSNIMLKILNLSGNPIGDEG 242

Query:   235 VKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSL 294
              K LC  L++N+ +E LQL+S D+ DEGAK IAELLK NS LR++ELNNNMIDYSGFTSL
Sbjct:   243 AKTLCATLMENSSIEILQLNSTDIGDEGAKEIAELLKRNSTLRIIELNNNMIDYSGFTSL 302

Query:   295 AEALLENSTIRSLHXXXXXXXXXXXXXXXXXXXXXKSLRELHLHGNSIGDEGIRALMSGL 354
             A ALLEN+TIR+LH                     KSLRELHLHGNSIGDEG RALM+GL
Sbjct:   303 AGALLENNTIRNLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGTRALMAGL 362

Query:   355 SSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQN 414
             SS KGK+A+LD+GNNSISAKGAF+VAEYIK  KSL+W+NLYMNDIGDEGAEKIAD+LKQN
Sbjct:   363 SSHKGKVALLDLGNNSISAKGAFYVAEYIKRSKSLVWLNLYMNDIGDEGAEKIADSLKQN 422

Query:   415 RTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFHGNIN 474
             R+I TIDLGGNNIH++G +AIA+ LKDN++IT+L++ YNPIG DGAKALSE+LKFHGN+ 
Sbjct:   423 RSIATIDLGGNNIHAEGVNAIAQALKDNAIITTLEVGYNPIGPDGAKALSEILKFHGNVK 482

Query:   475 TLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSGC--NGLSFFHSAIYSL 532
             TLKLGWCQI A GAE VADMLRYNNTIS+LDLRANGLRDE  S C    L   + A+ S+
Sbjct:   483 TLKLGWCQIAAKGAEHVADMLRYNNTISVLDLRANGLRDEGAS-CLARSLKVVNEALTSV 541

Query:   533 KHMLFYSLCINYLQ--GAKCLAQSFKVVNE--ALTSIDLAFNEI 572
                    L  N ++  GA  +AQ+ K  NE   +TSI+L  N I
Sbjct:   542 ------DLGFNEIRDDGAFAIAQALKA-NEDVTVTSINLGNNFI 578
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009536 "plastid" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
UNIPROTKB|Q7RTR2 NLRC3 "Protein NLRC3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444070 Nlrc3 "NLR family, CARD domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621398 Rnh1 "ribonuclease/angiogenin inhibitor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2321956 LOC100360501 "ribonuclease inhibitor-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P10775 RNH1 "Ribonuclease inhibitor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1195456 Rnh1 "ribonuclease/angiogenin inhibitor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-19 si:dkey-156k2.3 "si:dkey-156k2.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2099207 RANGAP1 "AT3G63130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P13489 RNH1 "Ribonuclease inhibitor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query588
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-38
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-36
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-30
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-14
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 8e-08
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 4e-07
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 3e-06
smart0036828 smart00368, LRR_RI, Leucine rich repeat, ribonucle 3e-04
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information 
 Score =  142 bits (359), Expect = 7e-38
 Identities = 85/291 (29%), Positives = 133/291 (45%), Gaps = 32/291 (10%)

Query: 156 EFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAA---------------- 199
           E   +L     + + G   G+E    LA +L    + +E+  +                 
Sbjct: 17  ELLPKLLCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIPRGLQSLLQG 76

Query: 200 --------------NGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDN 245
                         N +   G    + +L+S+ +L+ L L+ N +GD G++ L   L D 
Sbjct: 77  LTKGCGLQELDLSDNALGPDGCGVLESLLRSS-SLQELKLNNNGLGDRGLRLLAKGLKDL 135

Query: 246 A-GVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENSTI 304
              +E+L L    L     +A+A+ L+ N  L+ L L NN I  +G  +LAE L  N  +
Sbjct: 136 PPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGIRALAEGLKANCNL 195

Query: 305 RSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVL 364
             L LN N     GA+ALA+ L   KSL  L+L  N++ D G  AL S L S    L  L
Sbjct: 196 EVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALASALLSPNISLLTL 255

Query: 365 DIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEGAEKIADALKQNR 415
            +  N I+  GA  +AE +   +SLL ++L  N  G+EGA+ +A++L +  
Sbjct: 256 SLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAESLLEPG 306

LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|197686 smart00368, LRR_RI, Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 588
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG4308478 consensus LRR-containing protein [Function unknown 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG4308478 consensus LRR-containing protein [Function unknown 99.8
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.77
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.76
KOG4341483 consensus F-box protein containing LRR [General fu 99.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG4341483 consensus F-box protein containing LRR [General fu 99.61
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
KOG4237498 consensus Extracellular matrix protein slit, conta 99.56
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.46
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.38
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.35
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.35
KOG0617264 consensus Ras suppressor protein (contains leucine 99.2
KOG0617264 consensus Ras suppressor protein (contains leucine 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.72
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.65
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.64
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.57
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.45
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.42
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.41
PLN03150623 hypothetical protein; Provisional 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.3
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.14
PLN03150623 hypothetical protein; Provisional 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.45
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.34
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.3
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.96
PRK15386 426 type III secretion protein GogB; Provisional 96.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.78
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 96.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 96.28
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.91
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.91
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.77
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.44
PRK15386 426 type III secretion protein GogB; Provisional 94.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.58
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.13
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.73
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 80.62
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information 
Probab=99.97  E-value=1.2e-27  Score=241.49  Aligned_cols=312  Identities=33%  Similarity=0.448  Sum_probs=229.6

Q ss_pred             EEEccCCCCCHHHHHHHHHHhhcCCCccEEEeecCCCCHHHHHHHHHHHhcCCCccEEEccCCCCC--hHHHHHHHHHHh
Q 007838          166 SVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNLSGNPIG--DEGVKCLCDILV  243 (588)
Q Consensus       166 ~L~Ls~~~l~~~~~~~l~~~l~~~~~L~~L~L~~~~i~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~--~~~~~~l~~~l~  243 (588)
                      .|+|.++.+.+..+..+...+   .+|++|++++|.+++.+...+...+...++|++|+++++.++  ......++..+.
T Consensus         2 ~l~L~~~~l~~~~~~~~~~~l---~~L~~l~l~~~~l~~~~~~~i~~~l~~~~~l~~l~l~~~~~~~~~~~~~~~~~~l~   78 (319)
T cd00116           2 QLSLKGELLKTERATELLPKL---LCLQVLRLEGNTLGEEAAKALASALRPQPSLKELCLSLNETGRIPRGLQSLLQGLT   78 (319)
T ss_pred             ccccccCcccccchHHHHHHH---hhccEEeecCCCCcHHHHHHHHHHHhhCCCceEEeccccccCCcchHHHHHHHHHH
Confidence            467777777755555444443   569999999999988888888888888888999999988877  566666777777


Q ss_pred             hCCCCCEEEecCCCCChhHHHHHHHHHhhCCCccEEEeeccCCChhhHHHHHHHHhhC-CCcceeecCCCCCChhHHHHH
Q 007838          244 DNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLEN-STIRSLHLNGNYGGALGANAL  322 (588)
Q Consensus       244 ~~~~L~~L~L~~~~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~-~~L~~L~L~~~~~~~~~~~~l  322 (588)
                      .+++|++|++++|.+.......+...... ++|++|++++|.+++.+...+...+..+ ++|++|++++|.++..+...+
T Consensus        79 ~~~~L~~L~l~~~~~~~~~~~~~~~l~~~-~~L~~L~ls~~~~~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~~  157 (319)
T cd00116          79 KGCGLQELDLSDNALGPDGCGVLESLLRS-SSLQELKLNNNGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEAL  157 (319)
T ss_pred             hcCceeEEEccCCCCChhHHHHHHHHhcc-CcccEEEeeCCccchHHHHHHHHHHHhCCCCceEEEcCCCcCCchHHHHH
Confidence            78889999998888876666666665444 6688888888888877777777777776 788888888888776666666


Q ss_pred             HHHhhcCCCCCEEEccCCCCChhHHHHHHHHHhcCCCCceEEEccCCCCChhhHHHHHHHHhcCCCCcEEEccCCCCChH
Q 007838          323 AKGLEGNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDE  402 (588)
Q Consensus       323 ~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n~l~~~  402 (588)
                      ...+..++.|++|++++|.+++.++..+...+.. .++|++|++++|.+++.+...+...+..+++|++|++++|.+++.
T Consensus       158 ~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~~l~~-~~~L~~L~L~~n~i~~~~~~~l~~~~~~~~~L~~L~ls~n~l~~~  236 (319)
T cd00116         158 AKALRANRDLKELNLANNGIGDAGIRALAEGLKA-NCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDA  236 (319)
T ss_pred             HHHHHhCCCcCEEECcCCCCchHHHHHHHHHHHh-CCCCCEEeccCCccChHHHHHHHHHhcccCCCCEEecCCCcCchH
Confidence            6667777778888888887777766666655543 357777777777777777766777777777777777777777776


Q ss_pred             HHHHHHHHHhh-CCCccEEEeeCCcCCHHHHHHHHHHHhcCCCcCEEECcCCCCChHHHHHHHHHHhhC-CCccEEEccc
Q 007838          403 GAEKIADALKQ-NRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKALSEVLKFH-GNINTLKLGW  480 (588)
Q Consensus       403 ~~~~l~~~l~~-~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~-~~L~~L~L~~  480 (588)
                      ++..+...+.. .++|++|++++|.+++.+...+...+..+++|+.+++++|.+++++...+...++.. +.++.|++.+
T Consensus       237 ~~~~l~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~~~~~~~~L~~l~l~~N~l~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (319)
T cd00116         237 GAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAESLLEPGNELESLWVKD  316 (319)
T ss_pred             HHHHHHHHHhccCCCceEEEccCCCCCcHHHHHHHHHHhcCCCccEEECCCCCCcHHHHHHHHHHHhhcCCchhhcccCC
Confidence            66666655432 467777777777777766667777777667777777777777777777777666655 6667776665


Q ss_pred             CC
Q 007838          481 CQ  482 (588)
Q Consensus       481 n~  482 (588)
                      +.
T Consensus       317 ~~  318 (319)
T cd00116         317 DS  318 (319)
T ss_pred             CC
Confidence            54

LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query588
2bnh_A457 Porcine Ribonuclease Inhibitor Length = 457 7e-26
2bnh_A457 Porcine Ribonuclease Inhibitor Length = 457 3e-20
3tsr_E457 X-Ray Structure Of Mouse Ribonuclease Inhibitor Com 4e-25
1z7x_W461 X-Ray Structure Of Human Ribonuclease Inhibitor Com 3e-20
1a4y_A460 Ribonuclease Inhibitor-Angiogenin Complex Length = 4e-20
3un9_A372 Crystal Structure Of An Immune Receptor Length = 37 7e-06
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 2e-05
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 3e-05
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 96/372 (25%), Positives = 172/372 (46%), Gaps = 8/372 (2%)
Query: 150 SKQTLNEFAKELRA---FSSVDMSGRNFGDEGLFFLAESLGYNQTA-EEVSFAANGITAA 205
           +++   +    LRA    + + +     GD G+  + + L       +++S     +T A
Sbjct: 37  TEEHCKDIGSALRANPSLTELCLRTNELGDAGVHLVLQGLQSPTCKIQKLSLQNCSLTEA 96
Query: 206 GIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVD-NAGVERLQLSSVDLRDEGAK 264
           G       L+S   L+ L+LS NP+GD G++ LC+ L+D    +E+LQL    L     +
Sbjct: 97  GCGVLPSTLRSLPTLRELHLSDNPLGDAGLRLLCEGLLDPQCHLEKLQLEYCRLTAASCE 156
Query: 265 AIAELLKNNSILRVLELNNNMIDYSGFTSLAEALLENST-IRSLHXXXXXXXXXXXXXXX 323
            +A +L+    L+ L ++NN I  +G   L + L +++  + +L                
Sbjct: 157 PLASVLRATRALKELTVSNNDIGEAGARVLGQGLADSACQLETLRLENCGLTPANCKDLC 216
Query: 324 XXXXXXKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYI 383
                  SLREL L  N +GD GI  L  GL S   +L  L +    I+A G   +   +
Sbjct: 217 GIVASQASLRELDLGSNGLGDAGIAELCPGLLSPASRLKTLWLWECDITASGCRDLCRVL 276
Query: 384 KNCKSLLWINLYMNDIGDEGAEKIADALKQ-NRTITTIDLGGNNIHSKGASAIARVLKDN 442
           +  ++L  ++L  N +GDEGA  + ++L Q    + ++ +   ++ +     ++ +L  N
Sbjct: 277 QAKETLKELSLAGNKLGDEGARLLCESLLQPGCQLESLWVKSCSLTAACCQHVSLMLTQN 336
Query: 443 SVITSLDLAYNPIGADGAKALSEVLKFHG-NINTLKLGWCQIGASGAEFVADMLRYNNTI 501
             +  L L+ N +G  G + L + L   G  +  L LG C++  SG   +A +L  N ++
Sbjct: 337 KHLLELQLSSNKLGDSGIQELCQALSQPGTTLRVLCLGDCEVTNSGCSSLASLLLANRSL 396
Query: 502 SILDLRANGLRD 513
             LDL  N + D
Sbjct: 397 RELDLSNNCVGD 408
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure
>pdb|3TSR|E Chain E, X-Ray Structure Of Mouse Ribonuclease Inhibitor Complexed With Mouse Ribonuclease 1 Length = 457 Back     alignment and structure
>pdb|1Z7X|W Chain W, X-Ray Structure Of Human Ribonuclease Inhibitor Complexed With Ribonuclease I Length = 461 Back     alignment and structure
>pdb|1A4Y|A Chain A, Ribonuclease Inhibitor-Angiogenin Complex Length = 460 Back     alignment and structure
>pdb|3UN9|A Chain A, Crystal Structure Of An Immune Receptor Length = 372 Back     alignment and structure
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query588
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-111
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-50
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-33
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-78
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-57
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-62
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 9e-44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-33
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 2e-22
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 8e-30
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-10
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-30
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-22
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-20
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-15
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-04
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
 Score =  338 bits (869), Expect = e-111
 Identities = 104/414 (25%), Positives = 170/414 (41%), Gaps = 17/414 (4%)

Query: 166 SVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNIALKTLNL 225
           S+D+      D      AE L   Q  + V     G+T A  K     L+ N AL  LNL
Sbjct: 7   SLDIQCEELSDARW---AELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNL 63

Query: 226 SGNPIGDEGVKCLCDIL-VDNAGVERLQLSSVDLRDEGAKAIAELLKNNSILRVLELNNN 284
             N +GD GV C+   L   +  +++L L +  L   G   ++  L+    L+ L L++N
Sbjct: 64  RSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDN 123

Query: 285 MIDYSGFTSLAEALLE-NSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELHLHGNSIG 343
           ++  +G   L E LL+    +  L L      A     LA  L      +EL +  N I 
Sbjct: 124 LLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDIN 183

Query: 344 DEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYMNDIGDEG 403
           + G+R L  GL     +L  L + +  +++     +   + +  SL  + L  N +GD G
Sbjct: 184 EAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVG 243

Query: 404 AEKIADALKQ-NRTITTIDLGGNNIHSKGASAIARVLKDNSVITSLDLAYNPIGADGAKA 462
             ++   L   +  + T+ +    I +KG   + RVL+    +  L LA N +G +GA+ 
Sbjct: 244 MAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARL 303

Query: 463 LSEVLKF-HGNINTLKLGWCQIGASGAEFVADMLRYNNTISILDLRANGLRDEVCSG-CN 520
           L E L      + +L +  C   A+     + +L  N  +  L +  N L D      C 
Sbjct: 304 LCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQ 363

Query: 521 GLSFFHSAIYSLKHMLFYSLCINYL--QGAKCLAQSFKVVNEALTSIDLAFNEI 572
           GL    S +  L       L    +       LA +    N +L  +DL+ N +
Sbjct: 364 GLGQPGSVLRVL------WLADCDVSDSSCSSLAATLL-ANHSLRELDLSNNCL 410
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query588
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 100.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.56
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.48
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.4
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.4
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.38
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.34
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.26
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.99
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.73
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.71
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.13
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.82
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.53
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 88.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 86.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 85.0
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=375.61  Aligned_cols=414  Identities=19%  Similarity=0.221  Sum_probs=220.7

Q ss_pred             HHHHHHHcCCccEEEccCCCCCHHHHHHHHHHhhcCCCccEEEeecCCCCHHHHHHHHHHHhcCC-CccEEEccCCCCCh
Q 007838          154 LNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSNI-ALKTLNLSGNPIGD  232 (588)
Q Consensus       154 l~~~l~~~~~L~~L~Ls~~~l~~~~~~~l~~~l~~~~~L~~L~L~~~~i~~~~~~~l~~~l~~~~-~L~~L~Ls~n~i~~  232 (588)
                      ...++..+++|++|++++|.+++.+...++..+..+++|++|++++|.+++.++..+...+.... +|++|++++|.+++
T Consensus        20 ~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~~L~~L~L~~n~i~~   99 (461)
T 1z7x_W           20 WAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTG   99 (461)
T ss_dssp             HHHHHHHHTTCSEEEEESSCCCHHHHHHHHHHHHTCTTCCEEECTTCCCHHHHHHHHHHTTCSTTCCCCEEECTTSCCBG
T ss_pred             HHHHHhhcCCccEEEccCCCCCHHHHHHHHHHHHhCCCcCEEeCCCCcCChHHHHHHHHHHhhCCCceeEEEccCCCCCH
Confidence            33444455555566666555555555555555555555666666555555555544444333322 45566666555555


Q ss_pred             HHHHHHHHHHhhCCCCCEEEecCCCCChhHHHHHHHHHhh-CCCccEEEeeccCCChhhHHHHHHHHhhCCCcceeecCC
Q 007838          233 EGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKN-NSILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNG  311 (588)
Q Consensus       233 ~~~~~l~~~l~~~~~L~~L~L~~~~l~~~~~~~l~~~l~~-~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~  311 (588)
                      .+...++..+..+++|++|++++|.+++.+...+...+.. .++|++|++++|.+++.+...++..+..+++|++|++++
T Consensus       100 ~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~  179 (461)
T 1z7x_W          100 AGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSN  179 (461)
T ss_dssp             GGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCTTCCEEECCS
T ss_pred             HHHHHHHHHHccCCceeEEECCCCcCchHHHHHHHHHHhcCCCcceEEECCCCCCCHHHHHHHHHHHhhCCCCCEEECcC
Confidence            5555555555555556666666555555555555544332 344556666555555555555555555555566666655


Q ss_pred             CCCChhHHHHHHHHhh-cCCCCCEEEccCCCCChhHHHHHHHHHhcCCCCceEEEccCCCCChhhHHHHHHHHh-cCCCC
Q 007838          312 NYGGALGANALAKGLE-GNKSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIK-NCKSL  389 (588)
Q Consensus       312 ~~~~~~~~~~l~~~l~-~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~-~~~~L  389 (588)
                      |.+++.+...+...+. ..++|++|++++|.+++.++..+...+. .+++|++|++++|.+++.++..+...+. .+++|
T Consensus       180 n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~-~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~~~~~L  258 (461)
T 1z7x_W          180 NDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVA-SKASLRELALGSNKLGDVGMAELCPGLLHPSSRL  258 (461)
T ss_dssp             SBCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHH-HCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCC
T ss_pred             CCcchHHHHHHHHHHhcCCCCceEEEccCCCCcHHHHHHHHHHHH-hCCCccEEeccCCcCChHHHHHHHHHHhcCCCCc
Confidence            5555555444444443 2345556666555555555554444443 3345556666555555555544444333 35555


Q ss_pred             cEEEccCCCCChHHHHHHHHHHhhCCCccEEEeeCCcCCHHHHHHHHHHHhcC-CCcCEEECcCCCCChHHHHHHHHHHh
Q 007838          390 LWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKDN-SVITSLDLAYNPIGADGAKALSEVLK  468 (588)
Q Consensus       390 ~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~-~~L~~L~Ls~n~i~~~~~~~l~~~l~  468 (588)
                      ++|++++|.+++.++..++..+..+++|++|++++|.+++.+...+...+... ++|++|++++|.+++.+...+...+.
T Consensus       259 ~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~  338 (461)
T 1z7x_W          259 RTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLA  338 (461)
T ss_dssp             CEEECTTSCCCHHHHHHHHHHHHHCTTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHH
T ss_pred             eEEECcCCCCCHHHHHHHHHHHhhCCCcceEECCCCCCchHHHHHHHHHhccCCccceeeEcCCCCCchHHHHHHHHHHh
Confidence            66666655555555555555555555566666665555555555555554433 35556666665555555555555555


Q ss_pred             hCCCccEEEcccCCCChhHHHHHHHHHhc-CCcccEEEeecCCCCcccccCCCCchhhhhhHhhhhcccchhhhhccchh
Q 007838          469 FHGNINTLKLGWCQIGASGAEFVADMLRY-NNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQG  547 (588)
Q Consensus       469 ~~~~L~~L~L~~n~i~~~~~~~l~~~l~~-~~~L~~L~L~~n~l~~~~~~~~~~l~~~~~~~~~l~~L~~L~Ls~n~l~~  547 (588)
                      .+++|++|++++|.+++.++..+.+.+.. +++|++|+|++|.+++.      +...++..+..+++|++|+|++|.+++
T Consensus       339 ~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~i~~~------~~~~l~~~l~~~~~L~~L~l~~N~i~~  412 (461)
T 1z7x_W          339 QNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDS------SCSSLAATLLANHSLRELDLSNNCLGD  412 (461)
T ss_dssp             HCSSCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHH------HHHHHHHHHHHCCCCCEEECCSSSCCH
T ss_pred             hCCCccEEEccCCccccccHHHHHHHHcCCCCceEEEECCCCCCChh------hHHHHHHHHHhCCCccEEECCCCCCCH
Confidence            55556666666555555555555554443 44556666666655542      112245555555666666666665543


Q ss_pred             H--HHHHHHHHhhhhccceeeccCCcccc
Q 007838          548 A--KCLAQSFKVVNEALTSIDLAFNEIRV  574 (588)
Q Consensus       548 ~--~~l~~~~~~~~~~L~~L~ls~N~i~~  574 (588)
                      .  ..+...+...+.+|+.|++.++.++.
T Consensus       413 ~~~~~l~~~l~~~~~~L~~L~~~~~~~~~  441 (461)
T 1z7x_W          413 AGILQLVESVRQPGCLLEQLVLYDIYWSE  441 (461)
T ss_dssp             HHHHHHHHHHTSTTCCCCEEECTTCCCCH
T ss_pred             HHHHHHHHHhccCCcchhheeecccccCH
Confidence            2  12222222111245555555554443
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 588
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-18
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-18
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-13
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-17
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-17
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-17
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-16
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-16
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-16
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-16
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-15
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-15
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-15
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-14
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-14
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-13
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-12
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 2e-14
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 2e-13
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 4e-13
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 5e-12
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 2e-09
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 4e-06
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 1e-05
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 3e-13
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 5e-12
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 3e-11
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 3e-09
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 9e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Rna1p (RanGAP1), N-terminal domain
domain: Rna1p (RanGAP1), N-terminal domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score = 85.7 bits (210), Expect = 1e-18
 Identities = 61/327 (18%), Positives = 115/327 (35%), Gaps = 50/327 (15%)

Query: 200 NGITAAGIKAFDGVLQSNIALKTLNLSGNPIGDEGVKCLCDILVDNAGVERLQLSS---V 256
           + IT    K+   VL  + ++K + LSGN IG E  + L + +     +E  + S     
Sbjct: 13  DAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKKDLEIAEFSDIFTG 72

Query: 257 DLRDEGAKAIAELLKNNSILRVLELNNN-------------------------------- 284
            ++DE  +A+  LL+       L                                     
Sbjct: 73  RVKDEIPEALRLLLQALLKCPKLHTVRLSDNAFGPTAQEPLIDFLSKHTPLEHLYLHNNG 132

Query: 285 --------MIDYSGFTSLAEALLENSTIRSLHLNGNYGGALGANALAKGLEGNKSLRELH 336
                   +       ++ +       +RS+    N          AK  + ++ L  + 
Sbjct: 133 LGPQAGAKIARALQELAVNKKAKNAPPLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVK 192

Query: 337 LHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHVAEYIKNCKSLLWINLYM 396
           +  N I  EGI  L+    +   +L VLD+ +N+ +  G+  +A  +K+  +L  + L  
Sbjct: 193 MVQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAIALKSWPNLRELGLND 252

Query: 397 NDIGDEGAEKIADALK--QNRTITTIDLGGNNIHSKGASAIARVLKDN-SVITSLDLAYN 453
             +   GA  + DA    +N  + T+ L  N I       +  V+ +    +  L+L  N
Sbjct: 253 CLLSARGAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTVIDEKMPDLLFLELNGN 312

Query: 454 PIGADGA--KALSEVLK--FHGNINTL 476
               +      + EV      G ++ L
Sbjct: 313 RFSEEDDVVDEIREVFSTRGRGELDEL 339
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query588
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.8
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.6
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.03
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.98
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.51
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.24
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.7e-36  Score=311.51  Aligned_cols=420  Identities=18%  Similarity=0.213  Sum_probs=225.1

Q ss_pred             HHHHHHHcCCccEEEccCCCCCHHHHHHHHHHhhcCCCccEEEeecCCCCHHHHHHHHHHHhcC-CCccEEEccCCCCCh
Q 007838          154 LNEFAKELRAFSSVDMSGRNFGDEGLFFLAESLGYNQTAEEVSFAANGITAAGIKAFDGVLQSN-IALKTLNLSGNPIGD  232 (588)
Q Consensus       154 l~~~l~~~~~L~~L~Ls~~~l~~~~~~~l~~~l~~~~~L~~L~L~~~~i~~~~~~~l~~~l~~~-~~L~~L~Ls~n~i~~  232 (588)
                      +.+++..+++++.|+|++|++++.++..++..+..+++|++|+|++|.|++.++..+...+... .+|++|++++|.+++
T Consensus        19 ~~~l~~~l~~l~~L~L~~~~i~~~~~~~l~~~L~~~~~L~~LdLs~N~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~it~   98 (460)
T d1z7xw1          19 WAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTG   98 (460)
T ss_dssp             HHHHHHHHTTCSEEEEESSCCCHHHHHHHHHHHHTCTTCCEEECTTCCCHHHHHHHHHHTTCSTTCCCCEEECTTSCCBG
T ss_pred             HHHHHHhCCCCCEEEeCCCCCCHHHHHHHHHHHhcCCCCCEEECcCCcCChHHHHHHHHHHhcCCCCCCEEECCCCCccc
Confidence            3344444444455555555555444444444444444555555555555444444444443321 245555555555544


Q ss_pred             HHHHHHHHHHhhCCCCCEEEecCCCCChhHHHHHHHHHhhC-CCccEEEeeccCCChhhHHHHHHHHhhCCCcceeecCC
Q 007838          233 EGVKCLCDILVDNAGVERLQLSSVDLRDEGAKAIAELLKNN-SILRVLELNNNMIDYSGFTSLAEALLENSTIRSLHLNG  311 (588)
Q Consensus       233 ~~~~~l~~~l~~~~~L~~L~L~~~~l~~~~~~~l~~~l~~~-~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~L~~  311 (588)
                      .+...++..+..+++|++|++++|.+++.+...+...+... ............+...+...+...+.....++.+.+++
T Consensus        99 ~~~~~l~~~l~~~~~L~~L~L~~N~i~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~ls~  178 (460)
T d1z7xw1          99 AGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSN  178 (460)
T ss_dssp             GGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCTTCCEEECCS
T ss_pred             cccccccchhhccccccccccccccchhhhhhhhhhcccccccccccccccccccchhhhcccccccccccccccccccc
Confidence            44444444444444455555555544444444444333211 12233333333344444444444444555566666665


Q ss_pred             CCCChhHHHHHHHHhhcC-CCCCEEEccCCCCChhHHHHHHHHHhcCCCCceEEEccCCCCChhhHHHH-HHHHhcCCCC
Q 007838          312 NYGGALGANALAKGLEGN-KSLRELHLHGNSIGDEGIRALMSGLSSRKGKLAVLDIGNNSISAKGAFHV-AEYIKNCKSL  389 (588)
Q Consensus       312 ~~~~~~~~~~l~~~l~~~-~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l-~~~l~~~~~L  389 (588)
                      +...+.+...+...+... .....+++..+.+...+...+...+. ..+.++.+++++|.+.+.+.... .........+
T Consensus       179 ~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~-~~~~~~~l~~~~n~~~~~~~~~~~~~~~~~~~~l  257 (460)
T d1z7xw1         179 NDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVA-SKASLRELALGSNKLGDVGMAELCPGLLHPSSRL  257 (460)
T ss_dssp             SBCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHH-HCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCC
T ss_pred             cccccccccccccccccccccccccccccccccchhhhccccccc-ccccccccchhhccccccccchhhcccccccccc
Confidence            555544444444433322 24455666666555555444444433 23456666666666555443322 2222335566


Q ss_pred             cEEEccCCCCChHHHHHHHHHHhhCCCccEEEeeCCcCCHHHHHHHHHHHhc-CCCcCEEECcCCCCChHHHHHHHHHHh
Q 007838          390 LWINLYMNDIGDEGAEKIADALKQNRTITTIDLGGNNIHSKGASAIARVLKD-NSVITSLDLAYNPIGADGAKALSEVLK  468 (588)
Q Consensus       390 ~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~-~~~L~~L~Ls~n~i~~~~~~~l~~~l~  468 (588)
                      +.|++++|.+.......+...+..++.++.+++++|.+++.+...+...+.. ...|+.+++++|.+++.++..++..+.
T Consensus       258 ~~l~l~~n~i~~~~~~~~~~~l~~~~~l~~l~l~~n~i~~~~~~~l~~~l~~~~~~L~~l~l~~~~l~~~~~~~l~~~~~  337 (460)
T d1z7xw1         258 RTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLA  337 (460)
T ss_dssp             CEEECTTSCCCHHHHHHHHHHHHHCTTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccchhhccccccccccccccccccchhhhhhhhcccccc
Confidence            6667666666666666666666666666777777766666666666665543 245667777776666666666666666


Q ss_pred             hCCCccEEEcccCCCChhHHHHHHHHHh-cCCcccEEEeecCCCCcccccCCCCchhhhhhHhhhhcccchhhhhccchh
Q 007838          469 FHGNINTLKLGWCQIGASGAEFVADMLR-YNNTISILDLRANGLRDEVCSGCNGLSFFHSAIYSLKHMLFYSLCINYLQG  547 (588)
Q Consensus       469 ~~~~L~~L~L~~n~i~~~~~~~l~~~l~-~~~~L~~L~L~~n~l~~~~~~~~~~l~~~~~~~~~l~~L~~L~Ls~n~l~~  547 (588)
                      .+++|++|+|++|+|++.++..+++.+. .++.|++|+|++|.|++.      .+..+.+.+..+++|++|+|++|.|+.
T Consensus       338 ~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~L~Ls~n~i~~~------~~~~l~~~l~~~~~L~~L~Ls~N~i~~  411 (460)
T d1z7xw1         338 QNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDS------SCSSLAATLLANHSLRELDLSNNCLGD  411 (460)
T ss_dssp             HCSSCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCCHH------HHHHHHHHHHHCCCCCEEECCSSSCCH
T ss_pred             cccchhhhheeeecccCcccchhhhhhhcccCCCCEEECCCCCCChH------HHHHHHHHHhcCCCCCEEECCCCcCCH
Confidence            6666777777777766666666666554 345667777777766654      233345556666677777777776653


Q ss_pred             --HHHHHHHHHhhhhccceeeccCCccccCccccc
Q 007838          548 --AKCLAQSFKVVNEALTSIDLAFNEIRVSNIIFF  580 (588)
Q Consensus       548 --~~~l~~~~~~~~~~L~~L~ls~N~i~~~~~~~l  580 (588)
                        ...+...++.....|+.|++.+|.+.+++...+
T Consensus       412 ~g~~~l~~~l~~~~~~L~~l~l~~~~~~~~~~~~l  446 (460)
T d1z7xw1         412 AGILQLVESVRQPGCLLEQLVLYDIYWSEEMEDRL  446 (460)
T ss_dssp             HHHHHHHHHHTSTTCCCCEEECTTCCCCHHHHHHH
T ss_pred             HHHHHHHHHHHhCCCccCEEECCCCCCCHHHHHHH
Confidence              333334443222356677777776666655544
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure