Citrus Sinensis ID: 007979

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580--
MRSKKTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHHDSSSSSSVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
ccccccHHHHHHHHccccccccccccccHHHHHccccccccccHHHHccccccccccEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHccEEEEEEcccccccccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEccccccccccccHHHHccccccEEEcccccccccccccccccccccccccEEEccccccccccccccHHccccccccEEEEEcccccccHHHHHHccccccccccEEEEEEEcccccccccccHHHHHHHcccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEcccccccEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHHHHHccccccccccccccccEEEccEEc
ccccccHHHHHHHHHccHcccccccccccHHHEEcHHcccHHHHHHHHEEEEccccccEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHcccEEEEEEccccccccccEEcccEEEEEEEEcccccccccHHHcccccccccccccccccccccHHHHHHHHccccccEEEEcccccccccccHHHcccccccccHccEEEcccccccccccHHHcccccccEEEEcccccHHcccHHHcccccccEEEEcccccHHcccccccccccccEEEEEEccccccccccccccHHHHHHHcHccccccccccccccHHHHHHccccccccccEEEcccccccccccccccccHHHHHHccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHccccccHHccccccccccccccccEEEEcccHcHHHccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHHHcccccccccccHHccccEEEEEEEEc
MRSKKTEEEWCRILNNDLWKIEeiekgvlsplllsyndlpsrvkRCFSYCAVFPKDFNIMKEKLISMWMAQgyfsaeqdEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFvsqnecssmeingskepnainslDEKVCHLMLVIGlgasfpvsTCRIKRMRSLFIsgnmldnsslNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNertdslghmpagiarlpslrtldefhvsggegvdgrkgcrleslKNMELLQVCGirrlgnvsdvdeAKRLKLDKKKYLSCLRLWFDvkesggrrkneHDQLLLEAlqpplnlkelfigsyggntvspsWMMSLTNLRSLnlhlcenceqlpplgklpsleklyiSDMKSVKRVGNEILgiesdhhdssssssviiaFPKLqslfiedlpeleewdygitrtghpfidiMPRLSALAIAVcpklkalpdhihqtttlkglsiWGCDLLEERyrkgegedwpkishipniyINYLRI
mrskkteeewCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSggegvdgrkgcRLESLKNMELLqvcgirrlgnvsdvdeakrlkldkkkylscLRLWfdvkesggrrKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIesdhhdssssSSVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHqtttlkglsiwgCDLLEERYRKgegedwpkishipniyinylri
MRSKKTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDqlllealqpplnlKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIEsdhhdssssssVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
********EWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNE**************INSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKE**********QLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGI************VIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYL**
***KKTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSK******SLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDV************QLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHH*********IAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
********EWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIES*********SVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
****KTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHHDSSSSSSVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSKKTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHHDSSSSSSVIIAFPKLQSLFIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGEGEDWPKISHIPNIYINYLRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query582 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.737 0.438 0.337 2e-56
Q7XA39 988 Putative disease resistan N/A no 0.814 0.479 0.322 1e-54
Q7XBQ9970 Disease resistance protei N/A no 0.874 0.524 0.3 4e-54
Q9LRR4 1054 Putative disease resistan yes no 0.864 0.477 0.302 1e-53
Q7XA40 992 Putative disease resistan N/A no 0.826 0.484 0.327 2e-52
Q9LRR5 1424 Putative disease resistan no no 0.900 0.367 0.310 1e-50
Q39214926 Disease resistance protei no no 0.872 0.548 0.264 3e-27
Q38834852 Disease resistance RPP13- no no 0.632 0.431 0.279 5e-26
Q8W3K3910 Putative disease resistan no no 0.838 0.536 0.284 3e-24
Q9C8T9898 Putative disease resistan no no 0.786 0.510 0.251 2e-20
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  220 bits (560), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 169/501 (33%), Positives = 247/501 (49%), Gaps = 72/501 (14%)

Query: 1   MRSKKTEEEWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIM 60
           +R K+ E EW  + ++ +W + + E  +L  L LSY+ LP  +++CF YCAVFPKD  + 
Sbjct: 360 LRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMA 419

Query: 61  KEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVH 120
           KE LI+ WMA G+  ++ + E++ +G E +N L  RSFFQE + +        KMHD++H
Sbjct: 420 KENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYF--KMHDLIH 477

Query: 121 DFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSLFI 180
           D A  +     SS  I   +E NA           M+ IG                    
Sbjct: 478 DLATSLFSANTSSSNI---REINA------NYDGYMMSIGFAEVV--------------- 513

Query: 181 SGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLS 240
                  SS +  +L+    K  SLR L++ N      S++  +P +I  LVHLRYL+LS
Sbjct: 514 -------SSYSPSLLQ----KFVSLRVLNLRN------SNLNQLPSSIGDLVHLRYLDLS 556

Query: 241 SVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGI 300
               IR LP+ LC+L NL+ LD+ YC +L  LP+   KL ++++LL +   SL   P  I
Sbjct: 557 GNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGC-SLTSTPPRI 615

Query: 301 ARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLD 360
             L  L++L  F +        RKG +L  LKN+ L     I +L  V    +AK   L 
Sbjct: 616 GLLTCLKSLSCFVIG------KRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLS 669

Query: 361 KKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMS- 419
            K  L  L L +D+       K+ +D  +LEAL+P  NLK L I  +GG  + P WM   
Sbjct: 670 AKANLHSLCLSWDLD-----GKHRYDSEVLEALKPHSNLKYLEINGFGGIRL-PDWMNQS 723

Query: 420 -LTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHHDSSSSS 478
            L N+ S+ +  CENC  LPP G+LP LE L +    +      ++  +E + H      
Sbjct: 724 VLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSA------DVEYVEDNVHPGR--- 774

Query: 479 SVIIAFPKLQSLFIEDLPELE 499
                FP L+ L I D   L+
Sbjct: 775 -----FPSLRKLVIWDFSNLK 790
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.948 0.621 0.438 1e-119
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.920 0.591 0.440 1e-117
359482769 904 PREDICTED: putative disease resistance p 0.920 0.592 0.430 1e-116
359482784 919 PREDICTED: putative disease resistance p 0.914 0.578 0.442 1e-115
359482790 923 PREDICTED: putative disease resistance p 0.915 0.577 0.434 1e-115
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.955 0.563 0.444 1e-114
359482792 922 PREDICTED: putative disease resistance p 0.919 0.580 0.434 1e-114
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.938 0.580 0.417 1e-113
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.934 0.575 0.433 1e-112
147825450 927 hypothetical protein VITISV_000086 [Viti 0.931 0.584 0.427 1e-112
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  435 bits (1119), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 260/593 (43%), Positives = 363/593 (61%), Gaps = 41/593 (6%)

Query: 1   MRSKKTEEEWCRILNNDLWKIEEIEKG-----VLSPLLLSYNDLPSRVKRCFSYCAVFPK 55
           M+SK+T EEW R+L+++LW+++E+++      +  PLLLSY DLPS V+RCF YCA+FPK
Sbjct: 319 MQSKRTREEWERVLSSELWRLDEVDRDQVESRIFIPLLLSYYDLPSVVRRCFLYCAMFPK 378

Query: 56  DFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKM 115
           DF ++K++L+ MWMAQGY       +M+++GE YF++LA RSFFQ+F+ D    +   KM
Sbjct: 379 DFEMVKDELVKMWMAQGYIKETSGGDMELVGERYFHVLAARSFFQDFETDRFEGM-KFKM 437

Query: 116 HDIVHDFAQFVSQNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRM 175
           HDIVHDFAQ++++NEC ++++N         S+ E+V HL +++    SFPVS  + K +
Sbjct: 438 HDIVHDFAQYMTKNECLTVDVNTLGGATVETSI-ERVRHLSMMVSEETSFPVSIHKAKGL 496

Query: 176 RSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLR 235
           RSL I  +  D S   G  L +LF +LT +R+LD+        SSI +IP  + KL+HLR
Sbjct: 497 RSLLI--DTRDPSF--GAALPDLFKQLTCIRSLDLS------ASSIKEIPNEVGKLIHLR 546

Query: 236 YLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGH 295
           ++NL+    +  LPET+C+L NL+ LD+++C +LK LP  IGKLI ++HL   R+  +  
Sbjct: 547 HVNLARCGELESLPETMCDLCNLQSLDVTWCRSLKELPNAIGKLIKLRHLRIYRS-GVDF 605

Query: 296 MPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVC-GIRRL-GNVSDVDE 353
           +P GI R+  LRTLD F V GG G +  K   L  LKN+  +     IR L G + D  +
Sbjct: 606 IPKGIERITCLRTLDVFKVCGG-GENESKAANLRELKNLNHIGGSFSIRNLGGGIEDASD 664

Query: 354 AKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNTVS 413
           A   +L  KK L  L L FD  +  G        +L+EALQPP +L+ L I SYGG  + 
Sbjct: 665 AAEAQLKNKKRLLRLELGFDYNQENG--------ILIEALQPPSDLECLTISSYGGLDL- 715

Query: 414 PSWMMSLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIESDHHD 473
           P WMM+LT L+ L L  C N E L PLG LP+LE L +S +K V+R+    LGIE D + 
Sbjct: 716 PHWMMTLTRLQELRLDDCTNLEVLRPLGGLPNLEILVLSSLK-VRRLDAGFLGIEKDENA 774

Query: 474 SSSSSSV--IIAFPKLQSLFIEDLPELEEWDYGITRTGH------PFIDIMPRLSALAIA 525
           S +   +  + AFPKL+ L    L E+EEW+    R G         I IMP+L  L I 
Sbjct: 775 SINEGEIARVTAFPKLKRLDFRHLLEVEEWEGIERRVGEEDVNTTSIISIMPQLQYLRII 834

Query: 526 VCPKLKALPDHIHQTTTLKGLSIWGCDLLEERYRKGE-GEDWPKISHIPNIYI 577
            CP L+ALPD++     L+ L I  C +L +RY K E GEDW KISHIPN Y 
Sbjct: 835 NCPLLRALPDYV-LAAPLQELDIRWCTILRKRYGKEEMGEDWQKISHIPNSYF 886

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query582
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.869 0.480 0.303 2.2e-53
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.859 0.351 0.310 3.7e-53
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.876 0.283 0.268 9.6e-30
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.546 0.303 0.266 1.1e-21
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.546 0.303 0.266 1.1e-21
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.462 0.298 0.254 1e-20
TAIR|locus:5049561841017 AT1G58807 "AT1G58807" [Arabido 0.536 0.306 0.243 2.8e-20
TAIR|locus:28270381017 AT1G59124 "AT1G59124" [Arabido 0.536 0.306 0.243 2.8e-20
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.529 0.270 0.261 2.3e-19
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.554 0.327 0.300 4.8e-19
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 546 (197.3 bits), Expect = 2.2e-53, Sum P(2) = 2.2e-53
 Identities = 171/563 (30%), Positives = 281/563 (49%)

Query:     9 EWCRILNNDLWKIEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMW 68
             EW R+L++ +W +   +  +L  L +SY  LP+ +KRCF+YC++FPK     K+K++ +W
Sbjct:   392 EWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLW 451

Query:    69 MAQGYFS-AEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVS 127
             MA+G+       + ++ +G EYF+ L +RS  Q+ K  +        MHD +++ AQF S
Sbjct:   452 MAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTKTRYI-------MHDFINELAQFAS 504

Query:   128 QNECSSMEINGSKEPNAINSLDEKVCHLMLVIGLGASFPVSTCRIKRMRSL--FISGNML 185
               E SS   +G K       + E+  +L  +    A  P+    ++ ++ L  F+  ++ 
Sbjct:   505 -GEFSSKFEDGCKL-----QVSERTRYLSYLRDNYAE-PMEFEALREVKFLRTFLPLSLT 557

Query:   186 DNSS---LNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIEKLVHLRYLNLSSV 242
             ++S    L+  + ++L   LT LR L + ++         D  +NI    H R+L+LS  
Sbjct:   558 NSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPP--DFFKNIS---HARFLDLSR- 611

Query:   243 TLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIAR 302
             T + KLP++LC +YNL+ L +SYC +LK LP  I  LIN+++L    T  L  MP    R
Sbjct:   612 TELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGT-KLRQMPRRFGR 670

Query:   303 LPSLRTLDEFHVSGGEGVDGRKGCRLESLKNME-LLQVCGIRRLGNVSDVDEAKRLKLDK 361
             L SL+TL  F VS     DG +   L  L ++   L++  ++R+ +V+D  EA    L+ 
Sbjct:   671 LKSLQTLTTFFVSAS---DGSRISELGGLHDLHGKLKIVELQRVVDVADAAEAN---LNS 724

Query:   362 KKYLSCLR-LWFDVKESGGRRKNEH----DXXXXXXXXXXXXXKELFIGSYGGNTVSPSW 416
             KK+L  +  +W     S     N H    +             ++L I  Y G    P W
Sbjct:   725 KKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRF-PDW 783

Query:   417 MM--SLTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNEILGIEXXXXXX 474
             +   S + +  + L  C+ C  LP LG+LP L++L+IS M  ++ +G +    +      
Sbjct:   784 LSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQ 843

Query:   475 XXXXXVIIAFPKLQSLFIEDLPELEEW-DYGITRTGHPFIDIMPRLSALAIAVCPKLKA- 532
                      F  L++L  ++LP+ +EW D  +TR G    D+ P L  L I  CP+L   
Sbjct:   844 DQQ-----PFRSLETLRFDNLPDWQEWLDVRVTR-G----DLFPSLKKLFILRCPELTGT 893

Query:   533 LPDHIHQTTTLKGLSIWGCDLLE 555
             LP  +    +L  L I+ C LL+
Sbjct:   894 LPTFL---PSLISLHIYKCGLLD 913
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03820007
cc-nbs-lrr resistance protein (888 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 6e-17
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 81.2 bits (201), Expect = 6e-17
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 1   MRSKKTEEEWCRILNNDLWKIEEIE--KGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFN 58
           +  K T +EW  +L     ++   +    VLS L LSY++LP  +KRCF Y A+FP+D+N
Sbjct: 205 LAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYN 264

Query: 59  IMKEKLISMWMAQGYFSAEQD 79
           I KE+LI +W+A+G+      
Sbjct: 265 IRKEQLIKLWIAEGFVIPSDI 285

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 582
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.5
KOG4237498 consensus Extracellular matrix protein slit, conta 99.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
KOG4237498 consensus Extracellular matrix protein slit, conta 99.42
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.25
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.94
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.8
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.67
PLN03150623 hypothetical protein; Provisional 98.66
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.63
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.63
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
PLN03150623 hypothetical protein; Provisional 98.6
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.53
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.53
KOG4341483 consensus F-box protein containing LRR [General fu 98.52
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PRK15386 426 type III secretion protein GogB; Provisional 98.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.92
PRK15386426 type III secretion protein GogB; Provisional 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.43
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.24
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.21
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.33
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.03
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.99
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.05
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.66
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.18
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.37
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.04
smart0037026 LRR Leucine-rich repeats, outliers. 88.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.72
smart0037026 LRR Leucine-rich repeats, outliers. 87.72
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.46
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-49  Score=420.28  Aligned_cols=473  Identities=28%  Similarity=0.405  Sum_probs=316.1

Q ss_pred             CCCCCCHHHHHHHhcccccc----ccccCCCchHHHHhhhccCChhhhhHhhhccCCCCCCccCHHHHHHHHHHcCCccC
Q 007979            1 MRSKKTEEEWCRILNNDLWK----IEEIEKGVLSPLLLSYNDLPSRVKRCFSYCAVFPKDFNIMKEKLISMWMAQGYFSA   76 (582)
Q Consensus         1 l~~~~~~~~W~~~l~~~~~~----~~~~~~~i~~~L~lSY~~L~~~~k~cFl~~a~Fp~~~~i~~~~Li~~w~aeg~i~~   76 (582)
                      |+.|++.++|+.+.+...+.    .++.++.|+++|++|||+||+++|.||||||+|||||+|++++||.+|+||||+.+
T Consensus       366 ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~  445 (889)
T KOG4658|consen  366 LACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDP  445 (889)
T ss_pred             hcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCc
Confidence            68999999999999875444    23345789999999999999999999999999999999999999999999999988


Q ss_pred             C-CcccHHHHHHHHHHHHHhccCccccccCCCCCeeEEEeCHHHHHHHHHhhh-----ccceeeecC-CCCCCCcccCCC
Q 007979           77 E-QDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACKMHDIVHDFAQFVSQ-----NECSSMEIN-GSKEPNAINSLD  149 (582)
Q Consensus        77 ~-~~~~~~~~~~~~~~~L~~~~ll~~~~~~~~~~~~~~~mhdl~~d~a~~i~~-----~~~~~~~~~-~~~~~~~~~~~~  149 (582)
                      . .+..+++.|+.|+.+|+++++++.....  +...+|+|||+|||||.++|.     ++..+.... +....+.. .-+
T Consensus       446 ~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~-~~~  522 (889)
T KOG4658|consen  446 LDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQV-KSW  522 (889)
T ss_pred             cccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccc-cch
Confidence            4 4688999999999999999999987754  566789999999999999999     565544432 22222122 225


Q ss_pred             cceeEEEEEecCCCcccccccCCCCceEEEEeCCcCCCCchhhhhHHHHHccCCceeEEEeCCCcccccccccccccccc
Q 007979          150 EKVCHLMLVIGLGASFPVSTCRIKRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPRNIE  229 (582)
Q Consensus       150 ~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~~~l~~lp~~i~  229 (582)
                      ...|++++.++.+...+... .+++|++|.+.+|..    ....+.+.+|..++.||||||++     |..+..+|+.|+
T Consensus       523 ~~~rr~s~~~~~~~~~~~~~-~~~~L~tLll~~n~~----~l~~is~~ff~~m~~LrVLDLs~-----~~~l~~LP~~I~  592 (889)
T KOG4658|consen  523 NSVRRMSLMNNKIEHIAGSS-ENPKLRTLLLQRNSD----WLLEISGEFFRSLPLLRVLDLSG-----NSSLSKLPSSIG  592 (889)
T ss_pred             hheeEEEEeccchhhccCCC-CCCccceEEEeecch----hhhhcCHHHHhhCcceEEEECCC-----CCccCcCChHHh
Confidence            78899999999887765554 556899999999852    12334567789999999999999     668889999999


Q ss_pred             ccCCCCEEecCCCCCccccchhhhccCCccEEecCCCcCccccccccccCCCCceeecCCccCCCcCCccCCCCCCCCcc
Q 007979          230 KLVHLRYLNLSSVTLIRKLPETLCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSLRTL  309 (582)
Q Consensus       230 ~L~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~i~~l~~L~~L  309 (582)
                      .|.+||||+++++. +..+|..+++|++|++|++..+..+..+|.....|.+||+|.+.... ...-...++.+.+|++|
T Consensus       593 ~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L  670 (889)
T KOG4658|consen  593 ELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHL  670 (889)
T ss_pred             hhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccch
Confidence            99999999999999 89999999999999999999988777777777779999999987653 11111223334444444


Q ss_pred             CeeeecCCCCcCCCCccccccccCCCccCeeeeeecCCCCChhHHHhcccCCCCCcceEEEEeeecCCCCCCccchHHHH
Q 007979          310 DEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLL  389 (582)
Q Consensus       310 ~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~  389 (582)
                      ....+...+      ...+..+..+..|..+.....                        +..+           .....
T Consensus       671 ~~ls~~~~s------~~~~e~l~~~~~L~~~~~~l~------------------------~~~~-----------~~~~~  709 (889)
T KOG4658|consen  671 ENLSITISS------VLLLEDLLGMTRLRSLLQSLS------------------------IEGC-----------SKRTL  709 (889)
T ss_pred             hhheeecch------hHhHhhhhhhHHHHHHhHhhh------------------------hccc-----------cccee
Confidence            433332211      001111211211111100000                        0000           00111


Q ss_pred             HhhCCCCCCCcEEEEeeEeCCCcCCchhh-----c-CcCCcEEEEeCCCCCCcCCCCCCCCCcceeecccccCceEeCcc
Q 007979          390 LEALQPPLNLKELFIGSYGGNTVSPSWMM-----S-LTNLRSLNLHLCENCEQLPPLGKLPSLEKLYISDMKSVKRVGNE  463 (582)
Q Consensus       390 ~~~l~~~~~L~~L~l~~~~~~~~~p~~~~-----~-l~~L~~L~l~~~~~~~~l~~l~~l~~L~~L~L~~~~~l~~~~~~  463 (582)
                      ...+..+.+|+.|.+.++.+......|..     . ++++..+.+.+|.....+.+....|+|+.|.+..|..++.+...
T Consensus       710 ~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~  789 (889)
T KOG4658|consen  710 ISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPK  789 (889)
T ss_pred             ecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCH
Confidence            22333455566666665555432111211     1 44555555555655555555555566666666666655554322


Q ss_pred             ccCCCCCCCCCCCCCcccccCcccccc-cccccccccccccCcccCCCCCCcccccccceecccccccccCCcCCCCCCC
Q 007979          464 ILGIESDHHDSSSSSSVIIAFPKLQSL-FIEDLPELEEWDYGITRTGHPFIDIMPRLSALAIAVCPKLKALPDHIHQTTT  542 (582)
Q Consensus       464 ~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~L~~l~~~~~~~~~~~~~~~~~L~~L~l~~C~~L~~lp~~~~~l~~  542 (582)
                      .-....       ....+..|++++.+ .+.+.+.+.++.....        .++.|+.+.+..||++..+|.       
T Consensus       790 ~k~~~~-------l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l--------~~~~l~~~~ve~~p~l~~~P~-------  847 (889)
T KOG4658|consen  790 LKALLE-------LKELILPFNKLEGLRMLCSLGGLPQLYWLPL--------SFLKLEELIVEECPKLGKLPL-------  847 (889)
T ss_pred             HHHhhh-------cccEEecccccccceeeecCCCCceeEeccc--------CccchhheehhcCcccccCcc-------
Confidence            111000       00012355566666 4665555555543222        456688888888888777663       


Q ss_pred             cceEEEeCC
Q 007979          543 LKGLSIWGC  551 (582)
Q Consensus       543 L~~L~i~~C  551 (582)
                      +.++.+.+|
T Consensus       848 ~~~~~i~~~  856 (889)
T KOG4658|consen  848 LSTLTIVGC  856 (889)
T ss_pred             ccccceecc
Confidence            445555555

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query582
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-32
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  131 bits (331), Expect = 1e-32
 Identities = 19/143 (13%), Positives = 44/143 (30%), Gaps = 20/143 (13%)

Query: 1   MRSKKTE-EEWCRILNNDLWKIEEIEK-----GVLSPLLLSYNDLPSRVKRCFSYCAVFP 54
           +R      E + + L N  +K            +   + +S   L   +K  ++  ++  
Sbjct: 331 LRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQ 390

Query: 55  KDFNIMKEKLISMWMAQGYFSAEQDEEMDIIGEEYFNILATRSFFQEFKRDHDNLIVACK 114
           KD  +  + L  +W  +               E+       +S       D +       
Sbjct: 391 KDVKVPTKVLCILWDMETE-----------EVEDILQEFVNKSLLF---CDRNGKSFRYY 436

Query: 115 MHDIVHDFAQFVSQNECSSMEIN 137
           +HD+  DF    + ++   +   
Sbjct: 437 LHDLQVDFLTEKNCSQLQDLHKK 459
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.58
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.42
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.42
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.32
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.22
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.1
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.03
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.97
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.88
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.82
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 98.72
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.6
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.53
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.77
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.0
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.39
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.64
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.96  E-value=1.7e-29  Score=275.50  Aligned_cols=394  Identities=18%  Similarity=0.150  Sum_probs=258.0

Q ss_pred             CcceeEEEEEecCCC-cccccccCC-CCceEEEEeCCcCCCCchhhhhHHHHHccCCceeEEEeCCCccccccccccccc
Q 007979          149 DEKVCHLMLVIGLGA-SFPVSTCRI-KRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGNWSATLCSSILDIPR  226 (582)
Q Consensus       149 ~~~~~~l~~~~~~~~-~~~~~~~~~-~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~~~l~~lp~  226 (582)
                      ...++++.+..+... .+|..+... ++|+.|++++|.+...      .|..|..+++|++|++++|.+.+     .+|.
T Consensus       268 l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~------~p~~~~~l~~L~~L~L~~n~l~~-----~ip~  336 (768)
T 3rgz_A          268 LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGA------VPPFFGSCSLLESLALSSNNFSG-----ELPM  336 (768)
T ss_dssp             CTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEEC------CCGGGGGCTTCCEEECCSSEEEE-----ECCH
T ss_pred             cCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCc------cchHHhcCCCccEEECCCCcccC-----cCCH
Confidence            466788888777654 567666654 8999999999875422      45558889999999999854432     5675


Q ss_pred             c-ccccCCCCEEecCCCCCccccchhhhccC-CccEEecCCCcCcccccccccc--CCCCceeecCCccCCCcCCccCCC
Q 007979          227 N-IEKLVHLRYLNLSSVTLIRKLPETLCELY-NLEKLDISYCINLKALPQGIGK--LINMKHLLNERTDSLGHMPAGIAR  302 (582)
Q Consensus       227 ~-i~~L~~L~~L~L~~~~~~~~lp~~i~~L~-~L~~L~L~~~~~l~~lp~~i~~--l~~L~~L~l~~~~~~~~~p~~i~~  302 (582)
                      . ++.+++|++|++++|.+.+.+|..+.++. +|++|++++|.....+|..+..  +++|++|++.+|.....+|..++.
T Consensus       337 ~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~  416 (768)
T 3rgz_A          337 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN  416 (768)
T ss_dssp             HHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGG
T ss_pred             HHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhc
Confidence            5 88899999999999986668888888887 8999999998866667777766  788999999988777788888888


Q ss_pred             CCCCCccCeeeecCCCCcCCCCccccccccCCCccCeeeeeecCCCCChhHHHhcccCCCCCcceEEEEeeecCCCCCCc
Q 007979          303 LPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRK  382 (582)
Q Consensus       303 l~~L~~L~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~  382 (582)
                      +++|++|++..+...    +..+..+..+++|+.|....+...+.++.       .+..++.|+.|++..+...      
T Consensus       417 l~~L~~L~Ls~N~l~----~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-------~~~~l~~L~~L~L~~N~l~------  479 (768)
T 3rgz_A          417 CSELVSLHLSFNYLS----GTIPSSLGSLSKLRDLKLWLNMLEGEIPQ-------ELMYVKTLETLILDFNDLT------  479 (768)
T ss_dssp             CTTCCEEECCSSEEE----SCCCGGGGGCTTCCEEECCSSCCCSCCCG-------GGGGCTTCCEEECCSSCCC------
T ss_pred             CCCCCEEECcCCccc----CcccHHHhcCCCCCEEECCCCcccCcCCH-------HHcCCCCceEEEecCCccc------
Confidence            889998887655332    22344455555544444333333222222       3556778888888765432      


Q ss_pred             cchHHHHHhhCCCCCCCcEEEEeeEeCCCcCCchhhcCcCCcEEEEeCCCCCCcCCC-CCCCCCcceeecccccCceEeC
Q 007979          383 NEHDQLLLEALQPPLNLKELFIGSYGGNTVSPSWMMSLTNLRSLNLHLCENCEQLPP-LGKLPSLEKLYISDMKSVKRVG  461 (582)
Q Consensus       383 ~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~~l~~-l~~l~~L~~L~L~~~~~l~~~~  461 (582)
                          ...+..+..+++|+.|++++|.+....|.+++.+++|+.|++++|...+.+|. ++.+++|+.|++++|.....+|
T Consensus       480 ----~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip  555 (768)
T 3rgz_A          480 ----GEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP  555 (768)
T ss_dssp             ----SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCC
T ss_pred             ----CcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCC
Confidence                12345567788899999999988866688999999999999999988777775 8888999999999888555677


Q ss_pred             ccccCCCCCCCC-----------------------------------------------------CCCCCcccccCcccc
Q 007979          462 NEILGIESDHHD-----------------------------------------------------SSSSSSVIIAFPKLQ  488 (582)
Q Consensus       462 ~~~~~~~~~~~~-----------------------------------------------------~~~~~~~~~~~~~L~  488 (582)
                      ..++........                                                     ..........+++|+
T Consensus       556 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~  635 (768)
T 3rgz_A          556 AAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM  635 (768)
T ss_dssp             GGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCC
T ss_pred             hHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhcccccc
Confidence            655432110000                                                     000011223345555


Q ss_pred             ccccccccccc-ccccC---------------cccCCCC-CCcccccccceecccccccccCCcCCCCCCCcceEEEeCC
Q 007979          489 SLFIEDLPELE-EWDYG---------------ITRTGHP-FIDIMPRLSALAIAVCPKLKALPDHIHQTTTLKGLSIWGC  551 (582)
Q Consensus       489 ~L~l~~~~~L~-~l~~~---------------~~~~~~~-~~~~~~~L~~L~l~~C~~L~~lp~~~~~l~~L~~L~i~~C  551 (582)
                      +|+++++ ++. .+|..               .....+| .++.+++|+.|++++|.--..+|..+..+++|+.|++++|
T Consensus       636 ~LdLs~N-~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          636 FLDMSYN-MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN  714 (768)
T ss_dssp             EEECCSS-CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSS
T ss_pred             EEECcCC-cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCC
Confidence            5555443 121 11100               0011222 3668889999999986655578888888899999998875


Q ss_pred             cch-----------------------H----HHhcCCCCCCCCccCCcCce
Q 007979          552 DLL-----------------------E----ERYRKGEGEDWPKISHIPNI  575 (582)
Q Consensus       552 ~~l-----------------------~----~~~~~~~~~~~~~i~~i~~~  575 (582)
                      +--                       .    ..|....+++|++++|+|.+
T Consensus       715 ~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          715 NLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             EEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC-------------
T ss_pred             cccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCcccc
Confidence            321                       0    14677889999999999965
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 582
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.6 bits (101), Expect = 4e-05
 Identities = 35/228 (15%), Positives = 73/228 (32%), Gaps = 18/228 (7%)

Query: 233 HLRYLNLSSVTLIRKLPETLCELYNLEKLDISYC-INLKALPQGIGKLINMKHLLNERTD 291
            +         + + L E       ++ +D+S   I +  L   + +   +++L  E   
Sbjct: 24  GVIAFRCPRSFMDQPLAEHFSPF-RVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLR 82

Query: 292 SLGHMPAGIARLPSLRTLDEFHVSGGEGVDGRKGCRLESLKNMELLQVCGIRRLGNVSDV 351
               +   +A+  +L  L+    SG      +                    RL  ++  
Sbjct: 83  LSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLL-------------SSCSRLDELNLS 129

Query: 352 DEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGNT 411
                 +   +  ++ +          G RKN     L   ++   NL  L +       
Sbjct: 130 WCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLK 189

Query: 412 VSPSWMMSLTN-LRSLNLHLCENC--EQLPPLGKLPSLEKLYISDMKS 456
                     N L+ L+L  C +   E L  LG++P+L+ L +  +  
Sbjct: 190 NDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVP 237
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query582
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.11
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.89
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.75
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.75
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.99
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.82  E-value=1.2e-20  Score=180.99  Aligned_cols=253  Identities=20%  Similarity=0.202  Sum_probs=160.9

Q ss_pred             CCceEEEEeCCcCCCCchhhhhHHHHHccCCceeEEEeCC-CccccccccccccccccccCCCCEEecCCCCCccccchh
Q 007979          173 KRMRSLFISGNMLDNSSLNGKMLKELFGKLTSLRALDIGN-WSATLCSSILDIPRNIEKLVHLRYLNLSSVTLIRKLPET  251 (582)
Q Consensus       173 ~~L~~L~l~~~~l~~~~~~~~~~~~~~~~l~~Lr~L~L~~-~~~~~~~~l~~lp~~i~~L~~L~~L~L~~~~~~~~lp~~  251 (582)
                      .+++.|+++++.+...   .. +|..+.++++|++|+|++ |++.+     .+|..|++|++|++|++++|.+.+..|..
T Consensus        50 ~~v~~L~L~~~~l~g~---~~-lp~~l~~L~~L~~L~Ls~~N~l~g-----~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~  120 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKP---YP-IPSSLANLPYLNFLYIGGINNLVG-----PIPPAIAKLTQLHYLYITHTNVSGAIPDF  120 (313)
T ss_dssp             CCEEEEEEECCCCSSC---EE-CCGGGGGCTTCSEEEEEEETTEES-----CCCGGGGGCTTCSEEEEEEECCEEECCGG
T ss_pred             EEEEEEECCCCCCCCC---CC-CChHHhcCcccccccccccccccc-----ccccccccccccchhhhcccccccccccc
Confidence            4688888888876532   11 344588899999999986 33332     68888999999999999998866666777


Q ss_pred             hhccCCccEEecCCCcCccccccccccCCCCceeecCCccCCCcCCccCCCCCCC-CccCeeeecCCCCcCCCCcccccc
Q 007979          252 LCELYNLEKLDISYCINLKALPQGIGKLINMKHLLNERTDSLGHMPAGIARLPSL-RTLDEFHVSGGEGVDGRKGCRLES  330 (582)
Q Consensus       252 i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~i~~l~~L-~~L~~~~~~~~~~~~~~~~~~~~~  330 (582)
                      +..+.+|+++++++|.....+|..++++++|+++++++|.....+|..+..+..+ +.+....+.    ..+..+..+  
T Consensus       121 ~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~----l~~~~~~~~--  194 (313)
T d1ogqa_         121 LSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR----LTGKIPPTF--  194 (313)
T ss_dssp             GGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSE----EEEECCGGG--
T ss_pred             ccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccc----ccccccccc--
Confidence            8889999999999988777888888999999999998887777788877776665 333322111    111111111  


Q ss_pred             ccCCCccCeeeeeecCCCCChhHHHhcccCCCCCcceEEEEeeecCCCCCCccchHHHHHhhCCCCCCCcEEEEeeEeCC
Q 007979          331 LKNMELLQVCGIRRLGNVSDVDEAKRLKLDKKKYLSCLRLWFDVKESGGRRKNEHDQLLLEALQPPLNLKELFIGSYGGN  410 (582)
Q Consensus       331 l~~L~~L~~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~  410 (582)
                       ..+..+                             .+.+..+.          .....+..+..+++++.++++++.+.
T Consensus       195 -~~l~~~-----------------------------~l~l~~~~----------~~~~~~~~~~~~~~l~~l~~~~~~l~  234 (313)
T d1ogqa_         195 -ANLNLA-----------------------------FVDLSRNM----------LEGDASVLFGSDKNTQKIHLAKNSLA  234 (313)
T ss_dssp             -GGCCCS-----------------------------EEECCSSE----------EEECCGGGCCTTSCCSEEECCSSEEC
T ss_pred             -cccccc-----------------------------cccccccc----------cccccccccccccccccccccccccc
Confidence             111100                             11111000          00112234445667777777777666


Q ss_pred             CcCCchhhcCcCCcEEEEeCCCCCCcCCC-CCCCCCcceeecccccCceEeCccccCCCCCCCCCCCCCcccccCccccc
Q 007979          411 TVSPSWMMSLTNLRSLNLHLCENCEQLPP-LGKLPSLEKLYISDMKSVKRVGNEILGIESDHHDSSSSSSVIIAFPKLQS  489 (582)
Q Consensus       411 ~~~p~~~~~l~~L~~L~l~~~~~~~~l~~-l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~  489 (582)
                      .. +..+..+++|+.|++++|...+.+|. ++.+++|++|+|++|..-+.+|..                  ..+++|+.
T Consensus       235 ~~-~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~------------------~~L~~L~~  295 (313)
T d1ogqa_         235 FD-LGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG------------------GNLQRFDV  295 (313)
T ss_dssp             CB-GGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS------------------TTGGGSCG
T ss_pred             cc-ccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc------------------ccCCCCCH
Confidence            55 45566777777777777766656654 777777777777777633345531                  14566666


Q ss_pred             cccccccccc
Q 007979          490 LFIEDLPELE  499 (582)
Q Consensus       490 L~l~~~~~L~  499 (582)
                      +.+.+++.+.
T Consensus       296 l~l~~N~~l~  305 (313)
T d1ogqa_         296 SAYANNKCLC  305 (313)
T ss_dssp             GGTCSSSEEE
T ss_pred             HHhCCCcccc
Confidence            6666665443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure