Citrus Sinensis ID: 008009

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-

MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNNLELVNGNEKNSKIQTLMKKKGNGNSSGKECGNGQCVGSEEKKKGLLSIRVPVKTFLGMFSPNFGKVEVVSKKGVKDKALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEEDKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLIQNLQKFDQLMQESDQKGCDCSPSSSPPSQFDHLKALISIWEGRKAEVDGFLGNLKFARVGGMPSSIVGVTNSVNEEGENGVSSDSREETGGNSAQKVASGILSIPLSNVERLRSTLSTVSLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIKANP

cccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccEEEEEcccccccccccccccccccccHHHHccccEEEEHHHHHHHHccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHcccccccccccccc

cccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccEEEEcccccccEEEEEEEEccccccEEEcccccEEEEEcccccccEEEEEcHHHHHHccccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHcHHHcccccccccccEEEEEccccccccccccccccccccHHccccccccHEEcccccccccccccccEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHccHHHHHHHHHHccccccccccccccccEcccccccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEHHHHHHHHHccccHHHHHHHHHHHHHHccEccccccccccccHHHHHHHHHHHHHHHHccccccHHHccccc

MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADkknvnnlelvngneknSKIQTLMKkkgngnssgkecgngqcvgseekkkgllSIRVPVktflgmfspnfgkvevvskkgvkdkaldkddgsctncLQFAVTWSLLFNgfvqsfpspfkmGKKRIQKLgeedkghlsscvdgtkskvscefKRNELKGQldnackndggagkegkpVLLECFIGFVFDQLIQNLQKFDQLMQesdqkgcdcspsssppsqfDHLKALISIWEGRKAEVDGFLGnlkfarvggmpssivgvtnsvneegengvssdsreetggnsaqKVASGIlsiplsnveRLRSTLSTVSLTELIELLpqlgrtskdhpdkkklfsvQDFFRYTEAEGRRFFEeldrdgdgqvnLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLclsksgtlqKSEILASLknaglpaneENAVAMMRFLNadteesisyghfrnfmvllpsdrlqddprsIWFEAAtvvavpppveipagsVLKSALAGGLScalstslmhpvdtikanp

MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKknvnnlelvngneknskIQTLMkkkgngnssgkecgngqcvgseekkkgllSIRVPVKTflgmfspnfgkvevVSKKGVKDkaldkddgscTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLgeedkghlsscvdgtkskvSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLIQNLQKFDQLMQESDQKGCDCSPSSSPPSQFDHLKALISIWEGRKAEVDGFLGNLKFARVGGMPSSIVGVTNSVNEEGEngvssdsreetggnsaqkvaSGILSIPLSNVERLRSTLSTVSLTELIELLpqlgrtskdhpdkkklfsvqdFFRYTEAEGRRFfeeldrdgdgqvnledleiamrkrklprryAREFMrrtrshlfsksFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCAlstslmhpvdtikanp

MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKknvnnlelvngneknSKIQTLMkkkgngnssgkecgngQCVGSEEKKKGLLSIRVPVKTFLGMFSPNFGkvevvskkgvkdkALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEEDKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLIQNLQKFDQLMQESDQKGCDCspsssppsQFDHLKALISIWEGRKAEVDGFLGNLKFARVGGMPSSIVGVTNSVNEEGENGVSSDSREETGGNSAQKVASGILSIPLSNVERLRSTLSTVSLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEaatvvavpppveipaGSVLKSALAGGLSCALSTSLMHPVDTIKANP

**********FFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNNLE*****************************************GLLSIRVPVKTFLGMFSPNFGKVEVVSKKGVKDKALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPS**********************************************************KPVLLECFIGFVFDQLIQNLQKFD***********************DHLKALISIWEGRKAEVDGFLGNLKFARVGGMPSSIVGV*******************************ILSIPLSNVERLRSTLSTVSLTELIELLPQL***********KLFSVQDFFRYTEAEGRRFFEELD*****QVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGL*****NAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLM**********

*****DP*ESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNN*******************************************GLLSIRVPVKTFLGMFSPNF***********************TNCLQFAVTWSLLFNGFVQSFPSPF************************************************************LECFIGFVFDQLIQNLQKFDQ*MQ******************FDHLKALISIWEGRKAEVDGFLGNLKFARV*************************************************************************************************EGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIKA**

MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNNLELVNGNEKNSKIQTLMKKK***********NGQCVGSEEKKKGLLSIRVPVKTFLGMFSPNFGKVEVVSKKGVKDKALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEEDKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLIQNLQKFDQLM******************QFDHLKALISIWEGRKAEVDGFLGNLKFARVGGMPSSIVGVTNSVN**********************VASGILSIPLSNVERLRSTLSTVSLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIKANP

****NDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNNLELVNGNEKNSKIQTLMKKKGNGNSSGKECGNGQCVGSEEKKKGLLSIRVPVKTFLGMFSPNFGKVEVVSKKGVKDK***KDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEE****LSS*********SC********GQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLIQNLQKFDQLMQE**QKGCDCSPSSSPPSQFDHLKALISIWEGRKAEVDGFLGNLKFARVGGMP*****************************SAQKVASGILSIPLSNVERLRSTLSTVSLTELIELLPQLGR*SKD****KKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIK***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		581	2.2.26 [Sep-21-2011]
Q5XHA0		473	Calcium-binding mitochond	yes	no	0.321	0.395	0.25	5e-11
Q6NUK1		477	Calcium-binding mitochond	yes	no	0.314	0.383	0.235	2e-10
O18757		475	Calcium-binding mitochond	yes	no	0.316	0.387	0.234	2e-10
Q7ZY36		473	Calcium-binding mitochond	N/A	no	0.323	0.397	0.239	2e-10
A5PJZ1		477	Calcium-binding mitochond	no	no	0.316	0.385	0.234	3e-10
Q7T0U6		473	Calcium-binding mitochond	N/A	no	0.323	0.397	0.234	9e-10
Q19529		531	Probable calcium-binding	yes	no	0.327	0.357	0.233	2e-09
Q8BMD8		475	Calcium-binding mitochond	no	no	0.316	0.387	0.229	7e-09
Q628Z2		532	Probable calcium-binding	N/A	no	0.327	0.357	0.217	3e-07
Q66L49		477	Calcium-binding mitochond	no	no	0.314	0.383	0.213	2e-05

>sp\|Q5XHA0\|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1	Back alignment and function desciption

 Score = 70.1 bits (170), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 104/204 (50%), Gaps = 17/204 (8%)

Query: 385 RYTEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPR-RYAREFMRRTRSHLFSKSFGW 443
           RY E      F +LD + DG+V++ +L+  ++   +   + A E +             +
Sbjct: 23  RYAE-----LFHKLDVNKDGKVDIVELQEGLKAMGMAVGKGAEEKIVAAGDTNKDGHLDF 77

Query: 444 KQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNAD 503
            +F+  +E+ E  +  A+TSL  +K G ++ +EI+ SLK  G+  + E+A  +++ ++AD
Sbjct: 78  GEFIRYLEEHEKKMKIAFTSLDKNKDGKIESAEIMNSLKTLGINISLEHAEKILKSMDAD 137

Query: 504 TEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVPPPVEIP---------AGSVL 554
              ++ +  +R+  +  P+D +Q   R  +++ +TV+ +   + IP          G   
Sbjct: 138 GTLTVDWNEWRDHFLFNPADNIQQIIR--YWKHSTVLDIGDSLTIPDEFTEEEKKTGQWW 195

Query: 555 KSALAGGLSCALSTSLMHPVDTIK 578
           K  LAGG++ A+S +   P+D +K
Sbjct: 196 KQLLAGGMAGAVSRTGTAPLDRLK 219

Calcium-dependent mitochondrial solute carrier.
Xenopus tropicalis (taxid: 8364)

>sp\|Q6NUK1\|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2	Back alignment and function description

>sp\|O18757\|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1	Back alignment and function description

>sp\|Q7ZY36\|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2	Back alignment and function description

>sp\|A5PJZ1\|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1	Back alignment and function description

>sp\|Q7T0U6\|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1	Back alignment and function description

>sp\|Q19529\|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4	Back alignment and function description

>sp\|Q8BMD8\|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=2 SV=1	Back alignment and function description

>sp\|Q628Z2\|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1	Back alignment and function description

>sp\|Q66L49\|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		581
224098050		842	predicted protein [Populus trichocarpa]	0.986	0.680	0.714	0.0
255577655		843	mitochondrial carrier protein, putative	0.979	0.674	0.720	0.0
225449130		829	PREDICTED: mitochondrial substrate carri	0.969	0.679	0.690	0.0
224112957		798	predicted protein [Populus trichocarpa]	0.922	0.671	0.695	0.0
449449469		821	PREDICTED: mitochondrial substrate carri	0.953	0.674	0.690	0.0
297823387		819	mitochondrial substrate carrier family p	0.958	0.680	0.629	0.0
356533983		813	PREDICTED: mitochondrial substrate carri	0.948	0.677	0.649	0.0
356576189		811	PREDICTED: mitochondrial substrate carri	0.938	0.672	0.643	0.0
4510389		844	putative mitochondrial carrier protein [	0.955	0.657	0.617	0.0
30686563		823	mitochondrial substrate carrier family p	0.955	0.674	0.617	0.0

>gi\|224098050\|ref\|XP_002311112.1\| predicted protein [Populus trichocarpa] gi\|222850932\|gb\|EEE88479.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/595 (71%), Positives = 484/595 (81%), Gaps = 22/595 (3%)

Query: 1   MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKNVNNLELVNGNEKNS 60
           MVS NDPIESF NSIQ  ++ LSP+ELGI+KAAKDLE+C     KN +     +  + +S
Sbjct: 1   MVSTNDPIESFMNSIQVVRDALSPLELGIRKAAKDLETCW-GVSKNDHKATRDSDTDNSS 59

Query: 61  KIQTLMKKKGN---GNSSGKECGNGQCVGSEEKKKGLLSIRVPVKTFLGMFSPNF----- 112
           K+     KK +   GNS  + CG      SEEK+KG LSI+VPV++ L MFS N      
Sbjct: 60  KVSIFTVKKKSVSLGNSENRHCGV-----SEEKRKGFLSIKVPVRSLLRMFSMNLESGHR 114

Query: 113 --GKVEV-VSKKGVKDKALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQK 169
             G  +V VSKK +K+K    +DGSC NCL+FA+TWSLL NGFVQ+FPSPFK  KKR QK
Sbjct: 115 NGGDDKVGVSKKLLKEKETRNEDGSCVNCLRFALTWSLLVNGFVQAFPSPFKTNKKRFQK 174

Query: 170 LGEEDKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVF 229
            G+EDK +L  C +G+K+KVS E K+ ELK Q     +N    GK  K V +ECFIGF+F
Sbjct: 175 AGDEDKEYLHLCKNGSKAKVSGELKQRELKVQSVKGYQNVNEKGKTEKHVSIECFIGFLF 234

Query: 230 DQLIQNLQKFDQLMQESDQKGC--DCSPSSSPPSQFDHLKALISIWEGRKAEVDGFLGNL 287
           D LIQNLQKFDQ +QE + KGC  +CS S+  PSQFDHL A++SIWEG+K  VDGFLGNL
Sbjct: 235 DLLIQNLQKFDQSLQERNVKGCKNNCSNSTPVPSQFDHLTAIMSIWEGQKVHVDGFLGNL 294

Query: 288 KFARVGGMPSSIVGVTNSVNEEGENGVSS---DSREETGGNSAQKVASGILSIPLSNVER 344
            FARVGG+PSSIVGV++SVNEEG++GVSS   +S E+TGG+S QK+ASGILSIPLSNVER
Sbjct: 295 SFARVGGLPSSIVGVSSSVNEEGDDGVSSAPTNSTEDTGGSSPQKLASGILSIPLSNVER 354

Query: 345 LRSTLSTVSLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDG 404
           LRSTLSTVS TELIEL+ QLGR+SK++PDKKKLFSVQDFFRYTE EGRRFFEELDRDGDG
Sbjct: 355 LRSTLSTVSFTELIELVQQLGRSSKEYPDKKKLFSVQDFFRYTETEGRRFFEELDRDGDG 414

Query: 405 QVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSL 464
           QV LEDLEIA+RKRKLPR+YAREFM RTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSL
Sbjct: 415 QVTLEDLEIALRKRKLPRKYAREFMHRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSL 474

Query: 465 CLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDR 524
           CLSKSGTLQKSEILASLKN+GLPANE+NAVAMMRFLNADTEESISYGHFRNFM+LLP DR
Sbjct: 475 CLSKSGTLQKSEILASLKNSGLPANEDNAVAMMRFLNADTEESISYGHFRNFMLLLPPDR 534

Query: 525 LQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIKA 579
           LQDDPR+IWFEAATVVAV PPVEIPAGSVL+SALAGGLSCALS SLMHPVDTIK 
Sbjct: 535 LQDDPRNIWFEAATVVAVAPPVEIPAGSVLRSALAGGLSCALSCSLMHPVDTIKT 589

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255577655\|ref\|XP_002529704.1\| mitochondrial carrier protein, putative [Ricinus communis] gi\|223530806\|gb\|EEF32670.1\| mitochondrial carrier protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225449130\|ref\|XP_002277407.1\| PREDICTED: mitochondrial substrate carrier family protein C [Vitis vinifera] gi\|296086059\|emb\|CBI31500.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224112957\|ref\|XP_002316345.1\| predicted protein [Populus trichocarpa] gi\|222865385\|gb\|EEF02516.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449449469\|ref\|XP_004142487.1\| PREDICTED: mitochondrial substrate carrier family protein C-like [Cucumis sativus] gi\|449487287\|ref\|XP_004157552.1\| PREDICTED: mitochondrial substrate carrier family protein C-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297823387\|ref\|XP_002879576.1\| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi\|297325415\|gb\|EFH55835.1\| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356533983\|ref\|XP_003535537.1\| PREDICTED: mitochondrial substrate carrier family protein C-like [Glycine max]	Back alignment and taxonomy information

>gi\|356576189\|ref\|XP_003556216.1\| PREDICTED: mitochondrial substrate carrier family protein C-like [Glycine max]	Back alignment and taxonomy information

>gi\|4510389\|gb\|AAD21477.1\| putative mitochondrial carrier protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30686563\|ref\|NP_850252.1\| mitochondrial substrate carrier family protein [Arabidopsis thaliana] gi\|17380984\|gb\|AAL36304.1\| putative mitochondrial carrier protein [Arabidopsis thaliana] gi\|20466023\|gb\|AAM20346.1\| putative mitochondrial carrier protein [Arabidopsis thaliana] gi\|330254069\|gb\|AEC09163.1\| mitochondrial substrate carrier family protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		581
TAIR\|locus:2039225		823	SAMTL "S-adenosyl methionine t	0.960	0.678	0.581	9.7e-167
FB\|FBgn0052103		583	CG32103 [Drosophila melanogast	0.318	0.317	0.259	6.3e-12
UNIPROTKB\|A5PJZ1		477	SLC25A24 "Calcium-binding mito	0.314	0.383	0.227	1.9e-07
UNIPROTKB\|Q6NUK1		477	SLC25A24 "Calcium-binding mito	0.314	0.383	0.227	2.4e-07
WB\|WBGene00008924		531	F17E5.2 [Caenorhabditis elegan	0.325	0.355	0.22	1e-06
UNIPROTKB\|E1BW83		475	SLC25A24 "Uncharacterized prot	0.314	0.385	0.217	2.3e-06
UNIPROTKB\|J9NYA6		475	LOC611915 "Uncharacterized pro	0.311	0.381	0.225	3e-06
MGI\|MGI:1917160		475	Slc25a24 "solute carrier famil	0.314	0.385	0.222	3e-06
RGD\|1311982		475	Slc25a24 "solute carrier famil	0.314	0.385	0.217	8.2e-06
TAIR\|locus:2159168		478	APC1 "ATP/phosphate carrier 1"	0.361	0.439	0.213	1.1e-05

TAIR\|locus:2039225 SAMTL "S-adenosyl methionine transporter-like" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1622 (576.0 bits), Expect = 9.7e-167, P = 9.7e-167
 Identities = 341/586 (58%), Positives = 409/586 (69%)

Query:     1 MVSANDPIESFFNSIQHFKET-LSPIELGIKKAAKDLESCLVADKXXXXXXXXXXXXXXX 59
             MVS ND IE+ FNSIQ  K+  L PIELG+KKAA+D+E+C ++ +               
Sbjct:     1 MVSKNDHIETLFNSIQLVKDVVLLPIELGVKKAARDIENCWISKERDLGLVFRSSGRNRK 60

Query:    60 SKIQTLMXXXXXXXXXXXXXXXXQCVG-SEEKKKGLLSIRVPVKTFLGMFSPNFGXXXXX 118
              +I                    QCV  ++E+KKGL   ++PVK+  GMFSPN       
Sbjct:    61 KRI------VATPEFDDNATNNVQCVVVTDERKKGLSIKKIPVKSLFGMFSPNLVSEKLS 114

Query:   119 XXXXXXXXALDK-----DDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEE 173
                       DK     DD SCT+C +FA+TWSLL +GFV +FP PFK+GKKRI K+G+ 
Sbjct:   115 RGNDVVVAKKDKSLEKKDDDSCTDCFKFAMTWSLLVSGFVHAFPIPFKIGKKRIHKMGD- 173

Query:   174 DKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLI 233
             D+  L     G KSK +    R E++      C++     KEG P  +EC +GFV + L 
Sbjct:   174 DENSLRK--HGLKSKAAF-VSRKEVR------CQSVESVEKEGNPFSIECAVGFVVEMLA 224

Query:   234 QNLQKFDQLMQESDQKGCDCXXXXXXXXQFDHLKALISIWEGRKAEVDGFLGNLKFARVG 293
             QNLQK DQ +Q+S +    C               + +IWE RK +V+GFLGNL FARVG
Sbjct:   225 QNLQKLDQFIQDSSENESCCSKEASSNDS----PLIFNIWEARKLDVNGFLGNLMFARVG 280

Query:   294 GMPSSIVGVTNSVNEEG-ENGVSSDSREETGGNSAQKVASGILSIPLSNVERLRSTLSTV 352
              + S I G+T+ ++E+G E+ VS+  +EE+  +S Q +A+G+LSIPLSNVERL+STLST+
Sbjct:   281 DVASGIGGLTSHISEDGDESNVSTAGKEESAVDSPQNLATGLLSIPLSNVERLKSTLSTI 340

Query:   353 SLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLE 412
             SLTELIELLPQLGR S+DHPDKKKL SVQDFFRYTE+EGRRFFEELDRDGDG+V LEDLE
Sbjct:   341 SLTELIELLPQLGRPSRDHPDKKKLISVQDFFRYTESEGRRFFEELDRDGDGKVTLEDLE 400

Query:   413 IAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTL 472
             IAMR+RKLPRRYA+EFMRR RSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCL+KSGTL
Sbjct:   401 IAMRRRKLPRRYAKEFMRRARSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLTKSGTL 460

Query:   473 QKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSI 532
             +KSEILASL NAGLPANEENA+AMMRFL ADTEESISYGHFRNFMVLLP +RLQDDPR+I
Sbjct:   461 KKSEILASLNNAGLPANEENAIAMMRFLKADTEESISYGHFRNFMVLLPYERLQDDPRNI 520

Query:   533 WFEXXXXXXXXXXXXXXXGSVLKSALAGGLSCALSTSLMHPVDTIK 578
             WFE               G VLKSALAGGL+ ALSTSLMHP+DTIK
Sbjct:   521 WFEAATVVAVAPPVALPAGDVLKSALAGGLASALSTSLMHPIDTIK 566

GO:0005509 "calcium ion binding" evidence=IEA;ISS;IDA

GO:0005739 "mitochondrion" evidence=ISM

GO:0005743 "mitochondrial inner membrane" evidence=ISS

GO:0006810 "transport" evidence=IEA;ISS

GO:0055085 "transmembrane transport" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0009536 "plastid" evidence=IDA

FB\|FBgn0052103 CG32103 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|A5PJZ1 SLC25A24 "Calcium-binding mitochondrial carrier protein SCaMC-1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6NUK1 SLC25A24 "Calcium-binding mitochondrial carrier protein SCaMC-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

WB\|WBGene00008924 F17E5.2 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BW83 SLC25A24 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NYA6 LOC611915 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1917160 Slc25a24 "solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1311982 Slc25a24 "solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

TAIR\|locus:2159168 APC1 "ATP/phosphate carrier 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_LG_VIII000344	hypothetical protein (842 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		581
pfam00153		96	pfam00153, Mito_carr, Mitochondrial carrier protei	0.001
pfam00036		29	pfam00036, efhand, EF hand	0.003

>gnl\|CDD\|215754 pfam00153, Mito_carr, Mitochondrial carrier protein	Back alignment and domain information

 Score = 38.4 bits (90), Expect = 0.001
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 552 SVLKSALAGGLSCALSTSLMHPVDTIK 578
           S L S LAGG++ A++ ++ +P+D +K
Sbjct: 4   SFLASLLAGGIAGAIAATVTYPLDVVK 30

Length = 96

>gnl\|CDD\|200946 pfam00036, efhand, EF hand	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		581
KOG0036		463	consensus Predicted mitochondrial carrier protein	99.97
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.78
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.78
KOG0036		463	consensus Predicted mitochondrial carrier protein	99.74
PTZ00183		158	centrin; Provisional	99.71
PTZ00184		149	calmodulin; Provisional	99.68
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	99.62
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	99.52
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	99.48
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	99.46
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	99.45
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	99.34
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	99.3
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.09
PTZ00183		158	centrin; Provisional	99.04
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	99.04
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	99.0
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.96
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	98.95
PTZ00184		149	calmodulin; Provisional	98.93
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.87
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	98.85
PF08976		118	DUF1880: Domain of unknown function (DUF1880); Int	98.83
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	98.82
PLN02964		644	phosphatidylserine decarboxylase	98.74
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.73
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	98.7
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.63
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.59
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.58
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	98.57
KOG0038		189	consensus Ca2+-binding kinase interacting protein	98.57
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.56
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.56
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.55
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	98.53
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	98.52
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.51
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	98.51
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.47
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.45
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.44
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.39
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	98.34
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.31
PLN02964		644	phosphatidylserine decarboxylase	98.27
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.27
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	98.2
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.2
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.2
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.15
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	98.14
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	98.13
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	98.08
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.07
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.07
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	98.06
KOG4251		362	consensus Calcium binding protein [General functio	97.97
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	97.96
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	97.94
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	97.91
PF14658		66	EF-hand_9: EF-hand domain	97.84
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	97.83
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	97.62
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	97.58
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	97.56
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	97.55
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.53
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	97.5
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.47
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	97.41
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	97.39
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	97.36
KOG4666		412	consensus Predicted phosphate acyltransferase, con	97.35
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.26
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.26
KOG0752		320	consensus Mitochondrial solute carrier protein [En	97.24
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.16
PF14658		66	EF-hand_9: EF-hand domain	97.04
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	97.04
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	96.96
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	96.94
KOG0169		746	consensus Phosphoinositide-specific phospholipase	96.66
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	96.61
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.57
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.5
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	96.49
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	96.38
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	96.34
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	96.22
PF00153		95	Mito_carr: Mitochondrial carrier protein; InterPro	95.95
KOG0038		189	consensus Ca2+-binding kinase interacting protein	95.92
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	95.82
KOG0752		320	consensus Mitochondrial solute carrier protein [En	95.72
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	95.67
KOG4251		362	consensus Calcium binding protein [General functio	95.65
KOG4065		144	consensus Uncharacterized conserved protein [Funct	95.49
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	95.43
PTZ00168		259	mitochondrial carrier protein; Provisional	95.18
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	95.0
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	94.98
KOG0750		304	consensus Mitochondrial solute carrier protein [En	94.9
KOG0768		323	consensus Mitochondrial carrier protein PET8 [Ener	94.87
KOG0761		361	consensus Mitochondrial carrier protein CGI-69 [En	94.64
KOG0760		302	consensus Mitochondrial carrier protein MRS3/4 [En	94.46
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	94.42
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	94.4
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	94.18
PTZ00168		259	mitochondrial carrier protein; Provisional	93.59
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	93.08
KOG0770		353	consensus Predicted mitochondrial carrier protein	93.0
KOG0762		311	consensus Mitochondrial carrier protein [Energy pr	92.98
PTZ00169		300	ADP/ATP transporter on adenylate translocase; Prov	92.9
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	92.86
KOG4666		412	consensus Predicted phosphate acyltransferase, con	92.38
KOG0770		353	consensus Predicted mitochondrial carrier protein	91.28
PTZ00169		300	ADP/ATP transporter on adenylate translocase; Prov	90.82
KOG0756		299	consensus Mitochondrial tricarboxylate/dicarboxyla	90.79
PF05042		174	Caleosin: Caleosin related protein; InterPro: IPR0	89.9
KOG0035		890	consensus Ca2+-binding actin-bundling protein (act	89.33
KOG0758		297	consensus Mitochondrial carnitine-acylcarnitine ca	89.14
KOG0753		317	consensus Mitochondrial fatty acid anion carrier p	88.41
KOG1955		737	consensus Ral-GTPase effector RALBP1 [Intracellula	87.91
KOG0765		333	consensus Predicted mitochondrial carrier protein	87.68
KOG4065		144	consensus Uncharacterized conserved protein [Funct	87.64
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	84.08
KOG0762		311	consensus Mitochondrial carrier protein [Energy pr	83.48
PF09069		90	EF-hand_3: EF-hand; InterPro: IPR015154 Like other	82.62
KOG0749		298	consensus Mitochondrial ADP/ATP carrier proteins [	81.71
KOG1955		737	consensus Ral-GTPase effector RALBP1 [Intracellula	81.18
PLN02952		599	phosphoinositide phospholipase C	80.72
KOG3555		434	consensus Ca2+-binding proteoglycan Testican [Gene	80.68

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

Probab=99.97  E-value=2.4e-31  Score=277.61  Aligned_cols=191  Identities=25%  Similarity=0.464  Sum_probs=177.8

Q ss_pred             cHHHHHHHHHHHcCCCCCcccHHHHHHHHHHcCCC---HHHHHHHHHhhcCCCCCCCcchHHHHhhhccchhHHHHHHHH
Q 008009          387 TEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLP---RRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTS  463 (581)
Q Consensus       387 te~eLr~lF~~~D~d~dG~Is~eEf~~~L~~lgl~---~eel~~Lf~~~D~d~gDG~IsfeEF~~~L~~~ee~Lr~aFk~  463 (581)
                      .+.+++.+|+.+|.+++|+++..++...+..++++   .+.++.+|..+|.| .||+++|.||..++..++.++.++|..
T Consensus        12 r~~r~~~lf~~lD~~~~g~~d~~~l~k~~~~l~~~~~~~~~~~~l~~~~d~~-~dg~vDy~eF~~Y~~~~E~~l~~~F~~   90 (463)
T KOG0036|consen   12 RDIRIRCLFKELDSKNDGQVDLDQLEKGLEKLDHPKPNYEAAKMLFSAMDAN-RDGRVDYSEFKRYLDNKELELYRIFQS   90 (463)
T ss_pred             HHHHHHHHHHHhccCCCCceeHHHHHHHHHhcCCCCCchHHHHHHHHhcccC-cCCcccHHHHHHHHHHhHHHHHHHHhh
Confidence            35678899999999999999999999999999754   57889999999999 899999999999999999999999999


Q ss_pred             HcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCCcccHHHHHHHHHhCCCCCCccchHHHHHhcCeeecCC
Q 008009          464 LCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVP  543 (581)
Q Consensus       464 ~D~DgdG~Is~eEf~~vLk~lG~~lSeeel~~Lf~~lD~d~DGkIs~eEF~~~lll~Ps~~l~d~irs~W~e~~tvidV~  543 (581)
                      +|.++||.|+.+|+.+.|+.+|+.++++++.++++.+|+++++.|+++||++++++.|.+++.++.. +| ++..+++++
T Consensus        91 iD~~hdG~i~~~Ei~~~l~~~gi~l~de~~~k~~e~~d~~g~~~I~~~e~rd~~ll~p~s~i~di~~-~W-~h~~~idig  168 (463)
T KOG0036|consen   91 IDLEHDGKIDPNEIWRYLKDLGIQLSDEKAAKFFEHMDKDGKATIDLEEWRDHLLLYPESDLEDIYD-FW-RHVLLIDIG  168 (463)
T ss_pred             hccccCCccCHHHHHHHHHHhCCccCHHHHHHHHHHhccCCCeeeccHHHHhhhhcCChhHHHHHHH-hh-hhheEEEcc
Confidence            9999999999999999999999999999999999999999999999999999999999988866554 99 467889999


Q ss_pred             CCcccc---------CcchhhhhhhchhhhhhhccccCccccccCC
Q 008009          544 PPVEIP---------AGSVLKSALAGGLSCALSTSLMHPVDTIKAN  580 (581)
Q Consensus       544 ~~~~I~---------sg~~~k~fLAGGiAGAvSrT~taPLDrlKTR  580 (581)
                      +...+|         ++.||++|+|||+||||||||||||||||+.
T Consensus       169 E~~~iPdg~s~~e~~~g~ww~~liAGGiAGavSRTcTAPlDRLKV~  214 (463)
T KOG0036|consen  169 EDAVLPDGDSKLENDSGRWWGFLIAGGIAGAVSRTCTAPLDRLKVF  214 (463)
T ss_pred             ccccCCcchHHHHhcccchhhhhccccccccccccccCchhhhhee
Confidence            988777         4579999999999999999999999999985

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex []	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>KOG0752 consensus Mitochondrial solute carrier protein [Energy production and conversion]	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms]	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>PF00153 Mito_carr: Mitochondrial carrier protein; InterPro: IPR018108 A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [, , , , , ]	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>KOG0752 consensus Mitochondrial solute carrier protein [Energy production and conversion]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>PTZ00168 mitochondrial carrier protein; Provisional	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0750 consensus Mitochondrial solute carrier protein [Energy production and conversion]	Back alignment and domain information

>KOG0768 consensus Mitochondrial carrier protein PET8 [Energy production and conversion]	Back alignment and domain information

>KOG0761 consensus Mitochondrial carrier protein CGI-69 [Energy production and conversion]	Back alignment and domain information

>KOG0760 consensus Mitochondrial carrier protein MRS3/4 [Energy production and conversion]	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>PTZ00168 mitochondrial carrier protein; Provisional	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0770 consensus Predicted mitochondrial carrier protein [Energy production and conversion]	Back alignment and domain information

>KOG0762 consensus Mitochondrial carrier protein [Energy production and conversion]	Back alignment and domain information

>PTZ00169 ADP/ATP transporter on adenylate translocase; Provisional	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>KOG0770 consensus Predicted mitochondrial carrier protein [Energy production and conversion]	Back alignment and domain information

>PTZ00169 ADP/ATP transporter on adenylate translocase; Provisional	Back alignment and domain information

>KOG0756 consensus Mitochondrial tricarboxylate/dicarboxylate carrier proteins [Energy production and conversion]	Back alignment and domain information

>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin	Back alignment and domain information

>KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>KOG0758 consensus Mitochondrial carnitine-acylcarnitine carrier protein [Energy production and conversion]	Back alignment and domain information

>KOG0753 consensus Mitochondrial fatty acid anion carrier protein/Uncoupling protein [Energy production and conversion]	Back alignment and domain information

>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0765 consensus Predicted mitochondrial carrier protein [Energy production and conversion]	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>KOG0762 consensus Mitochondrial carrier protein [Energy production and conversion]	Back alignment and domain information

>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions	Back alignment and domain information

>KOG0749 consensus Mitochondrial ADP/ATP carrier proteins [Energy production and conversion]	Back alignment and domain information

>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN02952 phosphoinositide phospholipase C	Back alignment and domain information

>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		581
2bl0_B		145	Physarum Polycephalum Myosin Ii Regulatory Domain L		8e-04

>pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145

Back alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 33/131 (25%), Positives = 64/131 (48%), Gaps = 9/131 (6%) Query: 395 FEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQ-- 452 F+ D+D DG+V++E+L A+R L + + + L +K F F ++ + Sbjct: 11 FQIFDKDNDGKVSIEELGSALRS--LGKNPTNAELNTIKGQLNAKEFDLATFKTVYRKPI 68 Query: 453 KEPT-----ILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEES 507 K PT +L A+ +L +GT+Q++E+ L N G +M+ ++ + + Sbjct: 69 KTPTEQSKEMLDAFRALDKEGNGTIQEAELRQLLLNLGDALTSSEVEELMKEVSVSGDGA 128 Query: 508 ISYGHFRNFMV 518 I+Y F + +V Sbjct: 129 INYESFVDMLV 139

PyMOL of 2bl0

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		581
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	1e-07
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	7e-07
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	1e-06
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	2e-06
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	3e-06
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	1e-05
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	6e-05
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	1e-04
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	2e-04
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	2e-04
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	3e-04
1y1x_A		191	Leishmania major homolog of programmed cell death	4e-04
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	5e-04
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	6e-04

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165	Back alignment and structure

 Score = 50.8 bits (122), Expect = 1e-07
 Identities = 19/135 (14%), Positives = 48/135 (35%), Gaps = 10/135 (7%)

Query: 392 RRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYAREFMRRTRS--HLF----SKSFGWKQ 445
             +F  +    DG+V+ E+L+  + +  +   Y+   +   R    +     +   G+  
Sbjct: 3   YTYFSAV-AGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNA 61

Query: 446 FLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTE 505
           F  L           + ++    SGT++  E+  ++   G   + +    +++       
Sbjct: 62  FKELWAALN-AWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVK--RYSKN 118

Query: 506 ESISYGHFRNFMVLL 520
             I +  +    V L
Sbjct: 119 GRIFFDDYVACCVKL 133

PyMOL of 1k94

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		581
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.85
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.84
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.83
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.83
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.83
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.82
3fwb_A		161	Cell division control protein 31; gene gating, com	99.82
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.81
2jnf_A		158	Troponin C; stretch activated muscle contraction,	99.81
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.81
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.81
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.8
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	99.8
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	99.8
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.8
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	99.8
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.79
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	99.79
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	99.79
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	99.79
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.79
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	99.79
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.78
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	99.78
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	99.77
1y1x_A		191	Leishmania major homolog of programmed cell death	99.77
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	99.77
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.77
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	99.77
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.77
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.77
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	99.77
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	99.77
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	99.77
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	99.77
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	99.76
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	99.76
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	99.76
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	99.76
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.76
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	99.76
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	99.76
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	99.76
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	99.75
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	99.75
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.75
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	99.75
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	99.75
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	99.74
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	99.74
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	99.74
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	99.74
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	99.74
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	99.74
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	99.73
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	99.73
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	99.73
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.73
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.72
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	99.72
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	99.72
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	99.72
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	99.72
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.71
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	99.71
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	99.71
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	99.7
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	99.7
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	99.7
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	99.7
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	99.7
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	99.7
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	99.69
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	99.68
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	99.67
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	99.67
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	99.67
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	99.67
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	99.66
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	99.65
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	99.65
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	99.65
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	99.65
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	99.65
1y1x_A		191	Leishmania major homolog of programmed cell death	99.65
2hps_A		186	Coelenterazine-binding protein with bound coelent;	99.65
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	99.64
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.58
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	99.57
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	99.56
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	99.54
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.53
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	99.53
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.52
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.51
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.5
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	99.5
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	99.49
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	99.49
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	99.49
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	99.48
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	99.47
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	99.46
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.46
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	99.46
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	99.44
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	99.44
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	99.42
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	99.4
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	99.4
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	99.37
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	99.37
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	99.37
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.35
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	99.33
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	99.32
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	99.32
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	99.31
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	99.3
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	99.29
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.28
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.28
3fwb_A		161	Cell division control protein 31; gene gating, com	99.28
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	99.26
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	99.26
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.25
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	99.25
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	99.25
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.25
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	99.24
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	99.24
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	99.24
2jnf_A		158	Troponin C; stretch activated muscle contraction,	99.23
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	99.23
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.23
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	99.23
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.23
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.22
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.22
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	99.22
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	99.21
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	99.2
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	99.2
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.19
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	99.17
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	99.17
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.17
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	99.17
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	99.15
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	99.15
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.15
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.14
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	99.13
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	99.13
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	99.12
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	99.12
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	99.11
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	99.11
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	99.11
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	99.1
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	99.09
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	99.07
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	99.07
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	99.07
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	99.07
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	99.06
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	99.06
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	99.06
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.05
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	99.05
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	99.05
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	99.05
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	99.04
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	99.04
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	99.04
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	99.03
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	99.03
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.03
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	99.03
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	99.02
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.02
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	99.02
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	99.01
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.01
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	98.99
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.99
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.99
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	98.98
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	98.98
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.98
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	98.98
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	98.97
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	98.96
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	98.96
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.96
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	98.94
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	98.94
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	98.94
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	98.94
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	98.92
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	98.92
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	98.91
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	98.9
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	98.9
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	98.9
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.9
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	98.89
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.88
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	98.87
2hps_A		186	Coelenterazine-binding protein with bound coelent;	98.87
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	98.86
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.86
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	98.86
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	98.86
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.86
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	98.85
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	98.85
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	98.85
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	98.83
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	98.83
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	98.83
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.83
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.83
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.82
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.82
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.82
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	98.82
1c07_A		95	Protein (epidermal growth factor receptor pathway	98.82
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	98.81
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.81
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.81
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	98.81
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.8
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.79
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	98.78
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	98.77
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.77
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.77
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.76
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.76
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	98.75
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	98.74
1c07_A		95	Protein (epidermal growth factor receptor pathway	98.74
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.74
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.74
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.72
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.72
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	98.72
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	98.71
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.71
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.7
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	98.7
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.7
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	98.7
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.69
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	98.69
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.69
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	98.69
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.67
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.67
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	98.66
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	98.65
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.64
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.63
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	98.62
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.61
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.59
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	98.58
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	98.58
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.58
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.58
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.57
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	98.57
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	98.56
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.56
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.56
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.55
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.55
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.54
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.51
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	98.51
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	98.5
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	98.5
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.49
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	98.49
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	98.49
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.47
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.47
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.46
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.46
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.46
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.45
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.44
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.41
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.4
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.4
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.4
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	98.36
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.34
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	98.34
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.32
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.26
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.23
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.17
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.14
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.06
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	97.93
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	97.71
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	97.71
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	97.54
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	97.35
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	97.26
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	97.21
1nub_A		229	Basement membrane protein BM-40; extracellular mod	96.93
1nub_A		229	Basement membrane protein BM-40; extracellular mod	96.44
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	96.28
2lck_A		303	Mitochondrial uncoupling protein 2; membrane prote	93.57
1okc_A		297	ADP, ATP carrier protein heart isoform T1; mitocho	93.27
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	93.14
2lck_A		303	Mitochondrial uncoupling protein 2; membrane prote	92.45
1okc_A		297	ADP, ATP carrier protein heart isoform T1; mitocho	92.06
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	89.94
1pul_A		125	Hypothetical protein C32E8.3 in chromosome I; alph	83.73
1wlm_A		151	Protein CGI-38; structural genomics, NPPSFA, natio	81.26

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

Probab=99.85  E-value=6.9e-21  Score=173.49  Aligned_cols=130  Identities=18%  Similarity=0.315  Sum_probs=121.1

Q ss_pred             HHHHHHHHHHHcCCCCCcccHHHHHHHHHHcC--CCHHHHHHHHHhhcCCCCCCCcchHHHHhhhccc------hhHHHH
Q 008009          388 EAEGRRFFEELDRDGDGQVNLEDLEIAMRKRK--LPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQK------EPTILR  459 (581)
Q Consensus       388 e~eLr~lF~~~D~d~dG~Is~eEf~~~L~~lg--l~~eel~~Lf~~~D~d~gDG~IsfeEF~~~L~~~------ee~Lr~  459 (581)
                      .++++++|..+|.|++|.|+.+||..+++.++  ++..++..++..+|.+ ++|.|+|.||...+...      ++.++.
T Consensus         9 i~el~~~F~~~D~d~~G~I~~~El~~~l~~~~~~~~~~~~~~~~~~~d~~-~~g~i~~~ef~~~~~~~~~~~~~~~~l~~   87 (148)
T 2lmt_A            9 IAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENN-NNGQLNFTEFCGIMAKQMRETDTEEEMRE   87 (148)
T ss_dssp             HHHHHHHHHHHHCSSCCEEEGGGHHHHHHHHTCCCCHHHHHHHHHHHHTT-STTEEEHHHHHHHHHHTTTTTTTHHHHHH
T ss_pred             HHHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCchHHHHHHHHHhcccC-CCCcccHHHHHHHHHHHhcccCcHHHHHH
Confidence            35788999999999999999999999999987  5678899999999999 89999999999877643      567999


Q ss_pred             HHHHHcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCCcccHHHHHHHHH
Q 008009          460 AYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMV  518 (581)
Q Consensus       460 aFk~~D~DgdG~Is~eEf~~vLk~lG~~lSeeel~~Lf~~lD~d~DGkIs~eEF~~~ll  518 (581)
                      +|+.||.|++|+|+.+||+.+|..+|.+++++++..+++.+|.|+||.|+|+||+++|.
T Consensus        88 aF~~~D~d~~G~I~~~El~~~l~~~g~~~~~~e~~~l~~~~D~d~dG~I~~~EF~~~m~  146 (148)
T 2lmt_A           88 AFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMIS  146 (148)
T ss_dssp             HHHHHHSSCSSEECHHHHHHHHHHHTCCCCHHHHHHHHHHHCCSCCSSEEHHHHHHHHT
T ss_pred             HHHHHCCCCcCcCcHHHHHHHHHHcCccccHHHHHHHHHHhCCCCCCeEeHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999875

PyMOL of 2lmt

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus}	Back alignment and structure

>1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A*	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus}	Back alignment and structure

>1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A*	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11	Back alignment and structure

>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		581
d1ggwa_		140	a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo	2e-07
d2obha1		141	a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien	7e-07
d1y1xa_		182	a.39.1.8 (A:) Programmed cell death 6 protein-like	3e-06
d1w7jb1		139	a.39.1.5 (B:11-149) Myosin Essential Chain {Human	7e-06
d1m45a_		146	a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye	1e-05
d1s6ia_		182	a.39.1.5 (A:) Calcium-dependent protein kinase sk5	1e-05
d1topa_		162	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	1e-05
d1dtla_		156	a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus)	3e-05
d1okca_		292	f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos ta	7e-05
d1uhka1		187	a.39.1.5 (A:3-189) Calcium-regulated photoprotein	9e-05
d1jfja_		134	a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly	9e-05
d1qv0a_		189	a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr	1e-04
d1lkja_		146	a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom	1e-04
d1exra_		146	a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr	3e-04
d1wdcb_		142	a.39.1.5 (B:) Myosin Essential Chain {Bay scallop	4e-04
d1df0a1		186	a.39.1.8 (A:515-700) Calpain large subunit, C-term	4e-04
d1k94a_		165	a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta	6e-04
d1hqva_		181	a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous	0.001
d2opoa1		81	a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che	0.002
d1juoa_		172	a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId:	0.002
d1snla_		99	a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo	0.002
d3c1va1		93	a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa	0.003
d2sasa_		185	a.39.1.5 (A:) Sarcoplasmic calcium-binding protein	0.004

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140	Back information, alignment and structure


class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Cdc4p
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 15/136 (11%), Positives = 42/136 (30%), Gaps = 6/136 (4%)

Query: 388 EAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKLPRRYARE-----FMRRTRSHLFSKSFG 442
           ++  ++ F   DR G G++    +   +R        A        +             
Sbjct: 4   DSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVL 63

Query: 443 WKQFLSLMEQKEPTILRAYTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNA 502
            +     M       ++ +       +G +   E+   L + G   + E    +++ +  
Sbjct: 64  NRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPV 123

Query: 503 DTEESISYGHFRNFMV 518
             +  ++Y  F   ++
Sbjct: 124 K-DGMVNYHDFVQMIL 138

PyMOL of d1ggwa_

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156	Back information, alignment and structure

>d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]} Length = 292	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		581
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.81
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	99.8
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	99.8
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	99.79
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	99.78
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.78
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.78
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	99.78
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	99.77
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.77
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	99.76
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.75
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.74
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	99.74
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	99.74
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	99.7
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	99.7
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	99.7
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	99.69
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.68
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	99.68
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	99.68
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	99.67
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.67
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	99.65
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	99.64
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	99.63
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	99.63
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	99.62
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.62
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	99.61
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	99.61
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	99.6
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	99.6
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	99.59
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.55
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.55
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	99.55
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	99.55
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	99.49
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.47
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.47
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.45
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.45
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.44
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	99.41
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	99.36
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.26
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	99.26
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	99.25
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.25
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	99.23
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	99.23
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	99.21
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.2
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	99.2
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	99.19
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.16
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	99.16
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	99.13
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.13
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.12
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	99.11
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	99.11
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.11
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	99.11
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	99.1
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	99.07
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.07
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	99.07
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.07
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	99.04
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	99.03
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.01
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	99.01
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	99.01
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.01
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.99
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	98.97
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	98.96
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	98.93
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	98.92
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	98.91
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	98.91
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	98.91
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	98.9
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	98.9
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.89
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.88
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.88
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	98.87
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	98.86
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.86
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	98.85
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	98.85
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	98.85
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	98.82
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	98.81
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	98.81
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	98.79
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	98.78
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	98.77
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	98.74
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	98.72
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	98.7
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.68
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.67
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	98.66
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.66
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	98.63
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.62
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	98.61
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	98.61
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.59
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.59
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.57
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.57
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	98.55
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	98.54
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.54
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.54
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.51
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.44
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	98.43
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.41
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.4
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.39
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.38
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.36
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.35
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	98.31
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.27
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.26
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.26
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.26
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	98.25
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.25
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.23
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.22
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.18
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.12
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.04
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.0
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	97.98
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	97.93
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	97.93
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	97.88
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	97.78
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	97.77
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	97.51
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	97.38
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	97.25
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	97.2
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	97.17
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	97.04
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.01
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	96.93
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	96.82
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	96.53
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	96.13
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	94.47
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	93.83
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	93.16
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	90.75
d1okca_		292	ADP,ATP carrier protein {Cow (Bos taurus), heart i	88.05
d1h8ba_		73	alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	80.83

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Ciliate (Paramecium tetraurelia) [TaxId: 5888]

Probab=99.81  E-value=1.4e-19  Score=162.25  Aligned_cols=129  Identities=24%  Similarity=0.414  Sum_probs=120.2

Q ss_pred             HHHHHHHHHHcCCCCCcccHHHHHHHHHHcC--CCHHHHHHHHHhhcCCCCCCCcchHHHHhhhccc------hhHHHHH
Q 008009          389 AEGRRFFEELDRDGDGQVNLEDLEIAMRKRK--LPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQK------EPTILRA  460 (581)
Q Consensus       389 ~eLr~lF~~~D~d~dG~Is~eEf~~~L~~lg--l~~eel~~Lf~~~D~d~gDG~IsfeEF~~~L~~~------ee~Lr~a  460 (581)
                      .+++++|..+|.+++|.|+.+||..++...+  ++...+..++..+|.+ ++|.|+|.||..++...      .+.++.+
T Consensus         9 ~~l~~~F~~~D~~~~G~Is~~e~~~~l~~~~~~~~~~~~~~~~~~~d~~-~~g~i~~~ef~~~~~~~~~~~~~~~~~~~~   87 (146)
T d1exra_           9 AEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD-GNGTIDFPEFLSLMARKMKEQDSEEELIEA   87 (146)
T ss_dssp             HHHHHHHHHHCTTCSSEECHHHHHHHHHHHTCCCCHHHHHHHHHHHCTT-CSSSEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCCCCeECHHHHHHHHHhcCCCCCHHHHHHHHHhcCCC-CCCcccHHHHHHHHHHHhhccChHHHHHHH
Confidence            4688889999999999999999999999986  5778899999999999 89999999999987543      5678999


Q ss_pred             HHHHcCCCCCcccHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCCcccHHHHHHHHH
Q 008009          461 YTSLCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMV  518 (581)
Q Consensus       461 Fk~~D~DgdG~Is~eEf~~vLk~lG~~lSeeel~~Lf~~lD~d~DGkIs~eEF~~~ll  518 (581)
                      |+.+|.|++|+|+.+||+.++..+|..++++++..+++.+|.|+||+|+|+||+++|+
T Consensus        88 F~~~D~d~~G~i~~~e~~~~l~~~~~~~~~~~~~~i~~~~D~d~dG~i~~~eF~~~l~  145 (146)
T d1exra_          88 FKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMV  145 (146)
T ss_dssp             HHHHSTTCSSCBCHHHHHHHHHHTTCCCCHHHHHHHHHHHCSSSSSSBCHHHHHHHHH
T ss_pred             HHHhCCCCCCcCCHHHHHHHHHHHhhcCCHHHHHHHHHHhCCCCCCeEeHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999999999999999885

PyMOL of d1exra_

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]}	Back information, alignment and structure

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure