Citrus Sinensis ID: 008127


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MGICLSTTKVSGSNSGSNNNNANHHRNANKEEAKRRHNHHARNDTTHKHQHQHQERAKNYQQLKTKQHQKTNSRRQTGVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL
ccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHEEHcHHccccccEEEEEEEEcccccEEEEHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEcccccccHEEEEccccccccEEEccccEEEEccccEEEcccccHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHccccccHHHcccHHHHHcccccccccccccccEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHccccccHHHHHHHHHHHcccccccEcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccEcHHHHHHHHcccccHHHHHHHHcccccccEcHHHHHHHHHcccccccccccccccccccccc
mgiclsttkvsgsnsgsnnnnanhhrnANKEEAKRRhnhharndtthkhqHQHQERAKNYQQLKTkqhqktnsrrqtgvipcgkrtdfgydkdfdrRYTIGKLlghgqfgytyvatdkangdrVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHlhglvhrdmkpenflfksakedsslkatdfglsdfikpgkkfqDIVGSAYYvapevlkrksgpesdvwsIGVITYILLcgrrpfwdktedGIFKEVlrnkpdfrrkpwpsisnSAKDFVKKLLVKDPRARLTAAQalshpwvreggdaseipiDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRdqfdaidvdkngsiSLEEMRQALAKDLPWKLKESRVLEILQAIdcntdglvDFSEFVAATLHVHqleehdsekwhLRSQAAFEkfdidrdgfitpeelrmhtglkgsidplleeadidkdgriSLSEFRRLLRTAsissrnvppspsghrnprkl
mgiclsttkvsgsnsgsnnnnanhhRNANKEEAKRRHNHHARndtthkhqhqHQERAKNYQQLktkqhqktnsrrqtgvipcgkrtdfgydkdFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVkkieknkmilpiaveDVKREVKILQAlaghenvvKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLhglvhrdmKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEvlkrksgpesdvwsiGVITYILLCGRRPFWDKTEDGIFKevlrnkpdfrrkpwpsisnsaKDFVKKLLVKDPRARLTaaqalshpwvreggdaSEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQleehdsekwHLRSQAAFEKFDIDRDGFITPEelrmhtglkgsidplleeadidkdgriSLSEFRRLLrtasissrnvppspsghrnprkl
MGICLSTTKVsgsnsgsnnnnanhhrnanKEEAKRRHNHHARNDTTHKHQHQHQERAKNYQQLKTKQHQKTNSRRQTGVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL
*****************************************************************************GVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFK********KATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSI**SAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLL*******************************************
*******************************************************************************************KDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGG******I**SVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRL************************
*********************ANHHRNAN************************************************GVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRTASIS*****************
************************************************************************************RTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRT*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGICLSTTKVSGSNSGSNNNNANHHRNANKEEAKRRHNHHARNDTTHKHQHQHQERAKNYQQLKTKQHQKTNSRRQTGVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query577 2.2.26 [Sep-21-2011]
Q7XJR9571 Calcium-dependent protein yes no 0.967 0.977 0.755 0.0
Q9FKW4523 Calcium-dependent protein no no 0.906 1.0 0.737 0.0
Q1PE17534 Calcium-dependent protein no no 0.925 1.0 0.712 0.0
Q9SCS2601 CDPK-related kinase 5 OS= no no 0.932 0.895 0.437 1e-125
P53681602 CDPK-related protein kina N/A no 0.793 0.760 0.495 1e-124
Q9FMP5528 Calcium-dependent protein no no 0.759 0.829 0.464 1e-123
Q9FX86606 CDPK-related kinase 8 OS= no no 0.876 0.834 0.451 1e-123
O49717554 Calcium-dependent protein no no 0.838 0.873 0.439 1e-122
Q3E9C0523 Calcium-dependent protein no no 0.779 0.860 0.452 1e-122
Q38870646 Calcium-dependent protein no no 0.769 0.687 0.470 1e-122
>sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=1 SV=1 Back     alignment and function desciption
 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/590 (75%), Positives = 478/590 (81%), Gaps = 32/590 (5%)

Query: 1   MGICLSTTKVSGSNSGSNNNNANHHRNANKEEAKRRHNHHARN------DTTHKHQHQHQ 54
           MG+C S+   +  +SG N ++ N H +      K R      +         H+ Q +  
Sbjct: 1   MGLCFSS---AAKSSGHNRSSRNPHPHPPLTVVKSRPPRSPCSFMAVTIQKDHRTQPRRN 57

Query: 55  ERAKNYQQLKTKQHQKT-------NSRRQTGVIPCGKRTDFGYDKDFDRRYTIGKLLGHG 107
             AK      T  H K        N RR    IP GKR DFGY KDFD RYTIGKLLGHG
Sbjct: 58  ATAKKTPTRHTPPHGKVREKVISNNGRRHGETIPYGKRVDFGYAKDFDHRYTIGKLLGHG 117

Query: 108 QFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFE 167
           QFGYTYVATDK  GDRVAVKKI+K KM +PIAVEDVKREVKILQAL GHENVV+FYNAFE
Sbjct: 118 QFGYTYVATDKKTGDRVAVKKIDKAKMTIPIAVEDVKREVKILQALTGHENVVRFYNAFE 177

Query: 168 DDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVA 227
           D N VYI MELCEGGELLDRILA               RKDSRY+E+DAAVVVRQML+VA
Sbjct: 178 DKNSVYIVMELCEGGELLDRILA---------------RKDSRYSERDAAVVVRQMLKVA 222

Query: 228 AECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEV 287
           AECHL GLVHRDMKPENFLFKS +EDS LKATDFGLSDFIKPGKKF DIVGSAYYVAPEV
Sbjct: 223 AECHLRGLVHRDMKPENFLFKSTEEDSPLKATDFGLSDFIKPGKKFHDIVGSAYYVAPEV 282

Query: 288 LKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAK 347
           LKR+SGPESDVWSIGVI+YILLCGRRPFWDKTEDGIFKEVL+NKPDFRRKPWP+ISNSAK
Sbjct: 283 LKRRSGPESDVWSIGVISYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPWPTISNSAK 342

Query: 348 DFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALR 407
           DFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVK+SRLKQFALR
Sbjct: 343 DFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKFSRLKQFALR 402

Query: 408 ALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDC 467
           ALA+TLD+EELADLRDQFDAIDVDKNG ISLEEMRQALAKD PWKLK++RV EILQAID 
Sbjct: 403 ALATTLDEEELADLRDQFDAIDVDKNGVISLEEMRQALAKDHPWKLKDARVAEILQAIDS 462

Query: 468 NTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLK 527
           NTDG VDF EFVAA LHV+QLEEHDSEKW  RS+AAFEKFDID DGFIT EELRMHTGLK
Sbjct: 463 NTDGFVDFGEFVAAALHVNQLEEHDSEKWQQRSRAAFEKFDIDGDGFITAEELRMHTGLK 522

Query: 528 GSIDPLLEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL 577
           GSI+PLLEEADID DG+ISL EFRRLLRTASI SRNV  SP G+   RK+
Sbjct: 523 GSIEPLLEEADIDNDGKISLQEFRRLLRTASIKSRNV-RSPPGYLISRKV 571




May play a role in signal transduction pathways that involve calcium as a second messenger.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 Back     alignment and function description
>sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=1 SV=1 Back     alignment and function description
>sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 Back     alignment and function description
>sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=1 SV=1 Back     alignment and function description
>sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 Back     alignment and function description
>sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 Back     alignment and function description
>sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
225431134558 PREDICTED: calcium-dependent protein kin 0.954 0.987 0.809 0.0
224134094556 calcium dependent protein kinase 18 [Pop 0.960 0.996 0.803 0.0
449434158543 PREDICTED: calcium-dependent protein kin 0.935 0.994 0.836 0.0
255561295575 calcium-dependent protein kinase, putati 0.845 0.848 0.896 0.0
224074263557 calcium dependent protein kinase 16 [Pop 0.961 0.996 0.806 0.0
395863620550 CDPK1 [Fragaria vesca] 0.901 0.945 0.833 0.0
350538611565 calcium-dependent protein kinase [Solanu 0.878 0.897 0.834 0.0
147789502534 hypothetical protein VITISV_019799 [Viti 0.920 0.994 0.787 0.0
16904224572 calcium-dependent protein kinase CPK4 [N 0.928 0.937 0.805 0.0
325683724552 calcium-dependent protein kinase [Fragar 0.956 1.0 0.798 0.0
>gi|225431134|ref|XP_002267099.1| PREDICTED: calcium-dependent protein kinase 16 [Vitis vinifera] gi|297735013|emb|CBI17375.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/584 (80%), Positives = 507/584 (86%), Gaps = 33/584 (5%)

Query: 1   MGICLSTTKVSGSNSGSNNNNANHHRNANKEEAKRRHNHHARNDTTHKHQH---QHQERA 57
           MG CLS TKV  SNS +  N A          A +       + T++K+Q    Q  +R 
Sbjct: 1   MGACLSATKVRSSNSNTTANAA----------ATKNTRPRGSSKTSNKNQQKKPQEGDRN 50

Query: 58  KNYQQLKTKQHQKT----NSRRQTGVIPCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTY 113
           ++ QQ +  Q QK     N RR TG+IPCGKRTDFGY KDFD RYTIGKLLGHGQFGYTY
Sbjct: 51  RSNQQHRNPQPQKVKDRANGRRGTGIIPCGKRTDFGYAKDFDARYTIGKLLGHGQFGYTY 110

Query: 114 VATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNYVY 173
           VATDKANGDRVAVK+IEKNKMILPIAVEDVKREVKIL+AL GHENVV+F+NAFEDD+YVY
Sbjct: 111 VATDKANGDRVAVKRIEKNKMILPIAVEDVKREVKILEALTGHENVVQFHNAFEDDSYVY 170

Query: 174 IAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLH 233
           I MELCEGGELLDRILAK               KDSRY+EKDAA VVRQML+VAAECHLH
Sbjct: 171 IVMELCEGGELLDRILAK---------------KDSRYSEKDAAKVVRQMLKVAAECHLH 215

Query: 234 GLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSG 293
           GLVHRDMKPENFLFKS KEDS LKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVL+RKSG
Sbjct: 216 GLVHRDMKPENFLFKSTKEDSPLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLRRKSG 275

Query: 294 PESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKL 353
           PESDVWSIGVITYILLCG+RPFWDKTEDGIFKEVL+NKPDFRRKPWP+ISN AKDFVKKL
Sbjct: 276 PESDVWSIGVITYILLCGKRPFWDKTEDGIFKEVLKNKPDFRRKPWPTISNGAKDFVKKL 335

Query: 354 LVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTL 413
           LVKDPRARLTAAQALSHPWVREGGDASEIPIDISVL+NMR+FVKYS LKQFALRALASTL
Sbjct: 336 LVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLSNMREFVKYSHLKQFALRALASTL 395

Query: 414 DDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVLEILQAIDCNTDGLV 473
           DDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWK+KESRVLEILQAID NTDGLV
Sbjct: 396 DDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKMKESRVLEILQAIDSNTDGLV 455

Query: 474 DFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGSIDPL 533
           DF+EFVAATLHVHQLEEHDS+KW  RSQAAF+KFD+DRDGFITPEEL++HTGL+GSIDPL
Sbjct: 456 DFTEFVAATLHVHQLEEHDSDKWRQRSQAAFDKFDVDRDGFITPEELKLHTGLRGSIDPL 515

Query: 534 LEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL 577
           LEEADIDKDGRISL+EFRRLLRTASISSR V PS SG RNPRK+
Sbjct: 516 LEEADIDKDGRISLAEFRRLLRTASISSRQV-PSSSGFRNPRKI 558




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224134094|ref|XP_002327754.1| calcium dependent protein kinase 18 [Populus trichocarpa] gi|222836839|gb|EEE75232.1| calcium dependent protein kinase 18 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449434158|ref|XP_004134863.1| PREDICTED: calcium-dependent protein kinase 28-like [Cucumis sativus] gi|449491358|ref|XP_004158870.1| PREDICTED: calcium-dependent protein kinase 28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255561295|ref|XP_002521658.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223539049|gb|EEF40645.1| calcium-dependent protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224074263|ref|XP_002304327.1| calcium dependent protein kinase 16 [Populus trichocarpa] gi|222841759|gb|EEE79306.1| calcium dependent protein kinase 16 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|395863620|gb|AFN80337.1| CDPK1 [Fragaria vesca] Back     alignment and taxonomy information
>gi|350538611|ref|NP_001234607.1| calcium-dependent protein kinase [Solanum lycopersicum] gi|241994912|gb|ACS74732.1| calcium-dependent protein kinase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|147789502|emb|CAN69589.1| hypothetical protein VITISV_019799 [Vitis vinifera] Back     alignment and taxonomy information
>gi|16904224|gb|AAL30819.1|AF435451_1 calcium-dependent protein kinase CPK4 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|325683724|gb|ADZ44603.1| calcium-dependent protein kinase [Fragaria x ananassa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
TAIR|locus:2827826571 CPK16 "AT2G17890" [Arabidopsis 0.892 0.901 0.808 1.1e-224
TAIR|locus:2156947523 CPK28 "calcium-dependent prote 0.849 0.936 0.818 2.5e-223
TAIR|locus:2177023528 CPK17 "calcium-dependent prote 0.585 0.640 0.485 3.4e-113
TAIR|locus:2075885646 CPK2 "calmodulin-domain protei 0.608 0.543 0.494 8.9e-113
TAIR|locus:2150225523 CPK34 "AT5G19360" [Arabidopsis 0.606 0.669 0.465 3e-112
TAIR|locus:2128409529 CDPK6 "calcium-dependent prote 0.585 0.638 0.485 1.3e-111
TAIR|locus:2175503610 CPK1 "calcium dependent protei 0.610 0.577 0.490 7.1e-111
TAIR|locus:2015846521 CPK33 "calcium-dependent prote 0.606 0.671 0.464 3e-110
TAIR|locus:2012232606 AT1G49580 [Arabidopsis thalian 0.873 0.831 0.453 6.1e-110
TAIR|locus:2092399541 CPK9 "calmodulin-domain protei 0.590 0.630 0.473 4.4e-109
TAIR|locus:2827826 CPK16 "AT2G17890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2169 (768.6 bits), Expect = 1.1e-224, P = 1.1e-224
 Identities = 435/538 (80%), Positives = 459/538 (85%)

Query:    47 HKHQHQHQERAKNYQQLKTKQHQKT-------NSRRQTGVIPCGKRTDFGYDKDFDRRYT 99
             H+ Q +    AK      T  H K        N RR    IP GKR DFGY KDFD RYT
Sbjct:    50 HRTQPRRNATAKKTPTRHTPPHGKVREKVISNNGRRHGETIPYGKRVDFGYAKDFDHRYT 109

Query:   100 IGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENV 159
             IGKLLGHGQFGYTYVATDK  GDRVAVKKI+K KM +PIAVEDVKREVKILQAL GHENV
Sbjct:   110 IGKLLGHGQFGYTYVATDKKTGDRVAVKKIDKAKMTIPIAVEDVKREVKILQALTGHENV 169

Query:   160 VKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVV 219
             V+FYNAFED N VYI MELCEGGELLDRILA               RKDSRY+E+DAAVV
Sbjct:   170 VRFYNAFEDKNSVYIVMELCEGGELLDRILA---------------RKDSRYSERDAAVV 214

Query:   220 VRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGS 279
             VRQML+VAAECHL GLVHRDMKPENFLFKS +EDS LKATDFGLSDFIKPGKKF DIVGS
Sbjct:   215 VRQMLKVAAECHLRGLVHRDMKPENFLFKSTEEDSPLKATDFGLSDFIKPGKKFHDIVGS 274

Query:   280 AYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRRKPW 339
             AYYVAPEVLKR+SGPESDVWSIGVI+YILLCGRRPFWDKTEDGIFKEVL+NKPDFRRKPW
Sbjct:   275 AYYVAPEVLKRRSGPESDVWSIGVISYILLCGRRPFWDKTEDGIFKEVLKNKPDFRRKPW 334

Query:   340 PSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKYS 399
             P+ISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVK+S
Sbjct:   335 PTISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLNNMRQFVKFS 394

Query:   400 RLKQFALRALASTLDDEELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPWKLKESRVL 459
             RLKQFALRALA+TLD+EELADLRDQFDAIDVDKNG ISLEEMRQALAKD PWKLK++RV 
Sbjct:   395 RLKQFALRALATTLDEEELADLRDQFDAIDVDKNGVISLEEMRQALAKDHPWKLKDARVA 454

Query:   460 EILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEE 519
             EILQAID NTDG VDF EFVAA LHV+QLEEHDSEKW  RS+AAFEKFDID DGFIT EE
Sbjct:   455 EILQAIDSNTDGFVDFGEFVAAALHVNQLEEHDSEKWQQRSRAAFEKFDIDGDGFITAEE 514

Query:   520 LRMHTGLKGSIDPLLEEADIDKDGRISLSEFRRLLRTASISSRNVPPSPSGHRNPRKL 577
             LRMHTGLKGSI+PLLEEADID DG+ISL EFRRLLRTASI SRNV  SP G+   RK+
Sbjct:   515 LRMHTGLKGSIEPLLEEADIDNDGKISLQEFRRLLRTASIKSRNVR-SPPGYLISRKV 571




GO:0004683 "calmodulin-dependent protein kinase activity" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0005886 "plasma membrane" evidence=IDA
GO:0004672 "protein kinase activity" evidence=IDA
TAIR|locus:2156947 CPK28 "calcium-dependent protein kinase 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177023 CPK17 "calcium-dependent protein kinase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075885 CPK2 "calmodulin-domain protein kinase cdpk isoform 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150225 CPK34 "AT5G19360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128409 CDPK6 "calcium-dependent protein kinase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175503 CPK1 "calcium dependent protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015846 CPK33 "calcium-dependent protein kinase 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012232 AT1G49580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092399 CPK9 "calmodulin-domain protein kinase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKW4CDPKS_ARATH2, ., 7, ., 1, 1, ., 10.73730.90641.0nono
Q1PE17CDPKI_ARATH2, ., 7, ., 1, 1, ., 10.71230.92541.0nono
Q7XJR9CDPKG_ARATH2, ., 7, ., 1, 1, ., 10.75590.96700.9772yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.979
3rd Layer2.7.110.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036780001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (558 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-93
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-79
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 9e-58
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-55
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 6e-55
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-53
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-52
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-51
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 3e-51
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-50
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 3e-49
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 8e-44
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-43
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-41
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 3e-41
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 4e-41
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 5e-41
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 9e-41
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-39
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 9e-39
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 9e-39
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-38
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 6e-38
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 8e-38
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-37
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 2e-36
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 5e-36
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-35
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-35
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-35
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 6e-35
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 2e-34
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 6e-34
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 2e-33
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 3e-33
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 3e-33
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 7e-33
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 3e-32
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-31
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-31
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 2e-30
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-30
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-30
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 4e-30
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 5e-30
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 7e-30
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 5e-29
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-28
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-28
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 1e-28
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-28
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-28
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 7e-28
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 9e-28
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-27
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 2e-27
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-27
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 3e-27
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 4e-27
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 5e-27
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 5e-27
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 6e-27
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 7e-27
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-26
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-26
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-26
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 2e-26
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-26
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 5e-26
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 5e-26
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 6e-26
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 7e-26
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 7e-26
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 8e-26
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 1e-25
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 1e-25
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-25
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-25
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 4e-25
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 6e-25
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 6e-25
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 7e-25
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-24
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-24
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 1e-24
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-24
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 2e-24
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 2e-24
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-24
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-24
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 3e-24
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 3e-24
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 4e-24
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 6e-24
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 6e-24
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 1e-23
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-23
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-23
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 2e-23
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-23
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 3e-23
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-23
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-23
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 6e-23
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 7e-23
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 8e-23
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-22
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-22
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 2e-22
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-22
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-22
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-22
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 3e-22
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-22
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 7e-22
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 1e-21
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-21
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-21
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-21
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-21
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-21
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 4e-21
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 4e-21
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 5e-21
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 5e-21
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 6e-21
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 9e-21
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-20
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 2e-20
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-20
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-20
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-20
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-20
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 4e-20
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 4e-20
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 4e-20
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 4e-20
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 5e-20
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 7e-20
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 8e-20
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 8e-20
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 9e-20
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 1e-19
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 2e-19
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-19
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-19
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-19
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-19
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 4e-19
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 5e-19
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 5e-19
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-19
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 9e-19
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-18
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-18
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 1e-18
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 3e-18
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 3e-18
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 4e-18
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 6e-18
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 6e-18
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 7e-18
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 8e-18
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 8e-18
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 1e-17
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-17
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 3e-17
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 3e-17
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 4e-17
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 4e-17
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 5e-17
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 5e-17
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 7e-17
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 8e-17
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 1e-16
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 1e-16
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 4e-16
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 5e-16
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 6e-16
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 7e-16
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-16
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 9e-16
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 9e-16
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 2e-15
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 2e-15
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 2e-15
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 2e-15
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 4e-15
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-14
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 1e-14
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-14
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-14
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 3e-14
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 3e-14
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 4e-14
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 5e-14
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 7e-14
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-13
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 3e-13
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 4e-13
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 8e-13
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-12
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-12
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 2e-12
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 2e-12
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 4e-12
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 4e-12
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 5e-12
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-12
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 5e-12
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 5e-12
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 8e-12
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 1e-11
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 1e-11
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-11
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 3e-11
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 4e-11
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 6e-11
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 6e-11
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 6e-11
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 7e-11
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 7e-11
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-10
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 1e-10
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-10
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-10
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-10
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 4e-10
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 4e-10
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 4e-10
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 6e-10
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 6e-10
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 6e-10
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 8e-10
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 8e-10
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 8e-10
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 9e-10
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-09
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 1e-09
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 1e-09
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 2e-09
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-09
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-09
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-09
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-09
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-09
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-09
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 3e-09
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 4e-09
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 4e-09
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 4e-09
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 6e-09
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 6e-09
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-08
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 1e-08
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 2e-08
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 2e-08
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-08
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-08
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 4e-08
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 9e-08
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 9e-08
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 1e-07
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 2e-07
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 3e-07
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-07
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 6e-07
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 6e-07
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 8e-07
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-06
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-06
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 3e-06
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 5e-06
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 7e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 1e-05
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 1e-05
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 3e-05
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 5e-05
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 7e-05
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 9e-05
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 1e-04
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-04
pfam10591112 pfam10591, SPARC_Ca_bdg, Secreted protein acidic a 1e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 2e-04
cd00252116 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ bi 2e-04
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 3e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 3e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 4e-04
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 4e-04
COG4248 637 COG4248, COG4248, Uncharacterized protein with pro 6e-04
pfam1340530 pfam13405, EF_hand_4, EF-hand domain 6e-04
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 8e-04
pfam1320225 pfam13202, EF_hand_3, EF hand 0.001
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 0.001
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 0.001
pfam0003629 pfam00036, efhand, EF hand 0.001
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.002
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 0.002
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 0.002
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 0.002
cd0005267 cd00052, EH, Eps15 homology domain; found in prote 0.003
COG0661517 COG0661, AarF, Predicted unusual protein kinase [G 0.003
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 0.004
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 0.004
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  285 bits (733), Expect = 3e-93
 Identities = 118/278 (42%), Positives = 159/278 (57%), Gaps = 26/278 (9%)

Query: 98  YTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHE 157
           Y I + LG G FG  Y+A DK  G  VA+K I+K K+      E + RE+KIL+ L  H 
Sbjct: 1   YEILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIK--KDRERILREIKILKKL-KHP 57

Query: 158 NVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAA 217
           N+V+ Y+ FED++ +Y+ ME CEGG+L D +                 +K  R +E +A 
Sbjct: 58  NIVRLYDVFEDEDKLYLVMEYCEGGDLFDLL-----------------KKRGRLSEDEAR 100

Query: 218 VVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIV 277
             +RQ+L      H  G+VHRD+KPEN L     ED  +K  DFGL+  + PG+K    V
Sbjct: 101 FYLRQILSALEYLHSKGIVHRDLKPENILLD---EDGHVKLADFGLARQLDPGEKLTTFV 157

Query: 278 GSAYYVAPEVLKRKS-GPESDVWSIGVITYILLCGRRPFW-DKTEDGIFKEVLRNKPDFR 335
           G+  Y+APEVL  K  G   D+WS+GVI Y LL G+ PF  D     +FK++ + KP F 
Sbjct: 158 GTPEYMAPEVLLGKGYGKAVDIWSLGVILYELLTGKPPFPGDDQLLELFKKIGKPKPPFP 217

Query: 336 RKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWV 373
              W  IS  AKD ++KLLVKDP  RLTA +AL HP+ 
Sbjct: 218 PPEWD-ISPEAKDLIRKLLVKDPEKRLTAEEALQHPFF 254


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|204523 pfam10591, SPARC_Ca_bdg, Secreted protein acidic and rich in cysteine Ca binding region Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|238155 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|226699 COG4248, COG4248, Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 577
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
KOG0586596 consensus Serine/threonine protein kinase [General 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG1151775 consensus Tousled-like protein kinase [Signal tran 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
KOG1290590 consensus Serine/threonine protein kinase [Signal 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
PLN03224507 probable serine/threonine protein kinase; Provisio 100.0
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 100.0
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 100.0
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 100.0
KOG1027903 consensus Serine/threonine protein kinase and endo 100.0
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG1167418 consensus Serine/threonine protein kinase of the C 100.0
KOG0576 829 consensus Mitogen-activated protein kinase kinase 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
KOG1152772 consensus Signal transduction serine/threonine kin 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1345378 consensus Serine/threonine kinase [Signal transduc 100.0
KOG10251177 consensus Epidermal growth factor receptor EGFR an 100.0
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.97
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.97
PLN00181 793 protein SPA1-RELATED; Provisional 99.96
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.96
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.95
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.95
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.95
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.94
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.94
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.94
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.94
PRK09188365 serine/threonine protein kinase; Provisional 99.94
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.92
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.91
PRK12274218 serine/threonine protein kinase; Provisional 99.9
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.9
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.9
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.9
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.89
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.88
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.88
PRK10345210 hypothetical protein; Provisional 99.87
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.86
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.86
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.83
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 99.82
smart00090237 RIO RIO-like kinase. 99.82
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.81
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.79
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.78
PTZ00183158 centrin; Provisional 99.78
PTZ00184149 calmodulin; Provisional 99.78
PRK14879211 serine/threonine protein kinase; Provisional 99.77
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.76
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.75
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 99.75
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.74
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.72
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 99.72
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 99.7
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.67
KOG06061205 consensus Microtubule-associated serine/threonine 99.67
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.66
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.66
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.65
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.61
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.49
KOG0036 463 consensus Predicted mitochondrial carrier protein 99.46
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.46
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.44
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 99.43
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.42
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.41
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.41
KOG1266458 consensus Protein kinase [Signal transduction mech 99.4
KOG1243 690 consensus Protein kinase [General function predict 99.31
KOG3087229 consensus Serine/threonine protein kinase [General 99.31
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 99.28
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 99.24
PLN02964 644 phosphatidylserine decarboxylase 99.23
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.23
KOG0038189 consensus Ca2+-binding kinase interacting protein 99.21
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.12
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.12
COG4248 637 Uncharacterized protein with protein kinase and he 99.12
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.11
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.1
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.1
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.07
KOG0377631 consensus Protein serine/threonine phosphatase RDG 99.04
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.03
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.97
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.96
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.94
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.94
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.93
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.92
PTZ00183158 centrin; Provisional 98.91
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.91
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.89
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.89
COG0478304 RIO-like serine/threonine protein kinase fused to 98.89
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.88
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.84
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.83
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.82
PTZ00184149 calmodulin; Provisional 98.8
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.79
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.79
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.77
cd0005267 EH Eps15 homology domain; found in proteins implic 98.77
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.77
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.76
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.76
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.73
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.71
cd0005267 EH Eps15 homology domain; found in proteins implic 98.7
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.7
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.69
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.69
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=3.4e-63  Score=477.51  Aligned_cols=273  Identities=36%  Similarity=0.627  Sum_probs=246.1

Q ss_pred             CccccccccceeeeeeecccCCeEEEEEEEcCCCCEEEEEEecccccCchh----hHHHHHHHHHHHHHhcCCCCeeEEE
Q 008127           88 FGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPI----AVEDVKREVKILQALAGHENVVKFY  163 (577)
Q Consensus        88 ~~~~~~~~~~y~~~~~lG~G~fg~V~~~~~~~~~~~vaiK~i~~~~~~~~~----~~~~~~~E~~~l~~l~~hpniv~~~  163 (577)
                      ....+.+.+.|.+.+.||+|+||.|-+|..+.||+.||||++.+.......    ....+.+|++||++| +|||||+++
T Consensus       164 ~~~pks~~d~yii~~~LGsGafg~Vkla~e~~tgk~vAiKIi~krk~~~~s~~~~~~~~v~~EieILkkL-~HP~IV~~~  242 (475)
T KOG0615|consen  164 KVPPKSFNDYYIISKTLGSGAFGLVKLAYEKKTGKQVAIKIINKRKSTGCSRAIAKTRDVQNEIEILKKL-SHPNIVRIK  242 (475)
T ss_pred             cCccchhcceeEeeeeecCCceeEEEEEEEcccCcEEEeeeeehhhcccccccccchhhhHHHHHHHHhc-CCCCEEEEe
Confidence            344566788899999999999999999999999999999999876553311    233468999999999 599999999


Q ss_pred             EEEEcCCeEEEEEeccCCCchhHHHHHHhhhhhhhhhHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCceeccCCCC
Q 008127          164 NAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPE  243 (577)
Q Consensus       164 ~~~~~~~~~~lv~e~~~~g~L~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qil~~l~~LH~~~iiHrDlKp~  243 (577)
                      ++|+..++.||||||++||+|++++..+                 +.+.+...+.+++|++.||.|||++||+||||||+
T Consensus       243 d~f~~~ds~YmVlE~v~GGeLfd~vv~n-----------------k~l~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPe  305 (475)
T KOG0615|consen  243 DFFEVPDSSYMVLEYVEGGELFDKVVAN-----------------KYLREDLGKLLFKQLLTAVKYLHSQGIIHRDIKPE  305 (475)
T ss_pred             eeeecCCceEEEEEEecCccHHHHHHhc-----------------cccccchhHHHHHHHHHHHHHHHHcCcccccCCcc
Confidence            9999999999999999999999988655                 77889999999999999999999999999999999


Q ss_pred             cEEeecCCCCCCeeEEecCCCcccCCCCCccccccCCccccchhcccCC----CCCCchhhHHHHHHHHHhCCCCCCCCC
Q 008127          244 NFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKS----GPESDVWSIGVITYILLCGRRPFWDKT  319 (577)
Q Consensus       244 NILl~~~~~~~~vkl~DFGla~~~~~~~~~~~~~gt~~y~aPE~~~~~~----~~~~DiwSlG~il~el~tg~~Pf~~~~  319 (577)
                      |||+....++..+||+|||+|+.......+.+.||||.|.|||++.++.    ..++||||||||||-+++|.+||.+..
T Consensus       306 NILl~~~~e~~llKItDFGlAK~~g~~sfm~TlCGTpsYvAPEVl~~kg~~~~~~kVDiWSlGcvLfvcLsG~pPFS~~~  385 (475)
T KOG0615|consen  306 NILLSNDAEDCLLKITDFGLAKVSGEGSFMKTLCGTPSYVAPEVLASKGVEYYPSKVDIWSLGCVLFVCLSGYPPFSEEY  385 (475)
T ss_pred             eEEeccCCcceEEEecccchhhccccceehhhhcCCccccChhheecCCeecccchheeeeccceEEEEeccCCCccccc
Confidence            9999976677899999999999998888889999999999999997542    458999999999999999999998876


Q ss_pred             hhH-HHHHHHhCCCCCCCCCCCCCCHHHHHHHHHccccCcCCCCCHHHHhcCccccccCC
Q 008127          320 EDG-IFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGD  378 (577)
Q Consensus       320 ~~~-~~~~i~~~~~~~~~~~~~~~s~~~~~li~~~l~~dP~~Rpt~~~il~hp~f~~~~~  378 (577)
                      .+. ..++|.++...+....|..+|+++.+||.+||..||++|||+.++|+||||+....
T Consensus       386 ~~~sl~eQI~~G~y~f~p~~w~~Iseea~dlI~~mL~VdP~~R~s~~eaL~hpW~~~~~~  445 (475)
T KOG0615|consen  386 TDPSLKEQILKGRYAFGPLQWDRISEEALDLINWMLVVDPENRPSADEALNHPWFKDAPC  445 (475)
T ss_pred             CCccHHHHHhcCcccccChhhhhhhHHHHHHHHHhhEeCcccCcCHHHHhcChhhhcccc
Confidence            655 89999999999988999999999999999999999999999999999999997653



>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 5e-69
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 5e-69
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 4e-67
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 4e-67
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 5e-67
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-65
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-64
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 3e-62
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 7e-54
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 1e-53
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 9e-53
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 2e-52
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-52
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-51
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-51
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 9e-51
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 3e-50
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 3e-50
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 3e-50
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 7e-50
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-47
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-44
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 1e-41
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 1e-41
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-41
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-41
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 1e-41
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 1e-41
3bhy_A283 Crystal Structure Of Human Death Associated Protein 5e-41
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 5e-41
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 7e-41
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 8e-41
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 9e-41
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 1e-40
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 1e-40
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-40
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-40
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 4e-40
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 5e-40
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 5e-40
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 6e-40
3kk8_A284 Camkii Substrate Complex A Length = 284 7e-40
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 7e-40
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-40
3kk9_A282 Camkii Substrate Complex B Length = 282 8e-40
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 8e-40
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 9e-40
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 9e-40
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 1e-39
3soa_A444 Full-Length Human Camkii Length = 444 1e-39
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 1e-39
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-39
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 1e-39
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-39
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 1e-39
3f5u_A295 Crystal Structure Of The Death Associated Protein K 1e-39
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 2e-39
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 2e-39
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 3e-39
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 3e-39
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 5e-39
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 5e-39
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-39
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-39
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 9e-39
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 1e-38
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 3e-38
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 4e-38
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 8e-38
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 5e-37
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 6e-37
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 8e-37
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-36
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 1e-36
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 6e-36
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 8e-36
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 9e-36
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 1e-35
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-35
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-35
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-35
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 5e-35
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-35
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 8e-35
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-34
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 1e-34
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 1e-34
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-34
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-34
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 4e-34
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 4e-34
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-34
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 1e-33
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 1e-33
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 2e-33
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 3e-33
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 3e-33
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 1e-32
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 1e-32
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 1e-32
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-32
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-32
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 3e-32
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-32
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 7e-32
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 3e-31
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 3e-31
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 3e-31
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-31
4fie_A423 Full-Length Human Pak4 Length = 423 3e-31
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 4e-31
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 6e-31
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 7e-31
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 8e-31
2oza_A356 Structure Of P38alpha Complex Length = 356 8e-31
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 9e-31
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 1e-30
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-30
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-30
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-30
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 2e-30
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-30
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-30
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 2e-30
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 2e-30
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-30
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 2e-30
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 2e-30
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 2e-30
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-30
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 2e-30
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-30
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-30
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 2e-30
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-30
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 3e-30
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 3e-30
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 3e-30
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 3e-30
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 3e-30
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-30
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 3e-30
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 4e-30
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 4e-30
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-30
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 4e-30
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 4e-30
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 4e-30
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-30
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 4e-30
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 4e-30
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 5e-30
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 5e-30
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 5e-30
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 5e-30
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 5e-30
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 5e-30
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 5e-30
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 6e-30
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 6e-30
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 6e-30
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-30
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 6e-30
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 7e-30
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 7e-30
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 7e-30
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 7e-30
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 7e-30
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 7e-30
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 8e-30
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 8e-30
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 8e-30
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 8e-30
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 8e-30
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 8e-30
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 9e-30
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 9e-30
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-29
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-29
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 1e-29
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-29
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-29
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-29
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-29
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-29
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-29
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-29
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-29
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-29
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-29
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 2e-29
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 2e-29
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-29
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-29
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 2e-29
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-29
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 3e-29
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-29
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 3e-29
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 3e-29
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-29
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 3e-29
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-29
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 9e-29
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-28
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 2e-28
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 4e-28
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 6e-28
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 8e-28
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-27
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-27
2aao_A166 Regulatory Apparatus Of Calcium Dependent Protein K 7e-27
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-26
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-26
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-26
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 1e-26
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 1e-26
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-26
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-26
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-26
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-26
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 4e-26
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 4e-25
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 7e-25
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 8e-25
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 8e-25
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 9e-25
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-24
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 1e-24
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-24
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-24
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-24
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 2e-24
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-24
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 4e-24
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 5e-24
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 5e-24
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 3e-23
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 3e-23
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 3e-23
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 4e-23
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 4e-23
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 5e-23
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 7e-23
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 9e-23
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-22
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-22
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 2e-22
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 2e-22
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 3e-22
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-22
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 4e-22
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-22
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 4e-22
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 6e-22
3g51_A325 Structural Diversity Of The Active Conformation Of 7e-22
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 7e-22
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 7e-22
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 8e-22
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 1e-21
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 1e-21
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 1e-21
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 1e-21
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 1e-21
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 1e-21
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 1e-21
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 1e-21
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 2e-21
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-21
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 2e-21
4ae6_A343 Structure And Function Of The Human Sperm-specific 2e-21
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 2e-21
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 2e-21
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 2e-21
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 2e-21
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-21
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-21
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 2e-21
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 2e-21
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 2e-21
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 2e-21
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 2e-21
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 2e-21
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 2e-21
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 3e-21
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 3e-21
4ae9_A343 Structure And Function Of The Human Sperm-specific 3e-21
2qcs_A350 A Complex Structure Between The Catalytic And Regul 3e-21
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 3e-21
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 3e-21
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 3e-21
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 5e-21
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-21
1smh_A350 Protein Kinase A Variant Complex With Completely Or 5e-21
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 7e-21
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 7e-21
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 7e-21
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 7e-21
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-21
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 8e-21
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 8e-21
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 8e-21
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 8e-21
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 9e-21
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 1e-20
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-20
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 1e-20
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 1e-20
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 1e-20
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 1e-20
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 1e-20
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 1e-20
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 2e-20
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 2e-20
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 2e-20
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 2e-20
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-20
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 2e-20
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-20
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 2e-20
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-20
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 3e-20
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 3e-20
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 3e-20
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 3e-20
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 3e-20
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 4e-20
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 4e-20
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 4e-20
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 4e-20
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 5e-20
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-20
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 5e-20
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-20
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 5e-20
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 5e-20
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 5e-20
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 5e-20
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 6e-20
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 6e-20
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-20
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 6e-20
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 7e-20
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 7e-20
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 7e-20
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 7e-20
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 8e-20
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 8e-20
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 8e-20
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 8e-20
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 9e-20
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 9e-20
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 9e-20
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 9e-20
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 9e-20
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-19
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-19
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-19
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-19
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-19
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-19
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 1e-19
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 1e-19
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 1e-19
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 1e-19
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 1e-19
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 1e-19
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 1e-19
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-19
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-19
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 1e-19
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 1e-19
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 1e-19
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-19
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 1e-19
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 1e-19
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-19
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 1e-19
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-19
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 1e-19
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 1e-19
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-19
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-19
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 2e-19
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-19
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-19
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-19
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-19
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 3e-19
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 3e-19
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 3e-19
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-19
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 4e-19
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 4e-19
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 4e-19
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 5e-19
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-19
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-19
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 8e-19
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 8e-19
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 9e-19
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 9e-19
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 1e-18
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 1e-18
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 1e-18
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 1e-18
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-18
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 1e-18
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 1e-18
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 1e-18
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 1e-18
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 1e-18
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 2e-18
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 2e-18
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 2e-18
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 2e-18
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 2e-18
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 2e-18
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 2e-18
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 2e-18
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 2e-18
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 2e-18
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 2e-18
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 2e-18
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 2e-18
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 2e-18
2oza_B366 Structure Of P38alpha Complex Length = 366 2e-18
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 2e-18
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-18
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 3e-18
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 3e-18
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 3e-18
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 3e-18
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 3e-18
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 3e-18
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 3e-18
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 3e-18
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 3e-18
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 4e-18
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 4e-18
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 4e-18
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 4e-18
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 4e-18
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 4e-18
4exu_A371 Mapk13, Inactive Form Length = 371 4e-18
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 4e-18
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 4e-18
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 4e-18
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 4e-18
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 4e-18
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 5e-18
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 5e-18
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 5e-18
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 5e-18
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 5e-18
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 5e-18
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 5e-18
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 5e-18
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 6e-18
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 6e-18
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 6e-18
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 6e-18
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 6e-18
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 6e-18
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 6e-18
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 6e-18
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 6e-18
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 6e-18
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 6e-18
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 6e-18
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 6e-18
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 6e-18
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 6e-18
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 6e-18
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 6e-18
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 6e-18
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 7e-18
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 7e-18
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 7e-18
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 7e-18
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 7e-18
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 7e-18
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-18
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 7e-18
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 7e-18
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 8e-18
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 8e-18
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 8e-18
3hec_A348 P38 In Complex With Imatinib Length = 348 8e-18
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 8e-18
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 8e-18
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 8e-18
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 8e-18
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 8e-18
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 8e-18
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 8e-18
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 9e-18
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 9e-18
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 9e-18
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 9e-18
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 9e-18
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 9e-18
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 1e-17
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 1e-17
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 1e-17
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 1e-17
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 1e-17
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-17
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-17
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-17
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-17
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-17
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 1e-17
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-17
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-17
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-17
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-17
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 1e-17
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-17
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 2e-17
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 2e-17
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 2e-17
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-17
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 2e-17
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 3e-17
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 3e-17
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-17
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 3e-17
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 3e-17
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 3e-17
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 3e-17
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 3e-17
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 3e-17
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 4e-17
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 4e-17
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 4e-17
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-17
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 4e-17
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 4e-17
3pm8_A197 Cad Domain Of Pff0520w, Calcium Dependent Protein K 4e-17
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 5e-17
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 5e-17
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 5e-17
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 5e-17
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 5e-17
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 5e-17
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 5e-17
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 6e-17
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 7e-17
1s6i_A188 Ca2+-Regulatory Region (Cld) From Soybean Calcium-D 7e-17
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 7e-17
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 7e-17
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 8e-17
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 8e-17
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 8e-17
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 8e-17
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 1e-16
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 1e-16
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 1e-16
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 1e-16
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 1e-16
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 2e-16
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 2e-16
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 2e-16
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 2e-16
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 2e-16
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 3e-16
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 3e-16
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 3e-16
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 3e-16
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 3e-16
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 4e-16
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 4e-16
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 4e-16
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-16
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 4e-16
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 4e-16
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 5e-16
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 5e-16
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 5e-16
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 6e-16
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 6e-16
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 6e-16
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 7e-16
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 7e-16
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 7e-16
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 1e-15
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 1e-15
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 1e-15
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 2e-15
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 2e-15
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 2e-15
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 2e-15
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 2e-15
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 2e-15
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-15
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 2e-15
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 2e-15
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 2e-15
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-15
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 3e-15
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 3e-15
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 3e-15
3a7f_A303 Human Mst3 Kinase Length = 303 3e-15
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 3e-15
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 3e-15
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 3e-15
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 4e-15
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 4e-15
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 4e-15
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-15
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 5e-15
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 6e-15
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 8e-15
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-14
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-14
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-14
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-14
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-14
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-14
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 3e-14
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 4e-14
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 5e-14
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 6e-14
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 7e-14
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-13
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 1e-13
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-13
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 1e-13
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 1e-13
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 2e-13
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 3e-13
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 4e-13
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 4e-13
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 4e-13
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 4e-13
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 4e-13
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 5e-13
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 5e-13
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-13
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-13
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 5e-13
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 5e-13
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 6e-13
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 7e-13
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 7e-13
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-13
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 8e-13
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 9e-13
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 9e-13
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 9e-13
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 9e-13
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 9e-13
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 9e-13
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 1e-12
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 1e-12
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 1e-12
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 1e-12
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 1e-12
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-12
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 1e-12
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 1e-12
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 1e-12
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 1e-12
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 1e-12
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 1e-12
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 1e-12
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 1e-12
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 1e-12
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 1e-12
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 1e-12
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 1e-12
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 1e-12
2ygg_B150 Complex Of Cambr And Cam Length = 150 1e-12
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 1e-12
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 1e-12
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 1e-12
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 1e-12
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 1e-12
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 1e-12
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 1e-12
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-12
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 2e-12
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 2e-12
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 2e-12
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 2e-12
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 2e-12
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 2e-12
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 2e-12
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 2e-12
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 2e-12
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 2e-12
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-12
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 2e-12
1up5_B148 Chicken Calmodulin Length = 148 2e-12
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 2e-12
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-12
3l19_A214 Crystal Structure Of Calcium Binding Domain Of Cpcd 3e-12
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 3e-12
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 3e-12
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-12
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 3e-12
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 3e-12
4h58_A275 Braf In Complex With Compound 3 Length = 275 3e-12
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-12
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 3e-12
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 3e-12
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 3e-12
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 3e-12
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 3e-12
2lmt_A148 Nmr Structure Of Androcam Length = 148 3e-12
3k21_A191 Crystal Structure Of Carboxy-Terminus Of Pfc0420w L 4e-12
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-12
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 4e-12
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 4e-12
2l1w_A149 The Solution Structure Of Soybean Calmodulin Isofor 5e-12
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 5e-12
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 5e-12
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 5e-12
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 5e-12
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 5e-12
1rfj_A149 Crystal Structure Of Potato Calmodulin Pcm6 Length 6e-12
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-12
2nru_A307 Crystal Structure Of Irak-4 Length = 307 7e-12
2nry_A307 Crystal Structure Of Irak-4 Length = 307 7e-12
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 8e-12
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 8e-12
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 8e-12
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 9e-12
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 9e-12
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 1e-11
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 1e-11
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 1e-11
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-11
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 1e-11
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 1e-11
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 1e-11
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 1e-11
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 1e-11
4f99_A361 Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti 1e-11
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-11
3khe_A191 Crystal Structure Of The Calcium-Loaded Calmodulin- 2e-11
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 2e-11
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-11
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-11
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-11
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-11
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-11
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-11
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-11
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 2e-11
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 2e-11
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-11
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-11
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 3e-11
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 3e-11
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 3e-11
2lhi_A176 Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam L 3e-11
1eh4_A298 Binary Complex Of Casein Kinase-1 From S. Pombe Wit 4e-11
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 4e-11
2csn_A297 Binary Complex Of Casein Kinase-1 With Cki7 Length 5e-11
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 5e-11
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-11
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 7e-11
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 8e-11
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 9e-11
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 1e-10
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 1e-10
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-10
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-10
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-10
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 1e-10
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-10
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 2e-10
3o4y_A196 Crystal Structure Of Cad Domain Of The Plasmodium V 2e-10
1lkj_A146 Nmr Structure Of Apo Calmodulin From Yeast Saccharo 2e-10
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-10
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-10
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-10
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-10
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-10
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 2e-10
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-10
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-10
3lxn_A318 Structural And Thermodynamic Characterization Of Th 2e-10
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-10
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 2e-10
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-10
3b2t_A311 Structure Of Phosphotransferase Length = 311 3e-10
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 3e-10
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 3e-10
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 3e-10
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-10
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 4e-10
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 4e-10
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 4e-10
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-10
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 4e-10
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 4e-10
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 4e-10
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 4e-10
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 6e-10
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 6e-10
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 6e-10
1xfx_O149 Crystal Structure Of Anthrax Edema Factor (Ef) In C 6e-10
1niw_A148 Crystal Structure Of Endothelial Nitric Oxide Synth 7e-10
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 7e-10
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 7e-10
4ds7_A147 Crystal Structure Of Yeast Calmodulin Bound To The 8e-10
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 8e-10
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 9e-10
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-10
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 9e-10
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 1e-09
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 1e-09
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-09
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 1e-09
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-09
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-09
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 1e-09
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 1e-09
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-09
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-09
1y6w_A148 Trapped Intermediate Of Calmodulin Length = 148 2e-09
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-09
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 3e-09
3qrx_A169 Chlamydomonas Reinhardtii Centrin Bound To Melittin 3e-09
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 3e-09
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 3e-09
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 4e-09
2lan_A167 Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc 4e-09
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 4e-09
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 4e-09
1omw_A689 Crystal Structure Of The Complex Between G Protein- 4e-09
3psc_A695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 4e-09
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 4e-09
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 4e-09
1tnw_A162 Nmr Solution Structure Of Calcium Saturated Skeleta 4e-09
2lhh_A128 Solution Structure Of Ca2+-Bound Ycam Length = 128 4e-09
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-09
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 4e-09
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 4e-09
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 5e-09
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-09
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 5e-09
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 5e-09
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 5e-09
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 6e-09
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 6e-09
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 6e-09
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 6e-09
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 7e-09
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 7e-09
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 7e-09
3ox6_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 7e-09
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 7e-09
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 7e-09
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 7e-09
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 8e-09
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 8e-09
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 8e-09
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-09
3ox5_A153 Crystal Structure Of The Calcium Sensor Calcium-Bin 8e-09
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 8e-09
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 9e-09
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 9e-09
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 9e-09
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 9e-09
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 1e-08
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-08
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 1e-08
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-08
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 1e-08
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 1e-08
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 1e-08
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 1e-08
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 1e-08
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 1e-08
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 1e-08
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 1e-08
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 1e-08
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 1e-08
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 1e-08
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 1e-08
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-08
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-08
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-08
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-08
1s6j_A87 N-Terminal Region Of The Ca2+-Saturated Calcium Reg 2e-08
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 2e-08
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-08
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 2e-08
3sv0_A483 Crystal Structure Of Casein Kinase-1 Like Protein I 2e-08
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-08
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-08
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-08
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 3e-08
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-08
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 3e-08
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 3e-08
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 3e-08
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 3e-08
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 3e-08
3mse_B180 Crystal Structure Of C-Terminal Domain Of Pf110239 4e-08
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 4e-08
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 4e-08
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 4e-08
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 5e-08
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 5e-08
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 5e-08
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 5e-08
3kf9_A149 Crystal Structure Of The SdcenSKMLCK COMPLEX Length 5e-08
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 6e-08
2eu9_A355 Crystal Structure Of Clk3 Length = 355 6e-08
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 6e-08
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 7e-08
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 7e-08
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 7e-08
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 7e-08
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 7e-08
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 8e-08
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 9e-08
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 1e-07
2obh_A143 Centrin-Xpc Peptide Length = 143 1e-07
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 1e-07
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-07
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 1e-07
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 1e-07
1fvr_A327 Tie2 Kinase Domain Length = 327 1e-07
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 1e-07
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 1e-07
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 1e-07
3a4o_X286 Lyn Kinase Domain Length = 286 1e-07
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 2e-07
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 2e-07
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-07
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-07
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 2e-07
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 2e-07
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-07
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 2e-07
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-07
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 2e-07
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 2e-07
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 2e-07
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 2e-07
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-07
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 2e-07
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 2e-07
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 2e-07
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-07
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 2e-07
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-07
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-07
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-07
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-07
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-07
1rjb_A344 Crystal Structure Of Flt3 Length = 344 2e-07
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-07
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-07
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-07
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 2e-07
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 3e-07
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 3e-07
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 3e-07
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 3e-07
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-07
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 3e-07
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 3e-07
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 3e-07
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 3e-07
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 3e-07
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 4e-07
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-07
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 5e-07
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 5e-07
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 6e-07
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 7e-07
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-07
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 9e-07
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 9e-07
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 9e-07
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 1e-06
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 1e-06
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 1e-06
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-06
2jnx_A134 Nmr Derived Solution Structure Of An Ef-Hand Calciu 2e-06
2c47_A313 Structure Of Casein Kinase 1 Gamma 2 Length = 313 3e-06
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-06
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 3e-06
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-06
2k7c_A72 Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 3e-06
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 3e-06
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 3e-06
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 4e-06
1aj4_A161 Structure Of Calcium-Saturated Cardiac Troponin C, 4e-06
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-06
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-06
1dtl_A161 Crystal Structure Of Calcium-Saturated (3ca2+) Card 4e-06
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure

Iteration: 1

Score = 258 bits (660), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 161/478 (33%), Positives = 245/478 (51%), Gaps = 43/478 (8%) Query: 97 RYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGH 156 RY K LG G +G + DK G A+K I+K+ + + EV +L+ L H Sbjct: 5 RYQRVKKLGSGAYGEVLLCKDKLTGAERAIKIIKKSSVTTTSNSGALLDEVAVLKQL-DH 63 Query: 157 ENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDA 216 N++K Y FED Y+ ME+ GGEL D I+ + +++E DA Sbjct: 64 PNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILR-----------------QKFSEVDA 106 Query: 217 AVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGKKFQDI 276 AV+++Q+L H H +VHRD+KPEN L +S D+ +K DFGLS + G K ++ Sbjct: 107 AVIMKQVLSGTTYLHKHNIVHRDLKPENLLLESKSRDALIKIVDFGLSAHFEVGGKMKER 166 Query: 277 VGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNKPDFRR 336 +G+AYY+APEVL++K + DVWS GVI YILLCG PF +T+ I K V + K F Sbjct: 167 LGTAYYIAPEVLRKKYDEKCDVWSCGVILYILLCGYPPFGGQTDQEILKRVEKGKFSFDP 226 Query: 337 KPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPID----ISVLNNM 392 W +S+ AK VK +L +P R++A +AL+HPW+ + + L NM Sbjct: 227 PDWTQVSDEAKQLVKLMLTYEPSKRISAEEALNHPWIVKFCSQKHTDVGKHALTGALGNM 286 Query: 393 RQFVKYSRLKQFALRALASTLDD-EELADLRDQFDAIDVDKNGSISLEEMRQALAKDLPW 451 ++F +L Q A+ + S L EE +L F +D + +G + +E+ + K + W Sbjct: 287 KKFQSSQKLAQAAMLFMGSKLTTLEETKELTQIFRQLDNNGDGQLDRKELIEGYRKLMQW 346 Query: 452 KLK----------ESRVLEILQAIDCNTDGLVDFSEFVAATLHVHQLEEHDSEKWHLRSQ 501 K E+ V ILQ++D + +G +++SEFV + L + R Sbjct: 347 KGDTVSDLDSSQIEAEVDHILQSVDFDRNGYIEYSEFVTVCMDKQLLLSRE------RLL 400 Query: 502 AAFEKFDIDRDGFITPEELRMHTGLKGSIDP----LLEEADIDKDGRISLSEFRRLLR 555 AAF++FD D G IT EEL G+ D +L+E D + DG + EF +++ Sbjct: 401 AAFQQFDSDGSGKITNEELGRLFGVTEVDDETWHQVLQECDKNNDGEVDFEEFVEMMQ 458
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2AAO|A Chain A, Regulatory Apparatus Of Calcium Dependent Protein Kinase From Arabidopsis Thaliana Length = 166 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3PM8|A Chain A, Cad Domain Of Pff0520w, Calcium Dependent Protein Kinase Length = 197 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|1S6I|A Chain A, Ca2+-Regulatory Region (Cld) From Soybean Calcium-Dependent Protein Kinase-Alpha (Cdpk) In The Presence Of Ca2+ And The Junction Domain (Jd) Length = 188 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2LMT|A Chain A, Nmr Structure Of Androcam Length = 148 Back     alignment and structure
>pdb|3K21|A Chain A, Crystal Structure Of Carboxy-Terminus Of Pfc0420w Length = 191 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2L1W|A Chain A, The Solution Structure Of Soybean Calmodulin Isoform 4 Complexed With The Vacuolar Calcium Atpase Bca1 Peptide Length = 149 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|1RFJ|A Chain A, Crystal Structure Of Potato Calmodulin Pcm6 Length = 149 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|4F99|A Chain A, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide Length = 361 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2LHI|A Chain A, Solution Structure Of Ca2+CNA1 PEPTIDE-Bound Ycam Length = 176 Back     alignment and structure
>pdb|1EH4|A Chain A, Binary Complex Of Casein Kinase-1 From S. Pombe With An Atp Competitive Inhibitor, Ic261 Length = 298 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|2CSN|A Chain A, Binary Complex Of Casein Kinase-1 With Cki7 Length = 297 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3O4Y|A Chain A, Crystal Structure Of Cad Domain Of The Plasmodium Vivax Cdpk, Pvx_11610 Length = 196 Back     alignment and structure
>pdb|1LKJ|A Chain A, Nmr Structure Of Apo Calmodulin From Yeast Saccharomyces Cerevisiae Length = 146 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|1XFX|O Chain O, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin In The Presence Of 10 Millimolar Exogenously Added Calcium Chloride Length = 149 Back     alignment and structure
>pdb|1NIW|A Chain A, Crystal Structure Of Endothelial Nitric Oxide Synthase Peptide Bound To Calmodulin Length = 148 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|4DS7|A Chain A, Crystal Structure Of Yeast Calmodulin Bound To The C-Terminal Fragment Of Spindle Pole Body Protein Spc110 Length = 147 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|1Y6W|A Chain A, Trapped Intermediate Of Calmodulin Length = 148 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3QRX|A Chain A, Chlamydomonas Reinhardtii Centrin Bound To Melittin Length = 169 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|2LAN|A Chain A, Nmr Structure Of Ca2+-Bound Cabp1 N-Domain With Rdc Length = 167 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|1TNW|A Chain A, Nmr Solution Structure Of Calcium Saturated Skeletal Muscle Troponin C Length = 162 Back     alignment and structure
>pdb|2LHH|A Chain A, Solution Structure Of Ca2+-Bound Ycam Length = 128 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3OX6|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3OX5|A Chain A, Crystal Structure Of The Calcium Sensor Calcium-Binding Protein 1 (Cabp1) Length = 153 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1S6J|A Chain A, N-Terminal Region Of The Ca2+-Saturated Calcium Regulatory Domain (Cld) From Soybean Calcium-Dependent Protein Kinase- Alpha (Cdpk) Length = 87 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|3MSE|B Chain B, Crystal Structure Of C-Terminal Domain Of Pf110239 Length = 180 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|3KF9|A Chain A, Crystal Structure Of The SdcenSKMLCK COMPLEX Length = 149 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2OBH|A Chain A, Centrin-Xpc Peptide Length = 143 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2JNX|A Chain A, Nmr Derived Solution Structure Of An Ef-Hand Calcium Binding Protein From Entamoeba Histolytica Length = 134 Back     alignment and structure
>pdb|2C47|A Chain A, Structure Of Casein Kinase 1 Gamma 2 Length = 313 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2K7C|A Chain A, Nmr Structure Of Mg2+-Bound Cabp1 C-Domain Length = 72 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|1AJ4|A Chain A, Structure Of Calcium-Saturated Cardiac Troponin C, Nmr, 1 Structure Length = 161 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|1DTL|A Chain A, Crystal Structure Of Calcium-Saturated (3ca2+) Cardiac Troponin C Complexed With The Calcium Sensitizer Bepridil At 2.15 A Resolution Length = 161 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 0.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 0.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 0.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 0.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 0.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-162
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-161
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-154
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-153
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-153
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 1e-152
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-150
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-148
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-147
2y0a_A326 Death-associated protein kinase 1; transferase, ca 1e-146
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-144
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-144
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-144
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-140
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-140
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-137
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-137
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 1e-136
3bhy_A283 Death-associated protein kinase 3; death associate 1e-135
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-135
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-134
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-133
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-133
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-132
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-129
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-129
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-129
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-119
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 1e-114
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 1e-103
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 7e-82
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 7e-82
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 7e-82
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-81
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-80
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-79
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 9e-79
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-78
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-77
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 9e-76
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 8e-75
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-74
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-74
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-74
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-74
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-73
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 3e-73
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 8e-73
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 8e-73
2eue_A275 Carbon catabolite derepressing protein kinase; kin 8e-72
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-71
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-71
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 7e-71
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-70
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-70
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-69
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 9e-69
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-68
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 3e-67
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 5e-67
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-66
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 5e-66
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-64
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 3e-63
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 3e-62
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 7e-61
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-58
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-58
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-56
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-56
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-54
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-53
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-53
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 8e-53
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-52
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-52
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-51
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-47
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-10
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 6e-47
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 7e-47
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-46
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-45
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 4e-45
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-44
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-44
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-44
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 3e-44
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-44
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 9e-44
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-43
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-43
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-43
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-42
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 4e-42
3aln_A327 Dual specificity mitogen-activated protein kinase; 5e-42
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 6e-42
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 6e-42
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-41
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 5e-41
3o0g_A292 Cell division protein kinase 5; kinase activator c 3e-40
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 7e-40
2dyl_A318 Dual specificity mitogen-activated protein kinase 9e-40
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-39
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 3e-39
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 5e-39
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-39
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 6e-39
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 4e-38
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-38
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 7e-38
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-37
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-37
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-37
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-37
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-37
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-37
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-37
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 3e-37
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-37
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-37
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 6e-37
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 8e-37
3niz_A311 Rhodanese family protein; structural genomics, str 1e-36
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-36
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-13
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-36
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-36
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 5e-36
2fst_X367 Mitogen-activated protein kinase 14; active mutant 7e-36
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 7e-36
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 7e-36
3rp9_A458 Mitogen-activated protein kinase; structural genom 9e-36
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-36
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 1e-35
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-35
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-35
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-35
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 6e-10
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 1e-35
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-35
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-35
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-35
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-35
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 3e-35
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 4e-35
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 1e-34
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-34
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 6e-07
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-34
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-34
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 5e-34
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-33
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 2e-33
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-33
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 7e-33
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-10
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-07
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 8e-33
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-32
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 1e-32
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-32
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 7e-11
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 1e-32
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-32
3uqc_A286 Probable conserved transmembrane protein; structur 2e-32
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-32
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-32
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-32
3fwb_A161 Cell division control protein 31; gene gating, com 4e-32
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 5e-32
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 7e-32
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-31
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-31
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-31
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 3e-31
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 4e-31
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 6e-31
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-30
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-15
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-30
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-11
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 2e-05
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-30
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 1e-09
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 3e-30
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 7e-30
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-30
1exr_A148 Calmodulin; high resolution, disorder, metal trans 1e-29
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 2e-29
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 5e-29
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-11
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 3e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 7e-29
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-28
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-28
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-28
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-09
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-08
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 5e-28
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 3e-08
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-27
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-27
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 5e-27
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 9e-27
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-08
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 4e-26
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 6e-26
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 6e-26
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 7e-26
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 8e-26
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 1e-25
1y1x_A191 Leishmania major homolog of programmed cell death 4e-25
1y1x_A191 Leishmania major homolog of programmed cell death 6e-15
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 5e-25
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-25
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-12
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-24
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-10
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-24
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-24
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-23
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-24
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-24
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 9e-07
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 3e-24
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 4e-24
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 5e-24
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 7e-24
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-23
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-23
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-23
3q4u_A301 Activin receptor type-1; structural genomics conso 3e-23
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-23
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-23
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-15
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 4e-23
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 6e-23
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 7e-23
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 8e-23
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-22
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-22
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-21
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 4e-09
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 4e-06
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 4e-22
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 5e-22
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 7e-22
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-21
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-21
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-21
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-21
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 2e-21
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 7e-10
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-21
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-21
3soc_A322 Activin receptor type-2A; structural genomics cons 2e-21
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 2e-21
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 2e-21
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 2e-21
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-21
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 4e-21
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-21
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 4e-21
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 6e-21
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 7e-21
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 8e-21
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-20
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-20
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-20
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-20
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-20
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-20
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-20
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-20
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 5e-20
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 6e-20
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 6e-20
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 9e-20
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-19
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 1e-19
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-19
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-19
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-19
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-19
2xir_A316 Vascular endothelial growth factor receptor 2; ang 2e-19
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-19
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 3e-19
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 3e-11
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 3e-19
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 4e-19
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 4e-19
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 5e-19
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-19
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 5e-19
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 6e-19
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 5e-11
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 8e-19
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-18
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 1e-18
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 7e-08
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-18
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-18
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 1e-18
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-18
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-18
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-18
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-18
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 2e-18
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 3e-07
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 3e-18
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 4e-18
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 6e-18
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 8e-11
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 8e-18
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 1e-17
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-17
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 4e-11
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-17
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 4e-17
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-11
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 5e-17
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 5e-17
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 5e-17
4aoj_A329 High affinity nerve growth factor receptor; transf 6e-17
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-16
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 2e-16
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 3e-08
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-16
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-16
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 9e-12
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-16
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-16
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 1e-12
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-16
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 3e-15
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 4e-13
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 4e-15
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 1e-14
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 1e-08
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 1e-14
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 3e-10
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 2e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 2e-14
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 4e-14
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 3e-14
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 7e-14
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 1e-13
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-13
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 3e-11
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 1e-13
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 2e-13
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-13
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 1e-09
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 7e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 8e-13
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-10
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-05
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 1e-12
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 8e-11
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 3e-04
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 1e-12
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 7e-11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-12
1avs_A90 Troponin C; muscle contraction, calcium-activated, 5e-09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-12
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 6e-10
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 7e-08
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-12
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 2e-08
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 3e-12
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 5e-09
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 3e-12
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-11
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 4e-12
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 3e-11
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 7e-12
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 1e-10
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-11
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-09
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 5e-11
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 7e-11
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 1e-10
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 2e-10
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 1e-07
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 3e-10
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 8e-09
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 5e-09
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-08
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 6e-08
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 4e-08
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 1e-06
1c07_A95 Protein (epidermal growth factor receptor pathway 4e-08
1c07_A95 Protein (epidermal growth factor receptor pathway 2e-07
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 1e-07
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 2e-07
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 1e-06
3a4u_B143 Multiple coagulation factor deficiency protein 2; 2e-07
3a4u_B143 Multiple coagulation factor deficiency protein 2; 5e-05
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-07
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 3e-07
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 3e-07
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 4e-07
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 1e-06
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 5e-07
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 1e-05
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 3e-04
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 2e-06
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 3e-06
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 6e-06
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 1e-05
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 2e-05
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 2e-05
1qjt_A99 EH1, epidermal growth factor receptor substrate su 2e-05
1qjt_A99 EH1, epidermal growth factor receptor substrate su 3e-05
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 2e-05
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 2e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 2e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 3e-05
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 4e-05
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 2e-04
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 4e-05
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 7e-05
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 8e-04
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 8e-05
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 1e-04
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 1e-04
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 1e-04
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 2e-04
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 2e-04
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 2e-04
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 2e-04
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 2e-04
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 2e-04
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 7e-04
1nub_A229 Basement membrane protein BM-40; extracellular mod 3e-04
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 3e-04
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 6e-04
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 7e-04
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
 Score =  609 bits (1572), Expect = 0.0
 Identities = 159/502 (31%), Positives = 245/502 (48%), Gaps = 49/502 (9%)

Query: 81  PCGKRTDFGYDKDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAV 140
               R +  +   F  RY I  +LG G FG      D+      AVK I K         
Sbjct: 7   HSSGRENLYFQGTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKASAK-NKDT 65

Query: 141 EDVKREVKILQALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSA 200
             + REV++L+ L  H N++K +   ED +  YI  EL  GGEL D I+ +         
Sbjct: 66  STILREVELLKKL-DHPNIMKLFEILEDSSSFYIVGELYTGGELFDEIIKR--------- 115

Query: 201 WFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATD 260
                    R++E DAA +++Q+       H H +VHRD+KPEN L +S ++D  +K  D
Sbjct: 116 --------KRFSEHDAARIIKQVFSGITYMHKHNIVHRDLKPENILLESKEKDCDIKIID 167

Query: 261 FGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTE 320
           FGLS   +   K +D +G+AYY+APEVL+     + DVWS GVI YILL G  PF+ K E
Sbjct: 168 FGLSTCFQQNTKMKDRIGTAYYIAPEVLRGTYDEKCDVWSAGVILYILLSGTPPFYGKNE 227

Query: 321 DGIFKEVLRNKPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVR----EG 376
             I K V   K  F    W +IS+ AKD ++K+L   P  R+TA Q L HPW++    E 
Sbjct: 228 YDILKRVETGKYAFDLPQWRTISDDAKDLIRKMLTFHPSLRITATQCLEHPWIQKYSSET 287

Query: 377 GDASEIPIDISVLNNMRQFVKYSRLKQFALRALASTL-DDEELADLRDQFDAIDVDKNGS 435
              S++P   S + N+RQF    +L Q AL  +AS L   +E   L + F  +D + +G 
Sbjct: 288 PTISDLPSLESAMTNIRQFQAEKKLAQAALLYMASKLTTLDETKQLTEIFRKLDTNNDGM 347

Query: 436 ISLEEMRQALAKDLPWK-------------LKESRVLEILQAIDCNTDGLVDFSEFVAAT 482
           +  +E+ +   + +  K               E ++  ++  +D +  G +++SEF+A+ 
Sbjct: 348 LDRDELVRGYHEFMRLKGVDSNSLIQNEGSTIEDQIDSLMPLLDMDGSGSIEYSEFIASA 407

Query: 483 LHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKGS------IDPLLEE 536
           +    L   +      R + AF+ FD D  G I+ +EL        S      ++ ++E+
Sbjct: 408 IDRTILLSRE------RMERAFKMFDKDGSGKISTKELFKLFSQADSSIQMEELESIIEQ 461

Query: 537 ADIDKDGRISLSEFRRLLRTAS 558
            D +KDG +  +EF  +L+   
Sbjct: 462 VDNNKDGEVDFNEFVEMLQNFV 483


>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Length = 78 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Length = 93 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Length = 92 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Length = 100 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Length = 96 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Length = 106 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Length = 104 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Length = 93 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Length = 113 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Length = 95 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Length = 95 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Length = 92 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Length = 93 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Length = 99 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Length = 90 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Length = 101 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Length = 99 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 100.0
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.95
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.94
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.93
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.92
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.91
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.91
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.9
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.9
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.9
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.89
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.89
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.88
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.88
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.88
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.88
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.87
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.87
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.87
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.87
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.87
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.86
3fwb_A161 Cell division control protein 31; gene gating, com 99.86
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.86
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.86
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.86
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.86
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.86
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.85
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.85
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.85
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.85
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.85
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.85
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.85
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.85
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.85
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.84
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.84
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.84
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.84
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.83
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.83
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.82
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.82
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.82
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.81
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.81
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.81
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.81
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.81
1y1x_A191 Leishmania major homolog of programmed cell death 99.81
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.81
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.8
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.8
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.8
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.79
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.78
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.78
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.77
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.77
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.77
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.77
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.76
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.76
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.76
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.76
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.76
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.76
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.75
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.75
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.75
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.75
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.75
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.75
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.74
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.74
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.73
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.73
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.73
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.73
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.71
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.71
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.71
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.7
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.68
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.67
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.67
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.63
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.62
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.62
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.61
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.61
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.61
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.6
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.59
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.59
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.58
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.56
1y1x_A191 Leishmania major homolog of programmed cell death 99.56
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.56
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.55
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.54
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.53
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.52
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.51
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.48
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.46
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.46
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.44
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.43
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.41
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.38
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.38
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.38
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.37
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.37
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.37
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.37
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.35
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.33
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.32
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.32
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 99.31
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.31
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.28
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 99.28
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.27
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.27
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.26
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.25
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.25
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.25
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.24
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.24
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.23
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.23
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.22
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.21
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.21
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.21
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.2
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.19
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.18
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.18
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.17
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.17
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.17
1c07_A95 Protein (epidermal growth factor receptor pathway 99.16
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.16
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 99.16
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.14
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.14
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.13
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.13
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.13
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.12
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.12
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 99.12
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.12
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.11
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.11
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.11
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.1
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.1
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.1
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.1
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.1
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.1
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.1
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.09
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.09
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.08
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.08
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.08
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.08
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.08
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.07
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.07
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.07
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 99.07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.07
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.07
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.07
1c07_A95 Protein (epidermal growth factor receptor pathway 99.06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.06
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.06
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.05
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.05
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.05
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.05
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.05
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.05
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.05
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.05
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.04
3fwb_A161 Cell division control protein 31; gene gating, com 99.04
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.04
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.03
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.03
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.03
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.03
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.03
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.03
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.02
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.02
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.02
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.02
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.02
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.01
3li6_A66 Calcium-binding protein; calcium signaling protein 99.01
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.01
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.01
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.0
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.0
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.0
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.0
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.0
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.0
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.99
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.99
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.99
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.99
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.99
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.98
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.98
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.98
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.98
3li6_A66 Calcium-binding protein; calcium signaling protein 98.98
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.98
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.97
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.97
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.96
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.96
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.96
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.95
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.95
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.95
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.95
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.95
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.95
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.93
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.93
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
Probab=100.00  E-value=4.7e-78  Score=646.96  Aligned_cols=442  Identities=35%  Similarity=0.598  Sum_probs=371.6

Q ss_pred             cccccceeeeeeecccCCeEEEEEEEcCCCCEEEEEEecccccCchhhHHHHHHHHHHHHHhcCCCCeeEEEEEEEcCCe
Q 008127           92 KDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNY  171 (577)
Q Consensus        92 ~~~~~~y~~~~~lG~G~fg~V~~~~~~~~~~~vaiK~i~~~~~~~~~~~~~~~~E~~~l~~l~~hpniv~~~~~~~~~~~  171 (577)
                      ..+.++|++++.||+|+||.||+|.++.+|+.||||++.+.... ......+.+|+.+++++ +||||+++++++.+.+.
T Consensus        18 g~~~~~y~~~~~lG~G~~g~V~~~~~~~~~~~vavK~~~~~~~~-~~~~~~~~~E~~~l~~l-~hpniv~~~~~~~~~~~   95 (486)
T 3mwu_A           18 GTFAERYNIVCMLGKGSFGEVLKCKDRITQQEYAVKVINKASAK-NKDTSTILREVELLKKL-DHPNIMKLFEILEDSSS   95 (486)
T ss_dssp             CHHHHHEEEEEEEECCSSSEEEEEEETTTCCEEEEEEEEHHHHB-CSCHHHHHHHHHHHHHC-CCTTBCCEEEEEECSSE
T ss_pred             CChhcceEEeEEEeecCCEEEEEEEECCCCCEEEEEEEeccccc-chHHHHHHHHHHHHHhC-CCCCcCeEEEEEEcCCE
Confidence            35677999999999999999999999999999999998654321 12456789999999999 59999999999999999


Q ss_pred             EEEEEeccCCCchhHHHHHHhhhhhhhhhHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCceeccCCCCcEEeecCC
Q 008127          172 VYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAK  251 (577)
Q Consensus       172 ~~lv~e~~~~g~L~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qil~~l~~LH~~~iiHrDlKp~NILl~~~~  251 (577)
                      +|+|||||++|+|.+.+...                 ..+++..++.++.||+.||.|||++||+||||||+|||++..+
T Consensus        96 ~~lv~e~~~~~~L~~~~~~~-----------------~~~~~~~~~~i~~qi~~al~~lH~~~ivH~Dlkp~Nil~~~~~  158 (486)
T 3mwu_A           96 FYIVGELYTGGELFDEIIKR-----------------KRFSEHDAARIIKQVFSGITYMHKHNIVHRDLKPENILLESKE  158 (486)
T ss_dssp             EEEEECCCCSCBHHHHHHHH-----------------SSCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCSGGGEEESSSS
T ss_pred             EEEEEEcCCCCcHHHHHHhc-----------------CCCCHHHHHHHHHHHHHHHHHHHHCCeEeccCchHHEEEecCC
Confidence            99999999999999877543                 6789999999999999999999999999999999999998655


Q ss_pred             CCCCeeEEecCCCcccCCCCCccccccCCccccchhcccCCCCCCchhhHHHHHHHHHhCCCCCCCCChhHHHHHHHhCC
Q 008127          252 EDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRKSGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRNK  331 (577)
Q Consensus       252 ~~~~vkl~DFGla~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~DiwSlG~il~el~tg~~Pf~~~~~~~~~~~i~~~~  331 (577)
                      .++.+||+|||+|............+||+.|+|||++.+.++.++|||||||++|+|++|.+||.+.+..+++..+..+.
T Consensus       159 ~~~~~kl~Dfg~a~~~~~~~~~~~~~gt~~y~aPE~~~~~~~~~~DiwslG~il~~ll~g~~pf~~~~~~~~~~~i~~~~  238 (486)
T 3mwu_A          159 KDCDIKIIDFGLSTCFQQNTKMKDRIGTAYYIAPEVLRGTYDEKCDVWSAGVILYILLSGTPPFYGKNEYDILKRVETGK  238 (486)
T ss_dssp             TTCCEEECSCSCTTTBCCC----CCTTGGGGCCGGGGGSCCCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHTC
T ss_pred             CCCCEEEEECCcCeECCCCCccCCCcCCCCCCCHHHhCCCCCchhhHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHhCC
Confidence            67789999999998877666666778999999999999989999999999999999999999999999999999999988


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHccccCcCCCCCHHHHhcCccccccCCCCCC----cccHHHHHhhHHhhhhhhhhHHHHH
Q 008127          332 PDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEI----PIDISVLNNMRQFVKYSRLKQFALR  407 (577)
Q Consensus       332 ~~~~~~~~~~~s~~~~~li~~~l~~dP~~Rpt~~~il~hp~f~~~~~~~~~----~~~~~~~~~lk~~~~~s~l~~~~l~  407 (577)
                      ..+..+.|..+|+++.+||.+||..||.+|||+.++|+||||+........    +.....+.++++|....++++..+.
T Consensus       239 ~~~~~~~~~~~s~~~~~li~~~L~~dp~~R~t~~~~l~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  318 (486)
T 3mwu_A          239 YAFDLPQWRTISDDAKDLIRKMLTFHPSLRITATQCLEHPWIQKYSSETPTISDLPSLESAMTNIRQFQAEKKLAQAALL  318 (486)
T ss_dssp             CCSCSGGGGGSCHHHHHHHHHHTCSSTTTSCCHHHHHHCHHHHHTCCCCCCGGGHHHHHHHHHHHHHHHHSCHHHHHHHH
T ss_pred             CCCCCcccCCCCHHHHHHHHHHcCCChhhCcCHHHHhcCHhhccCcccCccccccccHHHHHHHHHHHHHHHHHHHHHHH
Confidence            877777788899999999999999999999999999999999987654322    2223457788888888889988888


Q ss_pred             hhcccc-chHHHhhhccccccccCCCCCCCCHHHHHHHHHh---hCCCCcc----------HHHHHHHHHhhcCCCCcce
Q 008127          408 ALASTL-DDEELADLRDQFDAIDVDKNGSISLEEMRQALAK---DLPWKLK----------ESRVLEILQAIDCNTDGLV  473 (577)
Q Consensus       408 ~~~~~~-~~~~~~~l~~~F~~~D~d~dG~i~~~el~~~l~~---~~~~~~~----------~~~~~~~~~~~D~d~dg~i  473 (577)
                      .+...+ +++++++++++|+.+|.|+||.|+.+||..++..   .+|..++          +.+++.+|+.+|.|+||.|
T Consensus       319 ~ia~~l~~~~~~~~l~~~F~~~D~d~dG~I~~~El~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~D~d~dG~I  398 (486)
T 3mwu_A          319 YMASKLTTLDETKQLTEIFRKLDTNNDGMLDRDELVRGYHEFMRLKGVDSNSLIQNEGSTIEDQIDSLMPLLDMDGSGSI  398 (486)
T ss_dssp             HHHHHHCCHHHHHHHHHHHHHHCTTCSSSBCHHHHHHHHHHHHHHHTCCGGGHHHHTSSCHHHHHHHHHHHHCTTCCSSB
T ss_pred             HHHHHhccHHHHHHHHHHHHHhCCCCCceeeHHHHHHHHHHhhhhhcccchhcccccchhhHHHHHHHHHHhcCCCCCcC
Confidence            887666 8899999999999999999999999999766543   3466655          8899999999999999999


Q ss_pred             ehhhHHHHHhhhhhhcccccHHHHHHHHHHHhhcCCCCCCcccHHHHhhhhcCcC------cHHHHHHHhCCCCCCcccH
Q 008127          474 DFSEFVAATLHVHQLEEHDSEKWHLRSQAAFEKFDIDRDGFITPEELRMHTGLKG------SIDPLLEEADIDKDGRISL  547 (577)
Q Consensus       474 ~f~EF~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~d~~G~I~~~El~~~l~~~~------~~~~~~~~~D~d~dG~i~~  547 (577)
                      +|+||+.++.......   .   ...++.+|+.||+|+||+|+.+||+.++...|      +++++|+.+|.|+||.|+|
T Consensus       399 ~~~Ef~~~~~~~~~~~---~---~~~~~~~F~~~D~d~dG~Is~~El~~~l~~~g~~~~~~~~~~~~~~~D~d~dG~I~~  472 (486)
T 3mwu_A          399 EYSEFIASAIDRTILL---S---RERMERAFKMFDKDGSGKISTKELFKLFSQADSSIQMEELESIIEQVDNNKDGEVDF  472 (486)
T ss_dssp             CHHHHHHHHSCTTTTC---C---HHHHHHHHHHHCSSCSSSBCSSCC--------------------CCCCSSCSSSBCH
T ss_pred             cHHHHHHHHHhhhccc---h---HHHHHHHHHHhCCCCCCcCCHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCCcEeH
Confidence            9999998765432211   1   23678899999999999999999999998776      5899999999999999999


Q ss_pred             HHHHHHHhhcc
Q 008127          548 SEFRRLLRTAS  558 (577)
Q Consensus       548 ~EF~~~l~~~~  558 (577)
                      +||+.+|....
T Consensus       473 ~EF~~~~~~~~  483 (486)
T 3mwu_A          473 NEFVEMLQNFV  483 (486)
T ss_dssp             HHHHHHHHHHC
T ss_pred             HHHHHHHHHhh
Confidence            99999998753



>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 577
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-82
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 5e-80
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-78
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-78
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-77
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-76
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-74
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-73
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-73
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 9e-73
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-71
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-71
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-71
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-68
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-67
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 8e-67
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 6e-66
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 8e-66
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-64
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-60
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-60
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-60
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-59
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-58
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-58
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-57
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-57
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-56
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 3e-56
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-56
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-56
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-55
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-55
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-55
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-54
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-53
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 9e-53
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-52
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 6e-52
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-51
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-51
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-51
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-51
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 8e-51
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 8e-51
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-50
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-50
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-50
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-50
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-49
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-49
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-48
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-48
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 9e-47
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-46
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-44
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-42
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-42
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 4e-42
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-41
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-41
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-40
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 5e-21
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-20
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-19
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-19
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 1e-18
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-18
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-18
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 5e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 1e-17
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-16
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-16
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 9e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.004
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 6e-16
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 8e-09
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 8e-16
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 8e-16
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-15
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 3e-15
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-04
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 6e-15
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 8e-09
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 6e-15
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 2e-14
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 5e-14
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 6e-14
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 1e-13
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 3e-13
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 3e-13
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 1e-08
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 1e-12
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-12
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-08
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 2e-12
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-06
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 3e-12
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-10
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 4e-12
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 9e-12
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 1e-11
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-11
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 1e-11
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 5e-10
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 2e-11
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 2e-08
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-11
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 4e-11
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 5e-09
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 6e-11
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 3e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-10
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 3e-10
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 1e-10
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 1e-06
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 1e-10
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 1e-10
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 6e-10
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.001
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 4e-10
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-10
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-09
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 4e-04
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 4e-10
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-08
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 0.002
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-09
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 1e-07
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 3e-07
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-09
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-08
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.003
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 2e-09
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 2e-05
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 2e-09
d1wdcb_142 a.39.1.5 (B:) Myosin Essential Chain {Bay scallop 3e-09
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 4e-09
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 5e-09
d1alva_173 a.39.1.8 (A:) Calpain small (regulatory) subunit ( 1e-07
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 6e-09
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 9e-09
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 7e-08
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-08
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-04
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 2e-08
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 3e-08
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.002
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 5e-08
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 5e-07
d1ggwa_140 a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo 6e-08
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 9e-08
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 8e-06
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-07
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-07
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 1e-04
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 3e-07
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 2e-05
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 7e-07
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 0.002
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 1e-06
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.002
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 1e-06
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 4e-06
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.001
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 5e-06
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.004
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 1e-05
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 3e-05
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 2e-04
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-05
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 8e-05
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 1e-04
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 1e-04
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 2e-04
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 2e-04
d1sraa_151 a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR 3e-04
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-04
d1xk4c183 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sa 0.002
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 0.003
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  257 bits (658), Expect = 3e-82
 Identities = 115/313 (36%), Positives = 165/313 (52%), Gaps = 22/313 (7%)

Query: 92  KDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQ 151
           +D    Y    +LG G F    +A DK     VA+K I K  +        ++ E+ +L 
Sbjct: 5   EDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKAL--EGKEGSMENEIAVLH 62

Query: 152 ALAGHENVVKFYNAFEDDNYVYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRY 211
            +  H N+V   + +E   ++Y+ M+L  GGEL DRI                  +   Y
Sbjct: 63  KIK-HPNIVALDDIYESGGHLYLIMQLVSGGELFDRI-----------------VEKGFY 104

Query: 212 TEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAKEDSSLKATDFGLSDFIKPGK 271
           TE+DA+ ++ Q+L      H  G+VHRD+KPEN L+ S  EDS +  +DFGLS    PG 
Sbjct: 105 TERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGS 164

Query: 272 KFQDIVGSAYYVAPEVLKRKS-GPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRN 330
                 G+  YVAPEVL +K      D WSIGVI YILLCG  PF+D+ +  +F+++L+ 
Sbjct: 165 VLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKA 224

Query: 331 KPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGGDASEIPIDISVLN 390
           + +F    W  IS+SAKDF++ L+ KDP  R T  QAL HPW+  G  A +  I  SV  
Sbjct: 225 EYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA-GDTALDKNIHQSVSE 283

Query: 391 NMRQFVKYSRLKQ 403
            +++    S+ KQ
Sbjct: 284 QIKKNFAKSKWKQ 296


>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.93
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.87
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.86
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.86
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.86
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.86
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.85
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.85
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.84
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.83
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.83
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.82
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.82
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.82
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.8
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.78
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.78
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.77
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.77
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.77
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.75
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.75
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.75
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.73
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.73
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.73
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.73
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.71
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.71
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.71
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.68
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.67
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.67
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.64
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.58
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.56
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.52
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.48
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.46
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.45
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.44
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.43
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.41
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.4
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.4
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.37
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.34
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.33
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.33
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.33
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.31
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.3
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.3
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.3
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.28
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.28
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.27
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.27
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.26
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.26
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.25
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.25
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.24
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.21
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.21
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.2
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.19
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.17
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.15
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.15
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.14
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.13
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.12
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.11
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.11
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.1
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.07
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.05
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.05
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.04
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.01
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 99.01
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.0
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.99
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.98
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.98
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.96
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.95
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.94
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.94
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.94
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.94
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.93
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.93
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.93
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.92
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.9
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.9
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.89
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.89
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.85
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.84
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.81
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.79
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.79
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.79
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.79
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.77
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.77
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.75
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.74
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.74
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.73
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.72
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.7
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.69
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.69
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.65
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.64
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.64
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.64
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.56
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.5
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.49
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.42
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.29
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.29
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.26
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.24
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.18
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.18
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.13
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.12
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.06
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.06
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.05
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.98
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.97
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.96
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.95
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.8
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 97.18
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.14
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.06
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 96.13
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.1
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 93.08
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 93.03
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 90.01
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 89.87
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 89.53
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 88.96
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 88.35
d1dava_71 Cellulosome endoglucanase SS {Clostridium thermoce 86.47
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 86.2
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=2.5e-62  Score=488.26  Aligned_cols=266  Identities=40%  Similarity=0.721  Sum_probs=221.6

Q ss_pred             cccccceeeeeeecccCCeEEEEEEEcCCCCEEEEEEecccccCchhhHHHHHHHHHHHHHhcCCCCeeEEEEEEEcCCe
Q 008127           92 KDFDRRYTIGKLLGHGQFGYTYVATDKANGDRVAVKKIEKNKMILPIAVEDVKREVKILQALAGHENVVKFYNAFEDDNY  171 (577)
Q Consensus        92 ~~~~~~y~~~~~lG~G~fg~V~~~~~~~~~~~vaiK~i~~~~~~~~~~~~~~~~E~~~l~~l~~hpniv~~~~~~~~~~~  171 (577)
                      +++.++|++++.||+|+||+||+|+++.+|+.||||++.+....  .....+.+|+.+|+++ +|||||++++++.+++.
T Consensus         5 edi~d~Y~~~~~lG~G~fg~Vy~~~~~~~~~~vAvK~i~~~~~~--~~~~~~~~Ei~il~~l-~HpnIv~l~~~~~~~~~   81 (307)
T d1a06a_           5 EDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALE--GKEGSMENEIAVLHKI-KHPNIVALDDIYESGGH   81 (307)
T ss_dssp             SCGGGTEEEEEESBSGGGGGEEEEEETTTCCEEEEEEEEC------------CHHHHHHHTC-CCTTBCCEEEEEECSSE
T ss_pred             CCCccceEEEEEEeeccCeEEEEEEECCCCCEEEEEEEchHHhh--hHHHHHHHHHHHHHhC-CCCCCCcEEEEEEECCE
Confidence            45677899999999999999999999999999999999765432  2345688999999999 59999999999999999


Q ss_pred             EEEEEeccCCCchhHHHHHHhhhhhhhhhHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCceeccCCCCcEEeecCC
Q 008127          172 VYIAMELCEGGELLDRILAKMISTTLTSAWFLAIRKDSRYTEKDAAVVVRQMLRVAAECHLHGLVHRDMKPENFLFKSAK  251 (577)
Q Consensus       172 ~~lv~e~~~~g~L~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qil~~l~~LH~~~iiHrDlKp~NILl~~~~  251 (577)
                      +|||||||+||+|.+++.                 ....+++..++.++.||+.||.|||++|||||||||+|||+...+
T Consensus        82 ~~lvmE~~~gg~L~~~l~-----------------~~~~l~e~~~~~~~~qi~~al~ylH~~~iiHrDiKp~Nil~~~~~  144 (307)
T d1a06a_          82 LYLIMQLVSGGELFDRIV-----------------EKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLD  144 (307)
T ss_dssp             EEEEECCCCSCBHHHHHH-----------------TCSCCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEESSSS
T ss_pred             EEEEEeccCCCcHHHhhh-----------------cccCCCHHHHHHHHHHHHHHHHhhhhceeeeEEecccceeecccC
Confidence            999999999999998774                 346899999999999999999999999999999999999998655


Q ss_pred             CCCCeeEEecCCCcccCCCCCccccccCCccccchhcccC-CCCCCchhhHHHHHHHHHhCCCCCCCCChhHHHHHHHhC
Q 008127          252 EDSSLKATDFGLSDFIKPGKKFQDIVGSAYYVAPEVLKRK-SGPESDVWSIGVITYILLCGRRPFWDKTEDGIFKEVLRN  330 (577)
Q Consensus       252 ~~~~vkl~DFGla~~~~~~~~~~~~~gt~~y~aPE~~~~~-~~~~~DiwSlG~il~el~tg~~Pf~~~~~~~~~~~i~~~  330 (577)
                      +++.+||+|||+|+...........+||+.|+|||++.+. ++.++|||||||++|+|++|++||.+....+....+...
T Consensus       145 ~~~~vkl~DFG~a~~~~~~~~~~~~~GT~~y~APE~~~~~~~~~~~DiwSlGvilyell~g~~Pf~~~~~~~~~~~i~~~  224 (307)
T d1a06a_         145 EDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKA  224 (307)
T ss_dssp             TTCCEEECCC------------------CTTSCHHHHTTCCCCTHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHTT
T ss_pred             CCceEEEeccceeEEccCCCeeeeeeeCccccCcHHHcCCCCCcHHHhhhhhHHHHHHHhCCCCCCCCCHHHHHHHHhcc
Confidence            6789999999999987766666778999999999998765 689999999999999999999999999999999999998


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHccccCcCCCCCHHHHhcCccccccC
Q 008127          331 KPDFRRKPWPSISNSAKDFVKKLLVKDPRARLTAAQALSHPWVREGG  377 (577)
Q Consensus       331 ~~~~~~~~~~~~s~~~~~li~~~l~~dP~~Rpt~~~il~hp~f~~~~  377 (577)
                      ...++.+.++.+|+++.+||.+||.+||.+|||+.|+|+||||+...
T Consensus       225 ~~~~~~~~~~~~s~~~~~li~~~L~~dP~~R~s~~eil~hp~~~~~~  271 (307)
T d1a06a_         225 EYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT  271 (307)
T ss_dssp             CCCCCTTTTTTSCHHHHHHHHHHSCSSGGGSCCHHHHHHSTTTTSSC
T ss_pred             CCCCCCccccCCCHHHHHHHHHHccCCHhHCcCHHHHhcCHhhCCCC
Confidence            88887777888999999999999999999999999999999998643



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure