Citrus Sinensis ID: 008128

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAFSV
cccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEHHHHHHHHHccccccccccccccccccHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccEEccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHHHHcccHHHHHHHccccEEEcccccccEEccEEEcccccccccHHHHHHHHHcccEEEEccccccccHHHHHHHHHcccEEEcccccccccHHHcHHHHHHccccccc
cccccccccccccHHHHHHHHHHHHHcHEEHcccccEEEEEccccccccccccccccccccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEcccccccEEHHHHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccEEHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHcccccccHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcEcccEEEEccccccHHHHHHHHHHHHHHHcccccHHccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccEEEEccccccHHHHHHHHHHHHHHccHHHHHHHccccEEccccccccccccEEcccccHccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEccccHHccccHHHcHHHHcccccHccc
mllpvgglgmnstmdDMNLIQQAQRHHLVVRElgeeidleigpgdddpsfannplmggprepsaeehdqnkqmgmvsqlpnddqdmsktqpakrKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREygrkhrrnpygnegsrnMQMSALEEHNNSLLHKEALRLQMASkdkiiadkPIYVKALMSKTAGSIVEAalkrdpheIEFIQSVQESLHALERVIAKNSHYVNIMERLlepermivfrvpwvddrgethvnrGFRVQFsqalgpcrgglrfhpsmnLSIAKFLGFEQTLKNalspyklggaaggsdfdpkgksdnEIMRFCQSFMNEIHrylgpdkdlpseemgvgtreMGYLFGQYRRlaghfqgsftgprifwsgsslrteatgYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAygaipvsvsdakgylvdedgfdymKISFLRDIKSQQRSLRDYSKTYArskyydeakpwnercdvafpcasqneidqsdainlvNSGCRilvegsnmpctpeAVDVLKKANVLIApamaagaggvrYSIFYSTCFLDAFSV
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSqlpnddqdmsktqpakrkkkvvkrwreewadtykwayvdvkegTARIFCSVCReygrkhrrnpygnegsRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLrdiksqqrslrdysKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAFSV
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAkrkkkvvkrwreewADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAFSV
************************RHHLVVRELG***************************************************************VVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYG**************************************ASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG*****************IMRFCQSFMNEIHRYLG**********GVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAF**
********GMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANN*************************************************REEWADTYKWAYVDVKEGTARIFCSVCREYG*************************NSLLHKEALR*********************SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFL**F**
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP************QMGMVSQLP**********************REEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAFSV
*LLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPL************************PNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGS*NMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGG*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGPREPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIADKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFLDAFSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query577 2.2.26 [Sep-21-2011]
P28724449 NADP-specific glutamate d N/A no 0.649 0.835 0.488 1e-107
Q8RQP4447 NADP-specific glutamate d yes no 0.625 0.807 0.508 1e-104
P28998523 NADP-specific glutamate d N/A no 0.625 0.690 0.491 1e-103
P31026447 NADP-specific glutamate d yes no 0.625 0.807 0.5 1e-103
P95544444 NAD(P)-specific glutamate no no 0.642 0.835 0.464 1e-101
P43793449 NADP-specific glutamate d yes no 0.649 0.835 0.469 1e-101
P15111447 NADP-specific glutamate d yes no 0.639 0.825 0.479 1e-101
Q8Z6F6447 NADP-specific glutamate d N/A no 0.639 0.825 0.479 1e-101
P00370447 NADP-specific glutamate d N/A no 0.627 0.809 0.480 1e-100
P94598444 Glutamate dehydrogenase O yes no 0.644 0.837 0.462 9e-99
>sp|P28724|DHE4_GIAIN NADP-specific glutamate dehydrogenase OS=Giardia intestinalis PE=2 SV=1 Back     alignment and function desciption
 Score =  389 bits (998), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/379 (48%), Positives = 255/379 (67%), Gaps = 4/379 (1%)

Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRV 249
           ++T   ++    +RD H  EF Q+V+E + +L+ +  +   Y+ I ER+LEPER+I+FRV
Sbjct: 3   AQTIEELIAVIKQRDGHMTEFRQAVEEVVDSLKVIFEREPKYIPIFERMLEPERVIIFRV 62

Query: 250 PWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLG 309
           PW+DD G  +VNRGFRVQ++ ALGP +GGLRFHPS+NLSI KFLGFEQ LKN+L+   +G
Sbjct: 63  PWMDDAGRINVNRGFRVQYNSALGPYKGGLRFHPSVNLSILKFLGFEQILKNSLTTLPMG 122

Query: 310 GAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRR 369
           G  GGSDFDPKGKSDNE+MRFCQSFM E+ R++G D D+P+ ++GVG RE+GYL+GQY+R
Sbjct: 123 GGKGGSDFDPKGKSDNEVMRFCQSFMTELQRHVGADTDVPAGDIGVGAREIGYLYGQYKR 182

Query: 370 LAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM 429
           L   F G  TG  + W GS +R EATGYG V+F + +  D N  ++G   ++SGSG +A 
Sbjct: 183 LRNEFTGVLTGKNVKWGGSFIRPEATGYGAVYFLEEMCKDNNTVIRGKNVLLSGSGNVAQ 242

Query: 430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRS-LRDYSKTYARSKY 488
              EKLI  GA  ++ SD+ G +VD+DGF+  K++ L  +K+++R  + ++   Y    Y
Sbjct: 243 FACEKLIQLGAKVLTFSDSNGTIVDKDGFNEEKLAHLMYLKNEKRGRVSEFKDKYPSVAY 302

Query: 489 YDEAKPW---NERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKK 545
           Y+  KPW     + D   PCA+QNE+   DA  LV  G + + EG+NMP T EAV V   
Sbjct: 303 YEGKKPWECFEGQMDCIMPCATQNEVSGDDATRLVGLGLKFVAEGANMPSTAEAVHVYHA 362

Query: 546 ANVLIAPAMAAGAGGVRYS 564
             V+  PA A+ AGGV  S
Sbjct: 363 KGVMYGPAKASNAGGVSVS 381

Giardia intestinalis (taxid: 5741)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 4
>sp|Q8RQP4|DHE4_COREF NADP-specific glutamate dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gdh PE=3 SV=2 Back     alignment and function description
>sp|P28998|DHE4_CHLSO NADP-specific glutamate dehydrogenase (Fragment) OS=Chlorella sorokiniana PE=2 SV=1 Back     alignment and function description
>sp|P31026|DHE4_CORGL NADP-specific glutamate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gdh PE=3 SV=2 Back     alignment and function description
>sp|P95544|DHE4_PRERU NAD(P)-specific glutamate dehydrogenase OS=Prevotella ruminicola GN=gdhA PE=1 SV=1 Back     alignment and function description
>sp|P43793|DHE4_HAEIN NADP-specific glutamate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gdhA PE=3 SV=1 Back     alignment and function description
>sp|P15111|DHE4_SALTY NADP-specific glutamate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gdhA PE=3 SV=2 Back     alignment and function description
>sp|Q8Z6F6|DHE4_SALTI NADP-specific glutamate dehydrogenase OS=Salmonella typhi GN=gdhA PE=3 SV=1 Back     alignment and function description
>sp|P00370|DHE4_ECOLI NADP-specific glutamate dehydrogenase OS=Escherichia coli (strain K12) GN=gdhA PE=1 SV=1 Back     alignment and function description
>sp|P94598|DHE3_BACTN Glutamate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gdhA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
449458193637 PREDICTED: NADP-specific glutamate dehyd 0.960 0.869 0.915 0.0
255549662636 glutamate dehydrogenase, putative [Ricin 0.960 0.871 0.913 0.0
225442347635 PREDICTED: NADP-specific glutamate dehyd 0.949 0.862 0.927 0.0
356526047637 PREDICTED: NADP-specific glutamate dehyd 0.960 0.869 0.882 0.0
356522684637 PREDICTED: NADP-specific glutamate dehyd 0.960 0.869 0.877 0.0
30695050637 glutamate dehydrogenase (NADP+) [Arabido 0.953 0.863 0.860 0.0
297847546624 hypothetical protein ARALYDRAFT_474290 [ 0.930 0.860 0.869 0.0
12321666624 NADP-specific glutatamate dehydrogenase, 0.930 0.860 0.866 0.0
224128524621 predicted protein [Populus trichocarpa] 0.923 0.858 0.888 0.0
147768438638 hypothetical protein VITISV_043645 [Viti 0.927 0.838 0.851 0.0
>gi|449458193|ref|XP_004146832.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] gi|449527615|ref|XP_004170805.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/555 (91%), Positives = 543/555 (97%), Gaps = 1/555 (0%)

Query: 1   MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
           MLLPVGGLGMN++MDDMNLIQQAQRHHLVVRELGEEIDLEIG GDDDPSFA+ P++GGP 
Sbjct: 1   MLLPVGGLGMNTSMDDMNLIQQAQRHHLVVRELGEEIDLEIGHGDDDPSFASTPIIGGPV 60

Query: 60  REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKE 119
           REPSAE+HD++K + +VSQL NDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVK+
Sbjct: 61  REPSAEDHDESKHVVLVSQLSNDDQDMSKTQPAKRKKKVVKRWREEWADTYKWAYVDVKD 120

Query: 120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
           GTARIFCSVC+EYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKII 
Sbjct: 121 GTARIFCSVCKEYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIV 180

Query: 180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
           DKPIYVKALMSKTAGSI+EAALKRDP+E+EFIQ+VQE++HALERVIAKNSHYVNIMERLL
Sbjct: 181 DKPIYVKALMSKTAGSIIEAALKRDPNEVEFIQAVQEAVHALERVIAKNSHYVNIMERLL 240

Query: 240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
           EPERM++FRVPWVDDRGETHVNRGFRVQF+QALGPCRGGLRFHPSMNLSI KFLGFEQTL
Sbjct: 241 EPERMVLFRVPWVDDRGETHVNRGFRVQFNQALGPCRGGLRFHPSMNLSITKFLGFEQTL 300

Query: 300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
           KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSF+NEI+RYLGPDKDLPSEEMGVGTRE
Sbjct: 301 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFINEIYRYLGPDKDLPSEEMGVGTRE 360

Query: 360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
           MGYLFGQYRRLAGHF+GSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC
Sbjct: 361 MGYLFGQYRRLAGHFEGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 420

Query: 420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
            VSGSGKIAMHVLEKLIAYGA+P++VSD+KGYLVDEDGFDYMKISFLRDIK+QQRSLRDY
Sbjct: 421 AVSGSGKIAMHVLEKLIAYGALPITVSDSKGYLVDEDGFDYMKISFLRDIKAQQRSLRDY 480

Query: 480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
           SKTYARSKYYDE KPWNERCDVAFPCA  NEIDQ+DAINL++SGCRIL+EGSNMPCTPEA
Sbjct: 481 SKTYARSKYYDEGKPWNERCDVAFPCAYHNEIDQADAINLISSGCRILIEGSNMPCTPEA 540

Query: 540 VDVLKKANVLIAPAM 554
           VDVL+KAN+LIAPAM
Sbjct: 541 VDVLRKANILIAPAM 555

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255549662|ref|XP_002515882.1| glutamate dehydrogenase, putative [Ricinus communis] gi|223544787|gb|EEF46302.1| glutamate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225442347|ref|XP_002281123.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356526047|ref|XP_003531631.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|356522684|ref|XP_003529976.1| PREDICTED: NADP-specific glutamate dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|30695050|ref|NP_175583.2| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] gi|332194586|gb|AEE32707.1| glutamate dehydrogenase (NADP+) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847546|ref|XP_002891654.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] gi|297337496|gb|EFH67913.1| hypothetical protein ARALYDRAFT_474290 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|12321666|gb|AAG50868.1|AC025294_6 NADP-specific glutatamate dehydrogenase, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224128524|ref|XP_002329025.1| predicted protein [Populus trichocarpa] gi|222839696|gb|EEE78019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147768438|emb|CAN69269.1| hypothetical protein VITISV_043645 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query577
TAIR|locus:2017542637 AT1G51720 [Arabidopsis thalian 0.972 0.880 0.836 1.8e-261
GENEDB_PFALCIPARUM|PF14_0286510 PF14_0286 "glutamate dehydroge 0.636 0.719 0.5 9.2e-107
UNIPROTKB|Q8ILF7510 PF14_0286 "Glutamate dehydroge 0.636 0.719 0.5 9.2e-107
GENEDB_PFALCIPARUM|PF14_0164470 PF14_0164 "NADP-specific gluta 0.681 0.836 0.456 5e-99
UNIPROTKB|Q8ILT0470 PF14_0164 "Glutamate dehydroge 0.681 0.836 0.456 5e-99
UNIPROTKB|Q8RQP4447 gdh "NADP-specific glutamate d 0.625 0.807 0.508 1.3e-98
UNIPROTKB|P31026447 gdh "NADP-specific glutamate d 0.625 0.807 0.5 2e-97
UNIPROTKB|P95544444 gdhA "NAD(P)-specific glutamat 0.642 0.835 0.464 6.1e-94
UNIPROTKB|P15111447 gdhA "NADP-specific glutamate 0.639 0.825 0.479 2.7e-93
UNIPROTKB|Q8Z6F6447 gdhA "NADP-specific glutamate 0.639 0.825 0.479 3.4e-93
TAIR|locus:2017542 AT1G51720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2516 (890.7 bits), Expect = 1.8e-261, P = 1.8e-261
 Identities = 470/562 (83%), Positives = 518/562 (92%)

Query:     1 MLLPVGGLGMNSTMDDMNLIQQAQRHHLVVRELGEEIDLEIGPGDDDPSFANNPLMGGP- 59
             M  P GGLGMN +MDDMNLIQQAQRH LVV  LGEEIDLEIGPG+DD +FANN L+GGP 
Sbjct:     1 MFGPTGGLGMNPSMDDMNLIQQAQRHQLVVSNLGEEIDLEIGPGEDDAAFANNSLIGGPP 60

Query:    60 REPSAEEHDQNKQMGMVSQLPNDDQDMSKTQPAXXXXXXXXXXXXXXADTYKWAYVDVKE 119
             REPS  EHD+ K M +VS LP++DQD+SK  PA              ADTYKWAYVD+K+
Sbjct:    61 REPSTGEHDETKHMVLVSDLPSEDQDISKGTPAKRKKKVVKRWREEWADTYKWAYVDMKD 120

Query:   120 GTARIFCSVCREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQMASKDKIIA 179
             GTARIFCS+CREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQ ASKDKI+ 
Sbjct:   121 GTARIFCSICREYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKDKIVV 180

Query:   180 DKPIYVKALMSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLL 239
             DKPIYVK +MSK+AGSIVE ALKRDP+EIEF+QSVQES+HALERVIAKNSHYVNIMERLL
Sbjct:   181 DKPIYVKTVMSKSAGSIVEGALKRDPNEIEFVQSVQESVHALERVIAKNSHYVNIMERLL 240

Query:   240 EPERMIVFRVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTL 299
             EPERMIVFRVPW+DDRGETHVNRGFRVQF+QALGPCRGG+RFHPSMNLSIAKFLGF+QTL
Sbjct:   241 EPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFLGFQQTL 300

Query:   300 KNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTRE 359
             KNALSPYKLGGA+GGSDFDPKGKSDNEIMRFCQSFMNE++RY+GPDKDLPSEE+GVGTRE
Sbjct:   301 KNALSPYKLGGASGGSDFDPKGKSDNEIMRFCQSFMNEMYRYMGPDKDLPSEEVGVGTRE 360

Query:   360 MGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRC 419
             MGYLFGQYRRLAG FQGSFTGPRI+W+ SSLRTEA+GYG+V+FA+LILADMNKE+KGLRC
Sbjct:   361 MGYLFGQYRRLAGQFQGSFTGPRIYWAASSLRTEASGYGVVYFARLILADMNKEIKGLRC 420

Query:   420 VVSGSGKIAMHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQRSLRDY 479
             VVSG GKIAMHV+EKLIA GA PV+VSD+KGYLVD+DGFDYMK++FLRDIKSQQRSLRDY
Sbjct:   421 VVSGCGKIAMHVVEKLIACGAHPVTVSDSKGYLVDDDGFDYMKLAFLRDIKSQQRSLRDY 480

Query:   480 SKTYARSKYYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEA 539
             SKTYAR+KY+DE KPWNERCDVAFPCASQNE+DQ+DAINLVN+GCR+LVEGSNMPCT EA
Sbjct:   481 SKTYARAKYFDELKPWNERCDVAFPCASQNEVDQADAINLVNAGCRLLVEGSNMPCTAEA 540

Query:   540 VDVLKKANVLIAPAMAAGAGGV 561
             VDV +KANVLIAPA+AAGAGGV
Sbjct:   541 VDVFRKANVLIAPAIAAGAGGV 562
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008295 "spermidine biosynthetic process" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GENEDB_PFALCIPARUM|PF14_0286 PF14_0286 "glutamate dehydrogenase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILF7 PF14_0286 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0164 PF14_0164 "NADP-specific glutamate dehydrogenase" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILT0 PF14_0164 "Glutamate dehydrogenase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RQP4 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium efficiens YS-314 (taxid:196164)] Back     alignment and assigned GO terms
UNIPROTKB|P31026 gdh "NADP-specific glutamate dehydrogenase" [Corynebacterium glutamicum ATCC 13032 (taxid:196627)] Back     alignment and assigned GO terms
UNIPROTKB|P95544 gdhA "NAD(P)-specific glutamate dehydrogenase" [Prevotella ruminicola (taxid:839)] Back     alignment and assigned GO terms
UNIPROTKB|P15111 gdhA "NADP-specific glutamate dehydrogenase" [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 (taxid:99287)] Back     alignment and assigned GO terms
UNIPROTKB|Q8Z6F6 gdhA "NADP-specific glutamate dehydrogenase" [Salmonella enterica subsp. enterica serovar Typhi (taxid:90370)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RQP4DHE4_COREF1, ., 4, ., 1, ., 40.50810.62560.8076yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT1G51720
glutamate dehydrogenase, putative; glutamate dehydrogenase, putative; FUNCTIONS IN- oxidoreductase activity, binding, catalytic activity; INVOLVED IN- amino acid metabolic process, metabolic process; LOCATED IN- cellular_component unknown; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- Glutamate/phenylalanine/leucine/valine dehydrogenase (InterPro-IPR006095), Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal (InterPro-IPR006096), NAD(P)-binding (InterPro-IPR016040), Glutamate/phenylalanine/leucine/valine dehydrogenase, [...] (637 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
NIR1
NIR1 (NITRITE REDUCTASE 1); ferredoxin-nitrate reductase/ nitrite reductase (NO-forming); invol [...] (586 aa)
     •• 0.941
GLT1
GLT1; glutamate synthase (NADH); NADH-dependent glutamate synthase (2208 aa)
    ••• 0.939
GLU2
GLU2 (GLUTAMATE SYNTHASE 2); glutamate synthase (ferredoxin); Encodes a gene whose sequence is [...] (1629 aa)
   •••• 0.932
GLU1
GLU1 (GLUTAMATE SYNTHASE 1); glutamate synthase (ferredoxin); Encodes a gene whose sequence is [...] (1648 aa)
   •••• 0.931
P5CS1
P5CS1 (DELTA1-PYRROLINE-5-CARBOXYLATE SYNTHASE 1); delta1-pyrroline-5-carboxylate synthetase; e [...] (717 aa)
     •• 0.920
GDCST
aminomethyltransferase, putative; aminomethyltransferase, putative; FUNCTIONS IN- aminomethyltr [...] (408 aa)
     •• 0.920
ASN1
ASN1 (GLUTAMINE-DEPENDENT ASPARAGINE SYNTHASE 1); asparagine synthase (glutamine-hydrolyzing); [...] (584 aa)
     •• 0.913
AT2G37500
arginine biosynthesis protein ArgJ family; arginine biosynthesis protein ArgJ family; FUNCTIONS [...] (468 aa)
   • •• 0.910
CBL
CBL (cystathionine beta-lyase); cystathionine beta-lyase; Encodes second enzyme in the methioni [...] (464 aa)
     •• 0.910
ATGSR1
ATGSR1; copper ion binding / glutamate-ammonia ligase; encodes a cytosolic glutamine synthetase [...] (356 aa)
     •• 0.907

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
PRK09414445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 0.0
PTZ00079454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 0.0
PRK14030445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 1e-139
PRK14031444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 1e-138
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 1e-122
cd05313254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 1e-101
pfam02812131 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr 2e-61
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 3e-53
PLN02477410 PLN02477, PLN02477, glutamate dehydrogenase 2e-50
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 1e-26
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny 1e-21
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 1e-20
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 7e-04
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information 
 Score =  566 bits (1462), Expect = 0.0
 Identities = 199/370 (53%), Positives = 269/370 (72%), Gaps = 7/370 (1%)

Query: 195 SIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWV 252
           S++E   KR+P + EF Q+V+E L +L  V+ KN  Y    I+ERL+EPER+I+FRVPWV
Sbjct: 9   SVLEQVKKRNPGQPEFHQAVREVLESLWPVLEKNPEYAEAGILERLVEPERVIIFRVPWV 68

Query: 253 DDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAA 312
           DD+G+  VNRGFRVQF+ A+GP +GGLRFHPS+NLSI KFLGFEQ  KNAL+   +GG  
Sbjct: 69  DDKGQVQVNRGFRVQFNSAIGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLPIGGGK 128

Query: 313 GGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAG 372
           GGSDFDPKGKSD EIMRFCQSFM E++R++GPD D+P+ ++GVG RE+GYLFGQY+RL  
Sbjct: 129 GGSDFDPKGKSDAEIMRFCQSFMTELYRHIGPDTDVPAGDIGVGGREIGYLFGQYKRLTN 188

Query: 373 HFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVL 432
            F+G  TG  + + GS +RTEATGYGLV+FA+ +L       +G R VVSGSG +A++ +
Sbjct: 189 RFEGVLTGKGLSFGGSLIRTEATGYGLVYFAEEMLKARGDSFEGKRVVVSGSGNVAIYAI 248

Query: 433 EKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDE 491
           EK    GA  V+ SD+ GY+ DE+G D  K   L++IK  +R  + +Y++ +  ++Y + 
Sbjct: 249 EKAQQLGAKVVTCSDSSGYVYDEEGIDLEK---LKEIKEVRRGRISEYAEEFG-AEYLEG 304

Query: 492 AKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIA 551
             PW+  CD+A PCA+QNE+D+ DA  L+ +G + + EG+NMP TPEA++V  +A VL A
Sbjct: 305 GSPWSVPCDIALPCATQNELDEEDAKTLIANGVKAVAEGANMPSTPEAIEVFLEAGVLFA 364

Query: 552 PAMAAGAGGV 561
           P  AA AGGV
Sbjct: 365 PGKAANAGGV 374

Length = 445
>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 577
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 100.0
PRK14030445 glutamate dehydrogenase; Provisional 100.0
PRK14031444 glutamate dehydrogenase; Provisional 100.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK09414445 glutamate dehydrogenase; Provisional 100.0
KOG2250 514 consensus Glutamate/leucine/phenylalanine/valine d 100.0
PLN02477410 glutamate dehydrogenase 100.0
PTZ00324 1002 glutamate dehydrogenase 2; Provisional 100.0
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 100.0
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 100.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 100.0
PF02812131 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di 100.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 100.0
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 99.94
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 99.91
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali 99.88
PRK08374 336 homoserine dehydrogenase; Provisional 98.99
PRK06392 326 homoserine dehydrogenase; Provisional 98.93
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.6
PRK06270 341 homoserine dehydrogenase; Provisional 98.57
PLN02700 377 homoserine dehydrogenase family protein 97.87
PRK06813 346 homoserine dehydrogenase; Validated 97.83
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.54
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.52
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.49
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.48
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.25
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.05
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.91
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 96.9
PTZ00075476 Adenosylhomocysteinase; Provisional 96.87
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.69
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.57
PRK00048 257 dihydrodipicolinate reductase; Provisional 96.43
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.43
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.39
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.38
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.36
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 96.34
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.32
PLN03129581 NADP-dependent malic enzyme; Provisional 96.29
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.29
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.25
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.09
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.04
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.96
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 95.93
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 95.92
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.9
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.88
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 95.88
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 95.86
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.83
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.81
PLN02494477 adenosylhomocysteinase 95.76
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.75
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.73
PRK13304 265 L-aspartate dehydrogenase; Reviewed 95.7
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.69
PRK06436303 glycerate dehydrogenase; Provisional 95.69
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 95.66
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.65
PRK06487317 glycerate dehydrogenase; Provisional 95.62
PRK13243333 glyoxylate reductase; Reviewed 95.62
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.6
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.59
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.57
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.5
PRK12861 764 malic enzyme; Reviewed 95.46
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.46
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.44
PRK13529563 malate dehydrogenase; Provisional 95.4
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.34
PTZ00317559 NADP-dependent malic enzyme; Provisional 95.34
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 95.33
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 95.26
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.24
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.21
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.2
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.15
PLN03139386 formate dehydrogenase; Provisional 95.11
PRK06932314 glycerate dehydrogenase; Provisional 95.09
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.05
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.04
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.01
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 95.0
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.98
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 94.92
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.87
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.87
PRK12862 763 malic enzyme; Reviewed 94.86
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 94.84
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 94.81
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.81
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.79
PRK07574385 formate dehydrogenase; Provisional 94.78
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 94.73
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.71
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 94.67
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.64
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.6
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.58
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.57
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.56
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 94.54
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 94.51
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 94.44
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 94.43
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 94.35
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 94.35
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.32
PRK08223287 hypothetical protein; Validated 94.24
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 94.22
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.21
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.19
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.19
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 94.18
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.11
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.08
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 94.08
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 93.86
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.86
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.86
PRK06141314 ornithine cyclodeaminase; Validated 93.83
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 93.81
PRK06349 426 homoserine dehydrogenase; Provisional 93.79
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.74
TIGR00036 266 dapB dihydrodipicolinate reductase. 93.71
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.7
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 93.7
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 93.7
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.63
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 93.54
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 93.51
PRK13303 265 L-aspartate dehydrogenase; Provisional 93.5
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.47
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.37
PRK11579 346 putative oxidoreductase; Provisional 93.33
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 93.3
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 93.28
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.23
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.23
COG5322351 Predicted dehydrogenase [General function predicti 93.17
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.1
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 93.09
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 93.08
PRK06719157 precorrin-2 dehydrogenase; Validated 93.06
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.05
PRK15116268 sulfur acceptor protein CsdL; Provisional 92.89
COG2344211 AT-rich DNA-binding protein [General function pred 92.88
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 92.86
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 92.86
PRK08300 302 acetaldehyde dehydrogenase; Validated 92.85
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 92.83
PLN02928347 oxidoreductase family protein 92.81
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.76
COG2130340 Putative NADP-dependent oxidoreductases [General f 92.66
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 92.55
smart0059790 ZnF_TTF zinc finger in transposases and transcript 92.52
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 92.38
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.31
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.26
PRK12548289 shikimate 5-dehydrogenase; Provisional 92.18
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 92.17
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 92.17
PRK08618325 ornithine cyclodeaminase; Validated 92.1
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 92.04
PLN00203 519 glutamyl-tRNA reductase 92.02
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 91.87
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.86
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 91.85
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 91.82
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 91.75
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 91.66
PRK14027283 quinate/shikimate dehydrogenase; Provisional 91.5
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.46
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 91.44
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 91.43
PRK12480330 D-lactate dehydrogenase; Provisional 91.39
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 91.39
PRK14851 679 hypothetical protein; Provisional 91.31
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 91.16
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 91.13
PRK07680 273 late competence protein ComER; Validated 91.06
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.94
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.87
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 90.58
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 90.44
PRK07340304 ornithine cyclodeaminase; Validated 90.38
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 90.2
PLN02306386 hydroxypyruvate reductase 90.18
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 90.02
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 89.97
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.86
PRK14852 989 hypothetical protein; Provisional 89.85
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 89.73
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.57
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 89.31
cd01483143 E1_enzyme_family Superfamily of activating enzymes 89.28
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 88.92
PRK10206 344 putative oxidoreductase; Provisional 88.87
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 88.87
PRK14982340 acyl-ACP reductase; Provisional 88.81
PRK13940414 glutamyl-tRNA reductase; Provisional 88.79
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 88.77
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 88.72
PRK13403 335 ketol-acid reductoisomerase; Provisional 88.31
PRK06046326 alanine dehydrogenase; Validated 88.25
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.16
COG0673 342 MviM Predicted dehydrogenases and related proteins 88.13
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 88.12
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 88.06
PRK12550272 shikimate 5-dehydrogenase; Reviewed 87.95
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 87.94
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 87.74
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 87.67
PRK05717255 oxidoreductase; Validated 86.95
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 86.93
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.92
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 86.78
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 86.76
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 86.74
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 86.71
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.66
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 86.6
PRK08605332 D-lactate dehydrogenase; Validated 86.56
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 86.36
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.16
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 86.15
PRK10669558 putative cation:proton antiport protein; Provision 86.14
PLN02688 266 pyrroline-5-carboxylate reductase 85.99
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.85
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 85.84
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 85.72
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 85.62
PRK05479 330 ketol-acid reductoisomerase; Provisional 85.62
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 85.51
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.3
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 85.23
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 85.14
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 85.14
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 85.13
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.1
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 85.09
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 85.02
PRK03659601 glutathione-regulated potassium-efflux system prot 84.85
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 84.72
PRK07877 722 hypothetical protein; Provisional 84.71
PRK08628258 short chain dehydrogenase; Provisional 84.69
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 84.69
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 84.56
PRK15059 292 tartronate semialdehyde reductase; Provisional 84.56
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.4
PRK12828239 short chain dehydrogenase; Provisional 84.07
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 84.01
PRK07523255 gluconate 5-dehydrogenase; Provisional 84.0
PLN02712 667 arogenate dehydrogenase 83.89
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 83.78
PRK05562223 precorrin-2 dehydrogenase; Provisional 83.77
PRK06138252 short chain dehydrogenase; Provisional 83.73
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.65
PRK08328231 hypothetical protein; Provisional 83.61
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 83.6
PRK06823315 ornithine cyclodeaminase; Validated 83.6
PRK07060245 short chain dehydrogenase; Provisional 83.55
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 83.41
COG0569225 TrkA K+ transport systems, NAD-binding component [ 83.41
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 83.19
PRK03562621 glutathione-regulated potassium-efflux system prot 82.97
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 82.96
PRK06523260 short chain dehydrogenase; Provisional 82.81
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.73
PRK06841255 short chain dehydrogenase; Provisional 82.65
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.25
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.18
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 81.99
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 81.96
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.96
KOG1257 582 consensus NADP+-dependent malic enzyme [Energy pro 81.94
PLN02353 473 probable UDP-glucose 6-dehydrogenase 81.88
PLN02240 352 UDP-glucose 4-epimerase 81.84
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 81.81
PRK08291330 ectoine utilization protein EutC; Validated 81.8
PRK04148134 hypothetical protein; Provisional 81.63
PRK06172253 short chain dehydrogenase; Provisional 81.62
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 81.58
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 81.58
PRK12938246 acetyacetyl-CoA reductase; Provisional 81.54
PRK09496453 trkA potassium transporter peripheral membrane com 81.5
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 81.44
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 81.41
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 81.4
PLN02858 1378 fructose-bisphosphate aldolase 81.26
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.17
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 81.08
PRK08703239 short chain dehydrogenase; Provisional 81.05
PRK06949258 short chain dehydrogenase; Provisional 80.93
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.8
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.71
PRK06125259 short chain dehydrogenase; Provisional 80.65
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 80.65
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 80.56
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.52
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 80.52
PRK07774250 short chain dehydrogenase; Provisional 80.5
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 80.47
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 80.37
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.2
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 80.15
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.13
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.12
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.1
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 80.07
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 80.06
PRK08339263 short chain dehydrogenase; Provisional 80.03
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.5e-122  Score=986.65  Aligned_cols=383  Identities=50%  Similarity=0.936  Sum_probs=372.4

Q ss_pred             hhhHHHHHHHHhhcCCCCccHHHHHHHHHHHHHHHHHhCccchHHHHhhcCCCeEEEEEEeEECCCCceEEEEEEEEEec
Q 008128          190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQFS  269 (577)
Q Consensus       190 ~~~~~~~~~~~~~~~~~~~ef~qav~~~~~~~~~~~~~~p~y~~~le~l~~Per~i~~rvp~~dd~G~~~v~~GyRVqhs  269 (577)
                      ...++.+++.+.+|+|+|+||+|||+|+++++.|+|+++|+|.+++++|++|+|+|+|||||+||+|++++|+|||||||
T Consensus        11 ~~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~~~~~~~~~~~y~~i~e~l~~Per~i~~~vp~~~D~G~v~v~~GyRVqhn   90 (454)
T PTZ00079         11 AQEMDALRKRVKSRDPNQPEFLQAFHEVMTSLKPLFQKNPKYLGVLERLVEPERVIQFRVPWVDDKGEQRVNRGFRVQYN   90 (454)
T ss_pred             HHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHhChhHHHHHHHhccCceEEEEEEEEEECCCCEEEEeeEEEEEc
Confidence            34467899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCeeeecCCCHHHHHHHhHHhHHhhhccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHhhhcCCCcccC
Q 008128          270 QALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLP  349 (577)
Q Consensus       270 ~alGPakGGlRfhp~vt~~evk~LA~~MT~KnAL~gLP~GGaKGGI~~DP~~~s~~Eler~~r~f~~eL~~~IGp~~DVp  349 (577)
                      +++|||||||||||+||++++++||++|||||||++||||||||||+|||+++|+.|++||||+||++|.+||||++|||
T Consensus        91 ~alGP~kGGlRfhp~v~~~~vk~La~~mt~KnAl~gLP~GGgKGGi~~dPk~~s~~El~r~~r~f~~eL~~~IGp~~Dvp  170 (454)
T PTZ00079         91 SALGPYKGGLRFHPSVNLSILKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMTELYRHIGPDTDVP  170 (454)
T ss_pred             CCCCCCCCCEEeeCCCCHHHHHHHHHHHHHHHHhcCCCCCCcceeeecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCChhHHHHHHHHhhhhhCCccccccCccccccCCCCCCCcchHHHHHHHHHHHHHcCCCCCCceEEEEecchHHH
Q 008128          350 SEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAM  429 (577)
Q Consensus       350 apDvGt~~~em~~i~~~y~~~~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~~~~~l~~~g~~l~GkrVaIQGfGNVG~  429 (577)
                      ||||||+++||+||+++|+++.+.+.|++||||+.+|||.+|++||||||+|++++++++++.+++|+||+||||||||+
T Consensus       171 A~DvGt~~rem~~~~~~y~~~~~~~~gv~TGK~~~~GGs~~r~eATG~Gv~~~~~~~l~~~~~~l~Gk~VaVqG~GnVg~  250 (454)
T PTZ00079        171 AGDIGVGGREIGYLFGQYKKLRNNFEGTLTGKNVKWGGSNIRPEATGYGLVYFVLEVLKKLNDSLEGKTVVVSGSGNVAQ  250 (454)
T ss_pred             hhhcCCCHHHHHHHHHHHHHHhCCCCceeCCCCCCCCCCCCCCcccHHHHHHHHHHHHHHcCCCcCCCEEEEECCCHHHH
Confidence            99999999999999999999999889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHCCCeEEEEEcCCCeeeCCCCCCHHhHhHHHHHHhhc-CcccccccccCCceEeCCCCccccccceeecCCcc
Q 008128          430 HVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERCDVAFPCASQ  508 (577)
Q Consensus       430 ~aA~~L~e~GAkVVaISDs~G~Iydp~GLD~e~L~~l~~~k~~~-g~l~~y~~~~p~a~~i~~~eil~~~cDIlIPcA~~  508 (577)
                      ++|++|.+.|+|||+|||++|+||||+|||+++|..|.++|+.+ +++.+|.+.++++++++++++|+++||||+|||++
T Consensus       251 ~aa~~L~e~GakVVavSD~~G~iy~~~Gld~~~l~~l~~~k~~~~g~i~~~~~~~~~a~~~~~~~~~~~~cDI~iPcA~~  330 (454)
T PTZ00079        251 YAVEKLLQLGAKVLTMSDSDGYIHEPNGFTKEKLAYLMDLKNVKRGRLKEYAKHSSTAKYVPGKKPWEVPCDIAFPCATQ  330 (454)
T ss_pred             HHHHHHHHCCCEEEEEEcCCCcEECCCCCCHHHHHHHHHHHhhcCCcHHhhhhccCCcEEeCCcCcccCCccEEEecccc
Confidence            99999999999999999999999999999999999999999865 78888876677899999999999999999999999


Q ss_pred             cccchhhHhhhhccCceEEEecCCCCCCHHHHHHHHhCCcEEecchhccccceeehhhhhcccc
Q 008128          509 NEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCFL  572 (577)
Q Consensus       509 n~It~enA~~l~~~~akiVvEgAN~p~T~eA~~iL~~rGI~viPD~~aNAGGVivS~~Ev~~~~  572 (577)
                      |+||.+||++|++++||+|+||||||+|++|+++|+++||+|+||+++|||||++||||+.-++
T Consensus       331 n~I~~~~a~~l~~~~ak~V~EgAN~p~t~eA~~~L~~~GI~~~PD~~aNAGGV~vS~~E~~Qn~  394 (454)
T PTZ00079        331 NEINLEDAKLLIKNGCKLVAEGANMPTTIEATHLFKKNGVIFCPGKAANAGGVAISGLEMSQNA  394 (454)
T ss_pred             ccCCHHHHHHHHHcCCeEEEecCCCCCCHHHHHHHHHCCcEEEChhhhcCCCeeeehHHhhhhh
Confidence            9999999999999999999999999999999999999999999999999999999999997654

>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>smart00597 ZnF_TTF zinc finger in transposases and transcription factors Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3r3j_A456 Kinetic And Structural Characterization Of Plasmodi 1e-119
2bma_A470 The Crystal Structure Of Plasmodium Falciparum Glut 1e-104
2yfh_A448 Structure Of A Chimeric Glutamate Dehydrogenase Len 1e-102
4fcc_A450 Glutamate Dehydrogenase From E. Coli Length = 450 1e-101
2yfg_E447 Structural Determinants Of Cofactor Specificity And 1e-101
3sbo_A447 Structure Of E.Coli Gdh From Native Source Length = 1e-101
1hrd_A449 Glutamate Dehydrogenase Length = 449 8e-92
1k89_A449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 2e-91
1aup_A449 Glutamate Dehydrogenase Length = 449 7e-91
3k92_A424 Crystal Structure Of A E93k Mutant Of The Majour Ba 7e-38
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 8e-38
1b26_A416 Glutamate Dehydrogenase Length = 416 8e-38
3aoe_A424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 4e-37
3aog_A440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 4e-37
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 2e-36
3mw9_A 501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 3e-35
1l1f_A 505 Structure Of Human Glutamate Dehydrogenase-Apo Form 4e-35
1nr1_A 496 Crystal Structure Of The R463a Mutant Of Human Glut 5e-35
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 9e-35
3etd_A 501 Structure Of Glutamate Dehydrogenase Complexed With 1e-34
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-34
1nqt_A 496 Crystal Structure Of Bovine Glutamate Dehydrogenase 1e-34
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 6e-34
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 9e-33
1hwy_A 501 Bovine Glutamate Dehydrogenase Complexed With Nad A 2e-32
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 1e-31
2yfq_A421 Crystal Structure Of Glutamate Dehydrogenase From P 5e-28
3aoe_E419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 3e-26
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure 
Iteration: 1

 Score =  424 bits (1090), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 277/368 (75%), Gaps = 1/368 (0%)
Query: 198 EAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFRVPWVDDRGE 257
           E  + ++ +E EF+Q+ +E L  L+ V  K++ Y+ ++E + EPER+I FRVPW++D+GE
Sbjct: 21  EKVVSKNKNEPEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFRVPWINDKGE 80
Query: 258 THVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDF 317
             +NRGFRVQ++  LGP +GGLRFHP++NLS+ KFLGFEQ  KN+L+   +GG  GGSDF
Sbjct: 81  HKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPMGGGKGGSDF 140
Query: 318 DPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYRRLAGHFQGS 377
           DPKGKS+NEI++FCQSFM  + RY+GP+ D+P+ ++GVG RE+GYLFGQY++L   F+G 
Sbjct: 141 DPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYKKLKNSFEGV 200
Query: 378 FTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIAMHVLEKLIA 437
            TG  I W GS++R EATGYG+V+FA+ +L D+N  L+  +C+VSGSG +A +++EKLI 
Sbjct: 201 LTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVAQYLVEKLIE 260
Query: 438 YGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSKYYDEAKPWN 496
            GAI +++SD+ GY+++ +GF   +++++ DIK+ QR  L++Y K    +KY++  KPWN
Sbjct: 261 KGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRLKEYLKYSKTAKYFENQKPWN 320
Query: 497 ERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAA 556
             CD+AFPCA+QNEI+++DA   + + C+++VEG+NMP   +A+  LK+ N+++ P+ AA
Sbjct: 321 IPCDIAFPCATQNEINENDADLFIQNKCKMIVEGANMPTHIKALHKLKQNNIILCPSKAA 380
Query: 557 GAGGVRYS 564
            AGGV  S
Sbjct: 381 NAGGVAVS 388
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query577
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 0.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 0.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 0.0
2yfg_A447 NADP-specific glutamate dehydrogenase; oxidoreduct 0.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 1e-143
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 1e-137
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 1e-137
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 1e-133
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 1e-128
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 1e-127
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 1e-126
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 1e-105
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 3e-37
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 8e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
 Score =  622 bits (1606), Expect = 0.0
 Identities = 183/374 (48%), Positives = 278/374 (74%), Gaps = 1/374 (0%)

Query: 189 MSKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYVNIMERLLEPERMIVFR 248
           +      + E  + ++ +E EF+Q+ +E L  L+ V  K++ Y+ ++E + EPER+I FR
Sbjct: 12  VDNQIEELREKVVSKNKNEPEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFR 71

Query: 249 VPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKL 308
           VPW++D+GE  +NRGFRVQ++  LGP +GGLRFHP++NLS+ KFLGFEQ  KN+L+   +
Sbjct: 72  VPWINDKGEHKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPM 131

Query: 309 GGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQYR 368
           GG  GGSDFDPKGKS+NEI++FCQSFM  + RY+GP+ D+P+ ++GVG RE+GYLFGQY+
Sbjct: 132 GGGKGGSDFDPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYK 191

Query: 369 RLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIA 428
           +L   F+G  TG  I W GS++R EATGYG+V+FA+ +L D+N  L+  +C+VSGSG +A
Sbjct: 192 KLKNSFEGVLTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVA 251

Query: 429 MHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQR-SLRDYSKTYARSK 487
            +++EKLI  GAI +++SD+ GY+++ +GF   +++++ DIK+ QR  L++Y K    +K
Sbjct: 252 QYLVEKLIEKGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRLKEYLKYSKTAK 311

Query: 488 YYDEAKPWNERCDVAFPCASQNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKAN 547
           Y++  KPWN  CD+AFPCA+QNEI+++DA   + + C+++VEG+NMP   +A+  LK+ N
Sbjct: 312 YFENQKPWNIPCDIAFPCATQNEINENDADLFIQNKCKMIVEGANMPTHIKALHKLKQNN 371

Query: 548 VLIAPAMAAGAGGV 561
           +++ P+ AA AGGV
Sbjct: 372 IILCPSKAANAGGV 385
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 100.0
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 100.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 97.76
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.6
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.32
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.19
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 97.17
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.08
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.04
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.01
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.96
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.96
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.91
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.88
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.81
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.75
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.68
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.68
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.63
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.62
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.6
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.56
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.48
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.46
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.45
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.45
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.43
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 96.43
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.43
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.38
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.34
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 96.33
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.31
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.3
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.3
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.24
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.24
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.19
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.18
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.16
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.05
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.03
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.01
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.01
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.0
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.98
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 95.98
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.97
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.94
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 95.93
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 95.86
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 95.85
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 95.85
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.82
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 95.81
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 95.8
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.78
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.73
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 95.72
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.71
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.71
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 95.7
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 95.69
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.66
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.62
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.62
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.59
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 95.58
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.56
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 95.53
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 95.53
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 95.53
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.52
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 95.51
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 95.5
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.5
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 95.49
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 95.49
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 95.48
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.46
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 95.46
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.45
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 95.44
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 95.44
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.44
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.43
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.42
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 95.42
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.41
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.4
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.39
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 95.37
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.37
4had_A 350 Probable oxidoreductase protein; structural genomi 95.35
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 95.31
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 95.3
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 95.3
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 95.3
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.26
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.25
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.25
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.24
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.24
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 95.23
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 95.22
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.22
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 95.21
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.21
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.19
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.18
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 95.18
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.16
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 95.16
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.15
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 95.14
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 95.13
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 95.13
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.13
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.11
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.11
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 95.1
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.08
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.06
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 95.05
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 95.04
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 95.04
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 95.04
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 95.03
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 95.03
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 94.98
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 94.96
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.92
2d59_A144 Hypothetical protein PH1109; COA binding, structur 94.92
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 94.87
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 94.87
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 94.85
3qha_A 296 Putative oxidoreductase; seattle structural genomi 94.82
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.8
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 94.78
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.74
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.73
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 94.73
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 94.66
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 94.65
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 94.63
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 94.63
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 94.57
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 94.52
1ydw_A 362 AX110P-like protein; structural genomics, protein 94.51
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.48
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.44
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.4
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.35
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.35
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.34
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 94.29
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.27
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.25
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.18
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.13
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 94.12
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.12
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.1
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 94.09
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.08
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.06
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 94.03
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 93.96
2duw_A145 Putative COA-binding protein; ligand binding prote 93.86
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 93.85
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 93.84
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 93.82
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 93.82
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 93.82
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 93.77
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 93.77
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.76
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.74
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 93.71
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 93.66
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 93.66
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 93.6
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 93.59
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 93.55
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 93.52
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 93.41
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 93.41
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 93.33
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 93.33
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 93.31
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 93.31
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 93.3
4h3v_A 390 Oxidoreductase domain protein; structural genomics 93.28
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 93.2
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 93.17
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 93.14
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 93.08
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 93.06
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.02
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 92.99
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.96
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.83
4ezb_A 317 Uncharacterized conserved protein; structural geno 92.8
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 92.71
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 92.62
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 92.62
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.58
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 92.53
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 92.53
1iuk_A140 Hypothetical protein TT1466; structural genomics, 92.48
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 92.47
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 92.41
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 92.35
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 92.24
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 92.19
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 91.86
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.84
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.8
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 91.77
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 91.74
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 91.71
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 91.41
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.38
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 91.37
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 91.19
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.07
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.01
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 90.97
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 90.82
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 90.81
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 90.72
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 90.65
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 90.59
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 90.35
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 89.93
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 89.88
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.81
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.65
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 89.61
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 89.6
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 89.52
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 89.49
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 89.39
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 89.34
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.32
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 89.18
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.0
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.94
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 88.81
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 88.76
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 88.66
4eye_A342 Probable oxidoreductase; structural genomics, niai 88.59
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 88.53
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.47
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.11
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.74
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 87.49
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 87.06
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 87.06
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 86.89
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 86.84
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 86.8
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 86.76
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 86.67
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.61
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 86.57
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 86.5
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.42
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 86.24
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 86.2
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 86.02
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 85.9
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 85.77
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 85.67
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 85.66
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 85.61
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 85.58
3edm_A259 Short chain dehydrogenase; structural genomics, ox 85.53
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 85.51
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 85.48
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 85.44
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 85.37
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 85.35
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 85.3
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 85.14
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 85.04
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 85.03
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 84.99
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 84.91
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 84.88
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 84.85
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 84.75
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 84.72
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 84.64
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 84.64
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 84.49
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 84.42
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 84.32
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 84.28
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.26
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 84.23
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 84.13
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 84.07
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 84.03
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 84.03
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 83.99
4g65_A461 TRK system potassium uptake protein TRKA; structur 83.98
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 83.94
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 83.88
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 83.85
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 83.8
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 83.77
1nff_A260 Putative oxidoreductase RV2002; directed evolution 83.73
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 83.68
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 83.63
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 83.59
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 83.59
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 83.5
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 83.34
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 83.32
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 83.29
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 83.28
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 83.27
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 83.23
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 83.19
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 83.17
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 83.16
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 83.14
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 83.1
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 83.09
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 82.99
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 82.98
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 82.86
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 82.84
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 82.8
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 82.78
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 82.77
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 82.76
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 82.76
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 82.65
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 82.63
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 82.58
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 82.58
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 82.56
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 82.56
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 82.48
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 82.47
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 82.45
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 82.36
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 82.35
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 82.31
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 82.23
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 82.22
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 82.14
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 82.13
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 82.12
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 82.08
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 82.07
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 82.06
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 82.05
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 82.04
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 81.97
4eso_A255 Putative oxidoreductase; NADP, structural genomics 81.95
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 81.93
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 81.91
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 81.87
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 81.87
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 81.87
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 81.79
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 81.76
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 81.71
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 81.69
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 81.63
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 81.62
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 81.6
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 81.6
4dqx_A277 Probable oxidoreductase protein; structural genomi 81.58
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 81.52
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 81.46
1xq6_A253 Unknown protein; structural genomics, protein stru 81.45
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 81.44
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 81.39
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 81.38
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 81.35
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 81.33
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 81.3
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 81.22
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 81.17
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 81.11
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 81.07
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 81.05
3imf_A257 Short chain dehydrogenase; structural genomics, in 80.99
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 80.98
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 80.96
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 80.95
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 80.92
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 80.7
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 80.69
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 80.67
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 80.67
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 80.66
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 80.59
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 80.57
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 80.55
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 80.48
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 80.46
1xq1_A266 Putative tropinone reducatse; structural genomics, 80.43
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 80.42
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 80.39
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 80.38
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 80.35
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 80.32
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 80.29
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 80.28
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 80.26
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 80.19
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 80.01
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
Probab=100.00  E-value=1.8e-120  Score=975.14  Aligned_cols=380  Identities=47%  Similarity=0.818  Sum_probs=366.9

Q ss_pred             hhHHHHHHHHhhcCCCCccHHHHHHHHHHHHHHHHHhCccch--HHHHhhcCCCeEEEEEEeEECCCCceEEEEEEEEEe
Q 008128          191 KTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQF  268 (577)
Q Consensus       191 ~~~~~~~~~~~~~~~~~~ef~qav~~~~~~~~~~~~~~p~y~--~~le~l~~Per~i~~rvp~~dd~G~~~v~~GyRVqh  268 (577)
                      .+++.+++++++|+|+|+||+|||+|+++++.|+|++||+|.  .++|+|++|+|+|+|||||+||+|++++|+||||||
T Consensus         8 ~~~~~~~~~~~~~~~~~~ef~qa~~e~~~~l~~~~~~~p~y~~~~~~e~l~~PeR~i~~~vp~~~D~G~~~v~~GyRvqh   87 (450)
T 4fcc_A            8 YSLESFLNHVQKRDPNQTEFAQAVREVMTTLWPFLEQNPKYRQMSLLERLVEPERVIQFRVVWVDDRNQVQVNRAWRVQF   87 (450)
T ss_dssp             -CHHHHHHHHHTTCTTCHHHHHHHHHHHHHHHHHHHHCGGGTSTTHHHHHTSCSEEEEEEEEEECTTSCEEEEEEEEEEE
T ss_pred             hhHHHHHHHHHhhCcCChHHHHHHHHHHHHHHHHHHhChhhhhhhHHHHHhCCceEEEEEEEEEECCCcEEEEEEEEEEE
Confidence            358899999999999999999999999999999999999998  599999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCeeeecCCCHHHHHHHhHHhHHhhhccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHhhhcCCCccc
Q 008128          269 SQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDL  348 (577)
Q Consensus       269 s~alGPakGGlRfhp~vt~~evk~LA~~MT~KnAL~gLP~GGaKGGI~~DP~~~s~~Eler~~r~f~~eL~~~IGp~~DV  348 (577)
                      |+++|||||||||||++|++|+++||++|||||||++||||||||||++||+++|+.|+|||||+||++|.+||||++||
T Consensus        88 n~alGP~kGG~Rfhp~v~l~ev~~La~~mT~KnAl~gLP~GGgKggi~~DPk~~s~~El~R~~~~f~~eL~~~iG~d~dv  167 (450)
T 4fcc_A           88 SSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDV  167 (450)
T ss_dssp             ECSSSSEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTSSCCEEEEEESCCCTTCCHHHHHHHHHHHHHHHGGGCBTTTEE
T ss_pred             CCCCCCCCCceEecCCCCHHHHHHHHHHHHHHHHHcCCCCCCCceEEecCCCcCCHHHHHHHHHHHHHHhhheecCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcCChhHHHHHHHHhhhhhCCccccccCccccccCCCCCCCcchHHHHHHHHHHHHHcCCCCCCceEEEEecchHH
Q 008128          349 PSEEMGVGTREMGYLFGQYRRLAGHFQGSFTGPRIFWSGSSLRTEATGYGLVFFAQLILADMNKELKGLRCVVSGSGKIA  428 (577)
Q Consensus       349 papDvGt~~~em~~i~~~y~~~~g~~~g~vTGKp~~~GGs~~r~eATG~GV~~~~~~~l~~~g~~l~GkrVaIQGfGNVG  428 (577)
                      |||||||+++||+||+++|+++.+...+++||||+.+|||.+|++||||||+|++++++++++.+++|+||+||||||||
T Consensus       168 pa~Dig~~~~em~~~~~~y~~~~~~~~~v~TGk~~~~GGs~~r~~aTg~Gv~~~~~~~~~~~~~~l~Gk~vaVQG~GnVG  247 (450)
T 4fcc_A          168 PAGDIGVGGREVGFMAGMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVA  247 (450)
T ss_dssp             EECBTTBCHHHHHHHHHHHHHHHTCCSCCCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEEECCSHHH
T ss_pred             CccceeecchhhhhhhhhhhhccCCCceeecCCCcccCCCCCCCCceeeeHHHHHHHHHHHcCCCcCCCEEEEeCCChHH
Confidence            99999999999999999999999998999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCeEEEEEcCCCeeeCCCCCCHHhHhHHHHHHhhc-CcccccccccCCceEeCCCCccccccceeecCCc
Q 008128          429 MHVLEKLIAYGAIPVSVSDAKGYLVDEDGFDYMKISFLRDIKSQQ-RSLRDYSKTYARSKYYDEAKPWNERCDVAFPCAS  507 (577)
Q Consensus       429 ~~aA~~L~e~GAkVVaISDs~G~Iydp~GLD~e~L~~l~~~k~~~-g~l~~y~~~~p~a~~i~~~eil~~~cDIlIPcA~  507 (577)
                      +++|++|++.|+|||++||++|+||||+|||+++|..+++.|..+ +++.+|.+.+ ++++++++++|+++||||+|||+
T Consensus       248 ~~aa~~L~e~GakvVavsD~~G~i~d~~Gid~e~l~~l~e~k~~~~g~v~~~~~~~-g~~~~~~~~i~~~~~DI~iPcAl  326 (450)
T 4fcc_A          248 QYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKSSRDGRVADYAKEF-GLVYLEGQQPWSVPVDIALPCAT  326 (450)
T ss_dssp             HHHHHHHHHTTCEEEEEEETTEEEECTTCCCHHHHHHHHHHHTSTTCCHHHHHHHH-TCEEEETCCGGGSCCSEEEECSC
T ss_pred             HHHHHHHHhcCCeEEEEecCCceEEeCCCCCHHHHHHHHHHhcccCCccccccccC-CcEEecCcccccCCccEEeeccc
Confidence            999999999999999999999999999999999998888877644 6777776554 78899999999999999999999


Q ss_pred             ccccchhhHhhhhccCceEEEecCCCCCCHHHHHHHHhCCcEEecchhccccceeehhhhhccc
Q 008128          508 QNEIDQSDAINLVNSGCRILVEGSNMPCTPEAVDVLKKANVLIAPAMAAGAGGVRYSIFYSTCF  571 (577)
Q Consensus       508 ~n~It~enA~~l~~~~akiVvEgAN~p~T~eA~~iL~~rGI~viPD~~aNAGGVivS~~Ev~~~  571 (577)
                      +|+||.+||++|..++||+|+||||+|+||||+++|++|||+|+||+++||||||+||||+.-+
T Consensus       327 ~~~I~~~~a~~L~a~g~k~IaEgAN~p~t~eA~~iL~~rGIl~~PD~~aNAGGVi~S~~E~~qn  390 (450)
T 4fcc_A          327 QNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQN  390 (450)
T ss_dssp             TTCBCHHHHHHHHHTTCCEEECCSSSCBCHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHH
T ss_pred             cccccHHHHHHHHhcCceEEecCCCCCCCHHHHHHHHHCCCEEEChHHhcCccHhhhHHHHhhh
Confidence            9999999999998889999999999999999999999999999999999999999999999643
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 577
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 2e-67
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 3e-56
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 8e-54
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 4e-53
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 7e-53
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 1e-40
d1hwxa1 293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 1e-34
d1b26a1234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 2e-34
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 2e-32
d1gtma1239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 5e-31
d1leha2134 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus 3e-25
d1c1da2148 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh 7e-24
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 6e-21
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 9e-13
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]

 Score =  215 bits (548), Expect = 2e-67
 Identities = 104/194 (53%), Positives = 143/194 (73%), Gaps = 3/194 (1%)

Query: 190 SKTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHY--VNIMERLLEPERMIVF 247
           SK    ++    K+   E EF+Q+V+E L +L  V+  +  Y  V ++ER++ PER+I F
Sbjct: 1   SKYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMVIPERVIEF 60

Query: 248 RVPWVDDRGETHVNRGFRVQFSQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYK 307
           RVPW DD G+ HVN G+RVQF+ A+GP +GGLRF PS+NLSI KFLGFEQ  K++L+   
Sbjct: 61  RVPWEDDNGKVHVNTGYRVQFNGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLP 120

Query: 308 LGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDLPSEEMGVGTREMGYLFGQY 367
           +GGA GGSDFDP GKSD E+MRFCQ+FM E++R++GPD D+P+ ++GVG RE+GY++GQY
Sbjct: 121 MGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDVPAGDLGVGAREIGYMYGQY 180

Query: 368 RRLAGHFQ-GSFTG 380
           R++ G F  G  TG
Sbjct: 181 RKIVGGFYNGVLTG 194
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query577
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 99.98
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.46
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.46
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 97.4
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.3
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.97
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.91
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.76
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.63
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.56
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.5
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.38
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.37
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.35
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.32
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.27
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.25
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.15
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.13
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.09
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.01
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.98
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.94
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.85
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.78
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.75
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.75
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.74
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.72
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.68
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.57
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.55
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.55
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.52
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.43
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.29
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.07
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.03
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.91
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.86
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.84
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.84
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.81
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.8
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.78
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.75
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.74
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.73
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.63
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.63
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.62
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 94.48
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.45
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.38
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.22
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.16
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.1
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.03
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.9
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.87
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.71
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.59
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.54
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.53
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.42
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.28
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.26
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.15
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.09
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 93.05
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 93.04
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.88
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.73
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.51
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.27
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.17
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.12
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.11
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.1
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.09
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.05
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.99
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.88
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 91.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 91.76
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.73
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.65
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 91.42
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.13
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.08
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 91.05
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 90.44
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 90.37
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 90.37
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.34
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 90.33
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 90.22
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.04
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 89.9
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 89.8
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.74
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 89.57
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 89.55
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 89.52
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 89.29
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 89.21
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 89.06
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.05
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.02
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 89.02
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 88.94
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.85
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.72
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 88.6
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 88.53
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.48
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.45
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 88.32
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.3
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.15
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 88.14
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 88.04
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.89
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 87.85
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.84
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 87.8
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.77
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.76
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.75
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 87.7
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 87.68
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.47
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.19
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 87.18
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 87.14
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 87.09
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 86.39
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 86.37
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 86.23
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 86.01
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 85.93
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 85.93
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.69
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 85.69
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 85.63
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 85.5
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 85.48
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 85.42
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 85.27
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 85.24
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 85.12
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 85.05
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 85.01
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.91
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 84.7
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 84.69
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 84.67
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 84.65
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.56
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.45
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 84.38
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.31
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.22
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 84.09
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 83.78
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 83.74
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.74
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 83.7
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.59
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 83.43
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 83.4
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 83.38
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 83.2
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 83.08
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 83.08
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 83.03
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 82.79
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 82.68
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 82.36
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 82.34
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.33
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.3
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 82.28
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 82.14
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.08
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 82.01
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 81.98
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 81.87
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 81.83
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 81.66
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 81.46
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 81.42
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 81.31
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.19
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 80.92
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.85
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 80.21
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 80.13
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 80.05
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.02
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]

Probab=100.00  E-value=2e-66  Score=499.40  Aligned_cols=190  Identities=54%  Similarity=1.029  Sum_probs=185.6

Q ss_pred             hhHHHHHHHHhhcCCCCccHHHHHHHHHHHHHHHHHhCccch--HHHHhhcCCCeEEEEEEeEECCCCceEEEEEEEEEe
Q 008128          191 KTAGSIVEAALKRDPHEIEFIQSVQESLHALERVIAKNSHYV--NIMERLLEPERMIVFRVPWVDDRGETHVNRGFRVQF  268 (577)
Q Consensus       191 ~~~~~~~~~~~~~~~~~~ef~qav~~~~~~~~~~~~~~p~y~--~~le~l~~Per~i~~rvp~~dd~G~~~v~~GyRVqh  268 (577)
                      +.++.+++++.+|+|+||||+|||.|++++++|+++++|+|.  +++++|++|+|+|+|+|||+||+|++++|+||||||
T Consensus         2 ~~~~~~~~~v~~rnp~EpeF~QaV~Ev~~sl~~~i~~~p~y~~~~i~e~l~~P~r~i~~~~p~~~d~G~~~~~~gyRvqh   81 (194)
T d1bgva2           2 KYVDRVIAEVEKKYADEPEFVQTVEEVLSSLGPVVDAHPEYEEVALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQF   81 (194)
T ss_dssp             HHHHHHHHHHHHHTTTCHHHHHHHHHHHHTTHHHHHTCHHHHHTTHHHHHTSCSEEEEEEEEEECTTSCEEEEEEEEEEE
T ss_pred             hhHHHHHHHHHhhCCCChHHHHHHHHHHHHHHHHHHhCHHHHHHHHHHHHcCCCeEEEEEEEEEecCCcEEEEeeEEEEe
Confidence            467899999999999999999999999999999999999998  599999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCeeeecCCCHHHHHHHhHHhHHhhhccCCCCCCceEEEecCCCCCCHHHHHHHHHHHHHHHhhhcCCCccc
Q 008128          269 SQALGPCRGGLRFHPSMNLSIAKFLGFEQTLKNALSPYKLGGAAGGSDFDPKGKSDNEIMRFCQSFMNEIHRYLGPDKDL  348 (577)
Q Consensus       269 s~alGPakGGlRfhp~vt~~evk~LA~~MT~KnAL~gLP~GGaKGGI~~DP~~~s~~Eler~~r~f~~eL~~~IGp~~DV  348 (577)
                      |+++|||||||||||++|++|+++||++|||||||++||||||||||++||+.+|+.|++|+||+|+++|.++|||++||
T Consensus        82 n~~lGP~kGGiR~~~~v~~~ev~~La~~MT~K~Al~~lp~GGgKggi~~dP~~~s~~el~r~~r~~~~~l~~~ig~~~DI  161 (194)
T d1bgva2          82 NGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLPMGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDV  161 (194)
T ss_dssp             ECSSSSEEEEEEECTTCCHHHHHHHHHHHHHHHHHTSSSCCEEEEEESCCCTTCCHHHHHHHHHHHHHHHGGGCBTTTEE
T ss_pred             cCCcCCcCCCeeecCcCCHHHHHHHHHHHHHhhhhcCCCcccccceeccCCCCCCHHHHHHHHHHHHHHhccccCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcCChhHHHHHHHHhhhhhCCc-cccccC
Q 008128          349 PSEEMGVGTREMGYLFGQYRRLAGHF-QGSFTG  380 (577)
Q Consensus       349 papDvGt~~~em~~i~~~y~~~~g~~-~g~vTG  380 (577)
                      |||||||+++||+||+|+|+++.|.+ .||+||
T Consensus       162 pApDvgt~~~eM~wi~d~y~~~~g~~~~gvvTG  194 (194)
T d1bgva2         162 PAGDLGVGAREIGYMYGQYRKIVGGFYNGVLTG  194 (194)
T ss_dssp             EECBTTBCHHHHHHHHHHHHHHHTSCCGGGSSS
T ss_pred             cCCcCCCCHHHHHHHHHHHHHhcCCCCCeeecC
Confidence            99999999999999999999999975 699997
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure