Citrus Sinensis ID: 008244
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 573 | ||||||
| 225456155 | 590 | PREDICTED: translocon at the outer membr | 0.924 | 0.898 | 0.777 | 0.0 | |
| 255579275 | 589 | amidase, putative [Ricinus communis] gi| | 0.923 | 0.898 | 0.755 | 0.0 | |
| 224135565 | 592 | amidase family protein [Populus trichoca | 0.923 | 0.893 | 0.744 | 0.0 | |
| 224118646 | 593 | amidase family protein [Populus trichoca | 0.923 | 0.892 | 0.743 | 0.0 | |
| 357521651 | 594 | Glutamyl-tRNA(Gln) amidotransferase subu | 0.923 | 0.890 | 0.716 | 0.0 | |
| 449497473 | 591 | PREDICTED: translocon at the outer membr | 0.924 | 0.896 | 0.735 | 0.0 | |
| 356512970 | 587 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.888 | 0.867 | 0.699 | 0.0 | |
| 449439139 | 585 | PREDICTED: LOW QUALITY PROTEIN: transloc | 0.914 | 0.895 | 0.724 | 0.0 | |
| 356524688 | 591 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.888 | 0.861 | 0.718 | 0.0 | |
| 30684733 | 589 | translocon at the outer membrane of chlo | 0.924 | 0.899 | 0.714 | 0.0 |
| >gi|225456155|ref|XP_002282402.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 [Vitis vinifera] gi|297734325|emb|CBI15572.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 778 bits (2008), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 420/540 (77%), Positives = 473/540 (87%), Gaps = 10/540 (1%)
Query: 1 MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG 60
MAS SANLWVLLGLGLAG+LLMT+KLKK I++DFGAF+++LQLLPPPQP PPKAPHPLT
Sbjct: 1 MASSSANLWVLLGLGLAGVLLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPHPLTN 60
Query: 61 LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI 120
LSFAVSD+FDIEGYVTGFG+P+WARTH ASRTS VVS LVEGGATC GKTVVDE AYSI
Sbjct: 61 LSFAVSDVFDIEGYVTGFGNPDWARTHDTASRTSPVVSALVEGGATCTGKTVVDEMAYSI 120
Query: 121 NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF 180
NG NKHY TPTNPAAPS++PGGSSSGAAVAVAA+ VDFSLG+DTVGGVRVP+AFCG++GF
Sbjct: 121 NGENKHYGTPTNPAAPSRIPGGSSSGAAVAVAANFVDFSLGLDTVGGVRVPAAFCGVIGF 180
Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
RPS+GAVSHMGII +S+SLDTVGWFA+DP ILR VGHVLLQL +A QRSPRQII ADDCF
Sbjct: 181 RPSHGAVSHMGIIHVSSSLDTVGWFAKDPSILRRVGHVLLQLTYAVQRSPRQIIFADDCF 240
Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFH--KTNGELKN--- 295
+ L+IP DRV QVV+KSTEKLFGRQVLK ENL Y DSKVPSLK FH KTNGE +N
Sbjct: 241 QSLRIPVDRVYQVVLKSTEKLFGRQVLKRENLENYLDSKVPSLKAFHSQKTNGETRNSLI 300
Query: 296 -----VMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
+M +QR+EFK+NH EWI SVKP LD IS+++ ++LE+++T IENC+S R E+R
Sbjct: 301 RSLVKIMHCLQRHEFKHNHEEWINSVKPILDASISSQLHDVLEVADTEIENCQSSRMEIR 360
Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
SA++SLLKDDGILV PT A PPPKLGGKE LSE+YQNR LLSIAS+SGCCQVTVPLG
Sbjct: 361 SALNSLLKDDGILVIPTVADPPPKLGGKESLSEEYQNRTLGLLSIASMSGCCQVTVPLGL 420
Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
YDK P SVSF+ARHGGDRFLLDTVQ MYASLQEQADIA KSKLS+N +++ SAEIAKEK
Sbjct: 421 YDKYPVSVSFMARHGGDRFLLDTVQTMYASLQEQADIAAKSKLSSNAVDRETSAEIAKEK 480
Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
GNQA+KDKQW KA+ FYTEAIKL+GNNATYYSNRAAAYLE GSFLQAEADCT+AINLDKK
Sbjct: 481 GNQAFKDKQWQKAVGFYTEAIKLSGNNATYYSNRAAAYLEMGSFLQAEADCTEAINLDKK 540
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579275|ref|XP_002530483.1| amidase, putative [Ricinus communis] gi|223529980|gb|EEF31906.1| amidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224135565|ref|XP_002322105.1| amidase family protein [Populus trichocarpa] gi|222869101|gb|EEF06232.1| amidase family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224118646|ref|XP_002317872.1| amidase family protein [Populus trichocarpa] gi|222858545|gb|EEE96092.1| amidase family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357521651|ref|XP_003631114.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] gi|355525136|gb|AET05590.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449497473|ref|XP_004160411.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356512970|ref|XP_003525187.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449439139|ref|XP_004137345.1| PREDICTED: LOW QUALITY PROTEIN: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356524688|ref|XP_003530960.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30684733|ref|NP_188424.2| translocon at the outer membrane of chloroplasts 64-III [Arabidopsis thaliana] gi|75335547|sp|Q9LVH5.1|OE64C_ARATH RecName: Full=Outer envelope protein 64, chloroplastic; AltName: Full=Translocon at the outer membrane of chloroplasts 64-III gi|9294499|dbj|BAB02718.1| unnamed protein product [Arabidopsis thaliana] gi|332642509|gb|AEE76030.1| translocon at the outer membrane of chloroplasts 64-III [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 573 | ||||||
| TAIR|locus:2088600 | 589 | TOC64-III "translocon at the o | 0.924 | 0.899 | 0.620 | 3.5e-178 | |
| UNIPROTKB|Q9MUK5 | 593 | TOC64 "Translocon at the outer | 0.924 | 0.893 | 0.603 | 1.3e-171 | |
| TAIR|locus:2184757 | 603 | TOC64-V "AT5G09420" [Arabidops | 0.884 | 0.840 | 0.478 | 9.9e-126 | |
| TAIR|locus:2036029 | 425 | AMI1 "AT1G08980" [Arabidopsis | 0.705 | 0.950 | 0.465 | 6.8e-95 | |
| UNIPROTKB|Q60AB7 | 341 | MCA0950 "Amidase family protei | 0.572 | 0.961 | 0.311 | 2.4e-37 | |
| TIGR_CMR|DET_1335 | 486 | DET_1335 "glutamyl-tRNA(Gln) a | 0.190 | 0.224 | 0.376 | 9.2e-17 | |
| TIGR_CMR|CHY_1102 | 485 | CHY_1102 "glutamyl-tRNA(Gln) a | 0.322 | 0.381 | 0.310 | 2.5e-16 | |
| UNIPROTKB|Q936X3 | 457 | atzE "Biuret hydrolase" [Pseud | 0.249 | 0.312 | 0.326 | 3.7e-16 | |
| SGD|S000004907 | 464 | HER2 "Subunit of the trimeric | 0.209 | 0.258 | 0.382 | 4.1e-16 | |
| CGD|CAL0003013 | 450 | orf19.3956 [Candida albicans ( | 0.209 | 0.266 | 0.341 | 5.8e-15 |
| TAIR|locus:2088600 TOC64-III "translocon at the outer membrane of chloroplasts 64-III" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1711 (607.4 bits), Expect = 3.5e-178, Sum P(2) = 3.5e-178
Identities = 335/540 (62%), Positives = 397/540 (73%)
Query: 1 MASQSANXXXXXXXXXXXXXXMTKKLKKNIKQDFGAFIEXXXXXXXXXXXXXXXXXXXTG 60
MASQ+AN +TKKLKK +++DFGAFI+ TG
Sbjct: 1 MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG 60
Query: 61 LSFAVSDLFDIEGYVTGFGHPEWXXXXXXXXXXXXXXXXLVEGGATCIGKTVVDEFAYSI 120
L+FAVSD+FDI GYVTGFGHP+W LVEGGATC+GKTVVDEFA+SI
Sbjct: 61 LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI 120
Query: 121 NGTNKHYDTPTNPAAPSQMPXXXXXXXXXXXXXDLVDFSLGIDTVGGVRVPSAFCGILGF 180
+G NKHYD+PTNPAAP+++P + VDF+LGIDTVGGVRVP+ +CG+LGF
Sbjct: 121 SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF 180
Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
+ SYGA+S+ GIIP+S+SLD+VGWFARDP LR VGHVLLQLPFA QR+PRQII+ADDCF
Sbjct: 181 KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF 240
Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKT----NGE---- 292
+LLKIP DR+ QVV KS EKLFGRQ+LKH+NL YF++KVPSLK F +T N +
Sbjct: 241 QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS 300
Query: 293 --LKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
L NVM+L+QR+EF NH +WI +VKPA+DP I +++ E E++ EN +IRNE R
Sbjct: 301 RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR 360
Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
AI SLLKDDGILV PT PPKLG KE+ SEDYQNRA SLLSIAS+SGCCQVTVPLG+
Sbjct: 361 VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH 420
Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
++KCP SVSFI RHGGDRFLLDTVQ MY SLQE + I T K S +++SAEIAKEK
Sbjct: 421 HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK 480
Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
GNQA+K+K W KAI Y+EAIKL+ NNATYYSNRAAAYLE G FLQAE DCTKAI LDKK
Sbjct: 481 GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK 540
|
|
| UNIPROTKB|Q9MUK5 TOC64 "Translocon at the outer membrane of chloroplasts 64" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184757 TOC64-V "AT5G09420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036029 AMI1 "AT1G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60AB7 MCA0950 "Amidase family protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1335 DET_1335 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1102 CHY_1102 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q936X3 atzE "Biuret hydrolase" [Pseudomonas sp. ADP (taxid:47660)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004907 HER2 "Subunit of the trimeric GatFAB AmidoTransferase(AdT) complex" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003013 orf19.3956 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 573 | |||
| PLN02722 | 422 | PLN02722, PLN02722, indole-3-acetamide amidohydrol | 0.0 | |
| PRK08310 | 395 | PRK08310, PRK08310, amidase; Provisional | 1e-121 | |
| COG0154 | 475 | COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf | 3e-64 | |
| pfam01425 | 431 | pfam01425, Amidase, Amidase | 8e-55 | |
| TIGR00132 | 460 | TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a | 4e-43 | |
| PRK09201 | 465 | PRK09201, PRK09201, amidase; Provisional | 5e-43 | |
| PRK07056 | 454 | PRK07056, PRK07056, amidase; Provisional | 1e-41 | |
| PRK06102 | 452 | PRK06102, PRK06102, hypothetical protein; Provisio | 3e-41 | |
| TIGR02715 | 452 | TIGR02715, amido_AtzE, amidohydrolase, AtzE family | 5e-40 | |
| PRK00012 | 459 | PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf | 9e-39 | |
| PRK08186 | 600 | PRK08186, PRK08186, allophanate hydrolase; Provisi | 7e-38 | |
| TIGR02713 | 561 | TIGR02713, allophanate_hyd, allophanate hydrolase | 4e-37 | |
| PRK05962 | 424 | PRK05962, PRK05962, amidase; Validated | 4e-33 | |
| PRK07488 | 472 | PRK07488, PRK07488, indole acetimide hydrolase; Va | 3e-32 | |
| PRK07139 | 439 | PRK07139, PRK07139, amidase; Provisional | 1e-27 | |
| PRK07235 | 502 | PRK07235, PRK07235, amidase; Provisional | 4e-24 | |
| PRK12470 | 462 | PRK12470, PRK12470, amidase; Provisional | 3e-23 | |
| PRK06170 | 490 | PRK06170, PRK06170, amidase; Provisional | 7e-22 | |
| PRK06169 | 466 | PRK06169, PRK06169, putative amidase; Provisional | 5e-21 | |
| PRK07486 | 484 | PRK07486, PRK07486, amidase; Provisional | 5e-21 | |
| PRK08137 | 497 | PRK08137, PRK08137, amidase; Provisional | 2e-19 | |
| PRK06707 | 536 | PRK06707, PRK06707, amidase; Provisional | 6e-19 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 3e-18 | |
| PRK06828 | 491 | PRK06828, PRK06828, amidase; Provisional | 5e-18 | |
| PRK06061 | 483 | PRK06061, PRK06061, amidase; Provisional | 7e-17 | |
| PRK07487 | 469 | PRK07487, PRK07487, amidase; Provisional | 1e-15 | |
| PRK11910 | 615 | PRK11910, PRK11910, amidase; Provisional | 4e-14 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-14 | |
| PRK07042 | 464 | PRK07042, PRK07042, amidase; Provisional | 1e-13 | |
| PRK07869 | 468 | PRK07869, PRK07869, amidase; Provisional | 9e-13 | |
| PRK06529 | 482 | PRK06529, PRK06529, amidase; Provisional | 3e-10 | |
| PRK06565 | 566 | PRK06565, PRK06565, amidase; Validated | 5e-09 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 2e-08 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 5e-08 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 3e-07 | |
| PRK05962 | 424 | PRK05962, PRK05962, amidase; Validated | 1e-04 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 7e-04 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 0.002 | |
| pfam13431 | 34 | pfam13431, TPR_17, Tetratricopeptide repeat | 0.004 |
| >gnl|CDD|166363 PLN02722, PLN02722, indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
Score = 537 bits (1385), Expect = 0.0
Identities = 239/421 (56%), Positives = 303/421 (71%), Gaps = 16/421 (3%)
Query: 33 DFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASR 92
D+GAF+EK L P PL GL+FAV D+FD+EGYVTGFG+P+WARTHSAA+
Sbjct: 6 DYGAFMEKFVL----SPTSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATS 61
Query: 93 TSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVA 152
T+ V ++ GGATC+GKT++DE AYSING N HY TPTNP AP ++PGGSSSG+AVAV
Sbjct: 62 TAPAVLAVLRGGATCVGKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVG 121
Query: 153 ADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKIL 212
A LVDFSLG DT G VRVP+++CGI GFRPS+GAVS +G+IP++ S DTVGWFARDP IL
Sbjct: 122 AKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGVIPMAQSFDTVGWFARDPVIL 181
Query: 213 RHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGR-QVLKHEN 271
+ VGHVLLQ P P QIIIA+DCF+L IP DR+VQV++KS EKLFG ++KH N
Sbjct: 182 KRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIVKHVN 241
Query: 272 LGEYFDSKVPSLKGF-HKTNGE----------LKNVMRLIQRYEFKNNHNEWIESVKPAL 320
LG+Y + KVPSLK F K E L + MRL+QRYEFK NH EWI +VKP
Sbjct: 242 LGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEF 301
Query: 321 DPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEM 380
P IS I E + +E I+ C+S++ E+R+A+++LL + G+LV PT PPPKL
Sbjct: 302 GPGISERIWEAVRTTEEKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPT 361
Query: 381 LSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS 440
E ++ RAFSLLSIA VSG CQV++PLG +D P SVS +A+HG D FLL+ V+++Y +
Sbjct: 362 TLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVSVSLLAKHGSDGFLLNLVESLYGT 421
Query: 441 L 441
+
Sbjct: 422 I 422
|
Length = 422 |
| >gnl|CDD|181375 PRK08310, PRK08310, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216494 pfam01425, Amidase, Amidase | Back alignment and domain information |
|---|
| >gnl|CDD|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236409 PRK09201, PRK09201, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235921 PRK07056, PRK07056, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235698 PRK06102, PRK06102, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233982 TIGR02715, amido_AtzE, amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >gnl|CDD|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236177 PRK08186, PRK08186, allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233981 TIGR02713, allophanate_hyd, allophanate hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236030 PRK07488, PRK07488, indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235945 PRK07139, PRK07139, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235979 PRK07235, PRK07235, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171524 PRK12470, PRK12470, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235723 PRK06170, PRK06170, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180437 PRK06169, PRK06169, putative amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236028 PRK07486, PRK07486, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236161 PRK08137, PRK08137, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235855 PRK06707, PRK06707, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|180715 PRK06828, PRK06828, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235686 PRK06061, PRK06061, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236029 PRK07487, PRK07487, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183377 PRK11910, PRK11910, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|235915 PRK07042, PRK07042, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180608 PRK06529, PRK06529, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180626 PRK06565, PRK06565, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 573 | |||
| COG0154 | 475 | GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su | 100.0 | |
| PLN02722 | 422 | indole-3-acetamide amidohydrolase | 100.0 | |
| PRK09201 | 465 | amidase; Provisional | 100.0 | |
| TIGR02715 | 452 | amido_AtzE amidohydrolase, AtzE family. Members of | 100.0 | |
| PRK05962 | 424 | amidase; Validated | 100.0 | |
| PRK07487 | 469 | amidase; Provisional | 100.0 | |
| PRK06102 | 452 | hypothetical protein; Provisional | 100.0 | |
| PRK06169 | 466 | putative amidase; Provisional | 100.0 | |
| PRK08310 | 395 | amidase; Provisional | 100.0 | |
| PRK07056 | 454 | amidase; Provisional | 100.0 | |
| PRK07486 | 484 | amidase; Provisional | 100.0 | |
| PRK07042 | 464 | amidase; Provisional | 100.0 | |
| PRK06170 | 490 | amidase; Provisional | 100.0 | |
| PRK07235 | 502 | amidase; Provisional | 100.0 | |
| PRK12470 | 462 | amidase; Provisional | 100.0 | |
| PRK07488 | 472 | indole acetimide hydrolase; Validated | 100.0 | |
| PRK06061 | 483 | amidase; Provisional | 100.0 | |
| TIGR00132 | 460 | gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) | 100.0 | |
| PRK06529 | 482 | amidase; Provisional | 100.0 | |
| PRK00012 | 459 | gatA aspartyl/glutamyl-tRNA amidotransferase subun | 100.0 | |
| PRK07869 | 468 | amidase; Provisional | 100.0 | |
| PRK08186 | 600 | allophanate hydrolase; Provisional | 100.0 | |
| PRK08137 | 497 | amidase; Provisional | 100.0 | |
| PRK07139 | 439 | amidase; Provisional | 100.0 | |
| TIGR02713 | 561 | allophanate_hyd allophanate hydrolase. Allophanate | 100.0 | |
| PRK06828 | 491 | amidase; Provisional | 100.0 | |
| PF01425 | 441 | Amidase: Amidase; InterPro: IPR000120 Amidase sign | 100.0 | |
| PRK11910 | 615 | amidase; Provisional | 100.0 | |
| PRK06707 | 536 | amidase; Provisional | 100.0 | |
| PRK06565 | 566 | amidase; Validated | 100.0 | |
| KOG1211 | 506 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG1212 | 560 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.71 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.58 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.46 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.43 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.41 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.36 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.32 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.3 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.28 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.22 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.22 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.18 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.16 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 99.15 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.12 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.1 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.1 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.09 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.08 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 99.06 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.02 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.0 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.99 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.99 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.97 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.94 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.92 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.91 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.91 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.9 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.87 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.85 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.85 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.83 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.83 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.81 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.81 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.79 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.78 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.78 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.78 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.75 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.75 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.74 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.74 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.73 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.72 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.72 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.71 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.68 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.64 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.64 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.63 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.63 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.62 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.62 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.61 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.59 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.58 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.54 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.54 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.52 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.52 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.51 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.49 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.48 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.47 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.46 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.45 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.45 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.44 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.37 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.37 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.37 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.35 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.35 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.31 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.31 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.31 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.3 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.3 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.29 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.29 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.27 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.26 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.24 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.24 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.22 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.22 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.2 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.19 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.18 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.18 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.16 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.16 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.16 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.15 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.15 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.11 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.11 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.09 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.07 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.07 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.07 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.06 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.06 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.04 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.02 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.01 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.99 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.97 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.97 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.94 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 97.92 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 97.92 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.92 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.91 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.85 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.85 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.83 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 97.81 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.81 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.78 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.77 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 97.76 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.74 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.71 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.71 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.71 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.69 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.68 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.67 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.67 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.67 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.65 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 97.65 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.65 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.64 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.62 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.62 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.61 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.6 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.58 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.56 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.55 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.5 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.49 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.48 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.44 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.44 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.43 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.42 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.41 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.4 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.38 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.36 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.34 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.31 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 97.3 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.3 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.29 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.28 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.27 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.26 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.19 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.17 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.14 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.13 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.13 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.13 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.1 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 97.09 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.08 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.07 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 97.07 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.03 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.02 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.01 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.01 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.0 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 96.96 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.9 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.9 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.8 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 96.76 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 96.76 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 96.75 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.73 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.7 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.67 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.66 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 96.64 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.63 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.6 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 96.56 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 96.54 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.49 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.44 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 96.44 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.42 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.29 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 96.28 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.22 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.18 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.15 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.12 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.11 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.1 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 95.97 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 95.84 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 95.84 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 95.81 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 95.77 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.72 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 95.7 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 95.61 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 95.51 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 95.4 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 95.35 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.18 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 95.17 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.13 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 95.1 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 95.09 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 95.07 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 95.04 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 94.99 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 94.94 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 94.73 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 94.69 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 94.64 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 94.59 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 94.57 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 94.5 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 94.46 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 94.42 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 94.42 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 94.41 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 94.25 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.14 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 94.07 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 93.72 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 93.71 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 93.5 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 93.33 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 93.29 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 93.27 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 93.25 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 93.22 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 93.18 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 93.17 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 93.1 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 93.05 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 92.97 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 92.81 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 92.49 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 92.42 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 92.06 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 92.05 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 92.03 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 91.71 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 91.6 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 91.55 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 90.95 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 90.88 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 90.72 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 90.68 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 90.58 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 90.44 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 90.41 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 89.83 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 89.72 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 89.68 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 89.51 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 89.19 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 89.04 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 88.68 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 88.48 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 88.46 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 88.29 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 88.07 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 87.89 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 87.68 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 87.68 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 87.6 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 85.67 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 85.37 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 84.94 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 83.88 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 83.85 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 83.54 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 83.3 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 83.13 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 82.67 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 82.66 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 81.96 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 81.94 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 81.69 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 81.67 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 81.06 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 80.49 |
| >COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-89 Score=711.60 Aligned_cols=419 Identities=26% Similarity=0.330 Sum_probs=337.8
Q ss_pred hHHHHhhhhhhHHHHHHH---------Hhh--hhcCcccceeeccccCCCC--CC-------CCCCCCCCCCCceeeeec
Q 008244 8 LWVLLGLGLAGILLMTKK---------LKK--NIKQDFGAFIEKLQLLPPP--QP-------LPPKAPHPLTGLSFAVSD 67 (573)
Q Consensus 8 ~~~~~~~~l~~~~~~~~~---------~~~--~~~~~~na~~~~~~~~~~~--~a-------~~~~~~gpL~Gvp~~vKD 67 (573)
+..+++..|++++..++. ++| +.|+.+|||++...+.++. +| ..+...|||+||||+|||
T Consensus 4 ~~~~~~~~l~~~~~~~~~s~~e~~~~~l~ri~~~~~~~na~~~~~~e~a~~~~~A~~~d~~~~~g~~~gpL~GvPiavKD 83 (475)
T COG0154 4 LTELTAAELAALLRAKELSAVELVEAYLARIEALNPDLNAFVAVDPEAALALAEAAAADARLAAGEPLGPLAGVPIAVKD 83 (475)
T ss_pred hhhhhHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCCCCEEEEeChhhcchHHHHHHHHHHHhcCCCCCCcCCceEEEee
Confidence 456678888888666552 233 7889999999999887654 33 124557899999999999
Q ss_pred ccccCCcccCCCchhhhhcCCCCCCChHHHHHHHhCCCeEEeecchhhhhcccCCCCCCCCCCCCCCCCCCCCCCCChHH
Q 008244 68 LFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGA 147 (573)
Q Consensus 68 ~~~~~g~~tt~Gs~~~~~~~~~~~~da~~v~~L~~aGai~~gkt~~~e~~~~~~~~~~~~G~t~NP~~~~~~~GGSSgGs 147 (573)
||+|+|++||+||+.+.+ ++|.+||++|+||+++|||+|||||||||+|+.+|+|++||+|+||||++|+||||||||
T Consensus 84 n~~~~G~~Tt~gS~~l~~--~~p~~DA~vV~rL~~aGaviiGKTNm~Efa~g~~~~~s~~G~t~NP~~~~~~pGGSSgGS 161 (475)
T COG0154 84 NIDTAGLPTTAGSKALED--YVPPYDATVVERLRAAGAVILGKTNMDEFAMGSSTENSAFGPTRNPWNLERVPGGSSGGS 161 (475)
T ss_pred ccccCCCccCccChhhcc--CCCCcCcHHHHHHHHCCCEEEeecCCchhhcCCCCCCCCCCCCCCCCCCCCCCCcCchHH
Confidence 999999999999999986 478999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhcCCccccccCCCCcccccccccCcccccCCCCccccCCCCCCCCCCCcccccccCHHHHHHHHHHhcCCCccc-
Q 008244 148 AVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAA- 226 (573)
Q Consensus 148 aaaVaag~~~~a~GtD~gGSiRiPAa~cGv~GlkPT~G~v~~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~- 226 (573)
||+||+|++|+|+|||||||||+|||||||||||||+||||+.|++|+++++|++|||+|+++|+..+++++.+.+..+
T Consensus 162 AaAVAag~~~~alGSDtGGSIR~PAa~cGvvGlKPT~Grvsr~g~~~~a~sld~~GplartV~D~a~l~~v~~g~D~~d~ 241 (475)
T COG0154 162 AAAVAAGLVPLALGSDTGGSIRIPAAFCGLVGLKPTYGRVSRYGVVPLASSLDQIGPLARTVRDAALLLDVIAGPDPRDS 241 (475)
T ss_pred HHHHHhCCcchhcccCCCCchhhhhhhhCceeeCCCCCccCCCCCccccCCcCccCcccCCHHHHHHHHHHHcCCCCccc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999988754332
Q ss_pred ---------------CCCCceEEEcccchhhcCCChHHHHHHHHHHHHHHc--CCccceeccCCccccccCCChhhhhhh
Q 008244 227 ---------------QRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKT 289 (573)
Q Consensus 227 ---------------~~~~~rl~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~lg~~v~~~~p~~~~~~~~ 289 (573)
..++.||++..+.... ...++++.++++++++.|. |++|++ ...|.+.....
T Consensus 242 ~~~~~~~~~~~~~~~~~~~lrigv~~~~~~~-~~~~~~v~~~~~~a~~~l~~~Ga~v~~---------v~lp~~~~~~~- 310 (475)
T COG0154 242 PLPPPPPVPPALAGKDLKGLRIGVPKELGGG-GPLDPDVRAAFEAAVKALEAAGAEVVE---------VSLPLLSDDYA- 310 (475)
T ss_pred ccccccCccchhhccCCCCcEEEEECccccc-CCCcHHHHHHHHHHHHHHHHCCCEEEe---------ccCCchhhhhh-
Confidence 1233466666665432 2346789999999999986 666632 22332211000
Q ss_pred hhhHHHHHH-HHHHHHHHhhhHH--HHHhhCCCCCHHHHHHHHHhhcCCHHHHHHHHHHHHHH---HHHHHhhcCCCCEE
Q 008244 290 NGELKNVMR-LIQRYEFKNNHNE--WIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEM---RSAISSLLKDDGIL 363 (573)
Q Consensus 290 ~~~l~~~~~-~~~~~e~~~~~~~--~~~~~~~~~~~~~~~~~~~g~~~s~~~~~~a~~~r~~~---~~~~~~~~~~~DvL 363 (573)
...+. .......+..... +.......+++++++++..|..++..+|.++...|... ++.+.++|+++|+|
T Consensus 311 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~ri~~G~~~~~~~~~~a~~~~~~~~~i~~~~~~~f~~~D~l 386 (475)
T COG0154 311 ----LAAYYLARFDGERYGLRAADLYGKTRAEGFGPEVKRRIMLGTYLLSAGYYDAYYRRAQKTLIRRAFDKLFEEVDVL 386 (475)
T ss_pred ----hhHHHHHHhhhhhhhhcchhhhhhhhhhcccHHHHHHHhccccccchHHHHHHHHHHHHHHHHHHHHHHHHhCCEE
Confidence 00010 0000011111111 44555677999999999999999999999998888555 99999999999999
Q ss_pred EEcCCCCCCCCCCC-CCCC-hHHHHHhhhhhhccccccCCceeeecCccC-CCCCceeEEEeccCCcHHHHHHHHHHHHH
Q 008244 364 VTPTTAYPPPKLGG-KEML-SEDYQNRAFSLLSIASVSGCCQVTVPLGYY-DKCPTSVSFIARHGGDRFLLDTVQNMYAS 440 (573)
Q Consensus 364 l~Pt~~~~ap~~~~-~~~~-~~~~~~~~~~~t~~~nl~G~PaisvP~g~~-~glPvGlq~~~~~~~d~~ll~~a~~le~~ 440 (573)
|+||+|.+||++++ .... ....+..+..||.++|++|+|+||||+|++ +|||+||||+|++++|..||+++.++|+.
T Consensus 387 l~Pt~~~~a~~ig~~~~~~~~~~~~~~~~~~t~~~Nl~G~PaisvP~g~~~~GlPvGlqlig~~~~d~~LL~~a~~~E~~ 466 (475)
T COG0154 387 LTPTTPTPAPKIGESESDGDDPLEMYLLDVFTVPANLAGLPAISVPAGFTADGLPVGLQLIGPAFDDATLLRLAAALEQA 466 (475)
T ss_pred EeCCCCCCCcccccccccccCHHHHhhhccccccccccCCCeEEeccCCCCCCCCeeEEEecCCCCHHHHHHHHHHHHHh
Confidence 99999999999997 2111 111222223589999999999999999998 69999999999999999999999999987
Q ss_pred HHH
Q 008244 441 LQE 443 (573)
Q Consensus 441 l~~ 443 (573)
...
T Consensus 467 ~~~ 469 (475)
T COG0154 467 LGW 469 (475)
T ss_pred hCC
Confidence 654
|
|
| >PLN02722 indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
| >PRK09201 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02715 amido_AtzE amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >PRK05962 amidase; Validated | Back alignment and domain information |
|---|
| >PRK07487 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06102 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06169 putative amidase; Provisional | Back alignment and domain information |
|---|
| >PRK08310 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07056 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07486 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07042 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06170 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07235 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK12470 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07488 indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >PRK06061 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >PRK06529 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK07869 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK08186 allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08137 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07139 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02713 allophanate_hyd allophanate hydrolase | Back alignment and domain information |
|---|
| >PRK06828 amidase; Provisional | Back alignment and domain information |
|---|
| >PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence | Back alignment and domain information |
|---|
| >PRK11910 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06707 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06565 amidase; Validated | Back alignment and domain information |
|---|
| >KOG1211 consensus Amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1212 consensus Amidases [Translation, ribosomal structure and biogenesis; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 573 | ||||
| 2dc0_A | 434 | Crystal Structure Of Amidase Length = 434 | 5e-17 | ||
| 2df4_A | 485 | Structure Of Trna-Dependent Amidotransferase Gatcab | 8e-14 | ||
| 3h0l_A | 478 | Structure Of Trna-Dependent Amidotransferase Gatcab | 3e-13 | ||
| 3al0_A | 475 | Crystal Structure Of The Glutamine Transamidosome F | 4e-12 | ||
| 3kfu_E | 471 | Crystal Structure Of The Transamidosome Length = 47 | 8e-12 | ||
| 3a1i_A | 521 | Crystal Structure Of Rhodococcus Sp. N-771 Amidase | 2e-11 | ||
| 3a1k_A | 521 | Crystal Structure Of Rhodococcus Sp. N771 Amidase L | 2e-11 | ||
| 2gi3_A | 476 | Crystal Structure Of Glutamyl-Trna(Gln) Amidotransf | 4e-11 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 2e-10 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 3e-10 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 4e-10 | ||
| 4gyr_A | 621 | Granulibacter Bethesdensis Allophanate Hydrolase Ap | 4e-10 | ||
| 1m21_A | 503 | Crystal Structure Analysis Of The Peptide Amidase P | 8e-10 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 1e-08 | ||
| 1obl_A | 414 | Crystal Structure Of The S133a Mutant Of Malonamida | 5e-08 | ||
| 1o9o_A | 414 | Crystal Structure Of The S131a Mutant Of Malonamida | 5e-08 | ||
| 4gcn_A | 127 | N-Terminal Domain Of Stress-Induced Protein-1 (Sti- | 1e-07 | ||
| 1ock_A | 412 | The Crystal Structure Of Malonamidase E2 From Brady | 4e-07 | ||
| 1obk_A | 414 | Crystal Structure Of The R158q Mutant Of Malonamida | 4e-07 | ||
| 1o9n_A | 414 | Crystal Structure Of The K62a Mutant Of Malonamidas | 5e-07 | ||
| 1obj_A | 414 | Crystal Structure Of The T150a Mutant Of Malonamida | 5e-07 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 5e-07 | ||
| 1o9q_A | 414 | Crystal Structure Of The S155c Mutant Of Malonamida | 5e-07 | ||
| 1obi_A | 414 | Crystal Structure Of The G130a Mutant Of Malonamida | 6e-07 | ||
| 1elr_A | 131 | Crystal Structure Of The Tpr2a Domain Of Hop In Com | 1e-06 | ||
| 3esk_A | 129 | Structure Of Hop Tpr2a Domain In Complex With The N | 1e-06 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 2e-06 | ||
| 3fwv_A | 128 | Crystal Structure Of A Redesigned Tpr Protein, T-Mo | 2e-06 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 2e-06 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 3e-06 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 3e-06 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 5e-06 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 1e-05 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 1e-05 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 2e-05 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 5e-04 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 7e-04 |
| >pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 | Back alignment and structure |
|
| >pdb|2DF4|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 485 | Back alignment and structure |
| >pdb|3H0L|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 | Back alignment and structure |
| >pdb|3AL0|A Chain A, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 475 | Back alignment and structure |
| >pdb|3KFU|E Chain E, Crystal Structure Of The Transamidosome Length = 471 | Back alignment and structure |
| >pdb|3A1I|A Chain A, Crystal Structure Of Rhodococcus Sp. N-771 Amidase Complexed With Benzamide Length = 521 | Back alignment and structure |
| >pdb|3A1K|A Chain A, Crystal Structure Of Rhodococcus Sp. N771 Amidase Length = 521 | Back alignment and structure |
| >pdb|2GI3|A Chain A, Crystal Structure Of Glutamyl-Trna(Gln) Amidotransferase Subunit A (Tm1272) From Thermotoga Maritima At 1.80 A Resolution Length = 476 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|4GYR|A Chain A, Granulibacter Bethesdensis Allophanate Hydrolase Apo Length = 621 | Back alignment and structure |
| >pdb|1M21|A Chain A, Crystal Structure Analysis Of The Peptide Amidase Pam In Complex With The Competitive Inhibitor Chymostatin Length = 503 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|1OBL|A Chain A, Crystal Structure Of The S133a Mutant Of Malonamidase E2 Complexed With Malonate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9O|A Chain A, Crystal Structure Of The S131a Mutant Of Malonamidase E2 Complexed With Malonamate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 | Back alignment and structure |
| >pdb|1OCK|A Chain A, The Crystal Structure Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 412 | Back alignment and structure |
| >pdb|1OBK|A Chain A, Crystal Structure Of The R158q Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9N|A Chain A, Crystal Structure Of The K62a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OBJ|A Chain A, Crystal Structure Of The T150a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|1O9Q|A Chain A, Crystal Structure Of The S155c Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OBI|A Chain A, Crystal Structure Of The G130a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 | Back alignment and structure |
| >pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|3FWV|A Chain A, Crystal Structure Of A Redesigned Tpr Protein, T-Mod(Vmy), In Complex With Meevf Peptide Length = 128 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 573 | |||
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 2e-50 | |
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 6e-43 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 3e-38 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 8e-37 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 4e-04 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 4e-36 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 6e-34 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 1e-33 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 2e-33 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 3e-33 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 1e-31 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 4e-30 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 7e-30 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 8e-30 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 2e-29 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 2e-29 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 3e-29 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 4e-29 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-28 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 4e-28 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 4e-28 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 2e-27 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 1e-26 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 4e-26 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-18 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-13 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 6e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-10 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-05 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 2e-18 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 5e-18 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 2e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 9e-18 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-15 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-10 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 4e-10 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 1e-07 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 6e-06 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-17 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 6e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-09 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 2e-08 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 9e-08 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 7e-04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-17 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-08 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 5e-08 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-08 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-08 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 5e-05 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 1e-15 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 4e-05 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-12 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 2e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-10 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-10 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-09 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-05 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 3e-10 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-10 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 9e-09 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 1e-09 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 1e-08 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 5e-07 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 6e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-09 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-08 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-08 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-08 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-07 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 8e-04 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 4e-09 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 2e-08 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 5e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-09 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-08 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-07 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 4e-05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 5e-04 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 4e-09 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 4e-05 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 3e-04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 9e-09 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-07 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-08 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-07 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-06 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-06 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-08 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-06 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-05 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 4e-08 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 5e-04 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 4e-08 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 4e-08 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-07 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 5e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 5e-08 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 1e-07 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-06 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 2e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-05 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 1e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 1e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-07 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-07 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-07 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 9e-06 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-04 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 1e-07 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 6e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 7e-06 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 2e-07 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 8e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 3e-07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 4e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 5e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 3e-04 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 8e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 3e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 7e-04 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 9e-07 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 5e-06 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 1e-06 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 1e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 7e-06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-04 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 3e-06 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 2e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 9e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 1e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 3e-05 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 8e-05 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 3e-05 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 3e-05 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 8e-05 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 8e-04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 5e-05 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 1e-04 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 5e-04 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 4e-04 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 7e-04 |
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414 | Back alignment and structure |
|---|
Score = 178 bits (453), Expect = 2e-50
Identities = 91/386 (23%), Positives = 148/386 (38%), Gaps = 37/386 (9%)
Query: 53 KAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTV 112
+A PL G++ + D+ D T G + + VV L GAT IGKT
Sbjct: 49 QASGPLRGIAVGIKDIIDTANMPTEMGSEIYRGWQPR--SDAPVVMMLKRAGATIIGKTT 106
Query: 113 VDEFAYSINGTNKHYDTPT-NPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVP 171
FA T T NP PGG+SSG+A AV A ++ +LG T G V P
Sbjct: 107 TTAFASR------DP-TATLNPHNTGHSPGGASSGSAAAVGAGMIPLALGTQTGGSVIRP 159
Query: 172 SAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVL----LQLPFAAQ 227
+A+CG +PS+ + +G+ S +LDTVG F + L +
Sbjct: 160 AAYCGTAAIKPSFRMLPTVGVKCYSWALDTVGLFGARAEDLARGLLAMTGRSEFSGIVPA 219
Query: 228 RSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFH 287
++PR ++ + ++ A++ +Q IK+ E+ G V + L E
Sbjct: 220 KAPRIGVVRQEFAGAVEPAAEQGLQAAIKAAERA-GASVQAID-LPEAVHEAWR------ 271
Query: 288 KTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRN 347
+ +IQ +E + P + A + + ++ + + I
Sbjct: 272 --------IHPIIQDFEAHRALAWEFSEHHDEIAPMLRASLDATVGLTPKEYDEARRIGR 323
Query: 348 EMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVP 407
R + + + +L+T + P + NR ++L+ G V VP
Sbjct: 324 RGRRELGEVFEGVDVLLTYSAPGTAPAKAL-ASTGDPRYNRLWTLM------GNPCVNVP 376
Query: 408 LGYYDKCPTSVSFIARHGGDRFLLDT 433
+ P V IAR G D L T
Sbjct: 377 VLKVGGLPIGVQVIARFGNDAHALAT 402
|
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434 | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521 | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493 | Back alignment and structure |
|---|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Length = 485 | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 471 | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Length = 478 | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Length = 476 | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 573 | |||
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 100.0 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 100.0 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 100.0 | |
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 100.0 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 100.0 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 100.0 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 100.0 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 100.0 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.71 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.61 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.59 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.57 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.49 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.48 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.48 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.48 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.46 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.43 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.43 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.32 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.31 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.31 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.29 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.27 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.27 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.25 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.25 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.25 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.24 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.24 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.23 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.23 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.21 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.21 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.21 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.2 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.2 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.19 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.19 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.19 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.17 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.17 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.16 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.16 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.16 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.16 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.15 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.13 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.13 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.12 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.11 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.1 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.1 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.07 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.07 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.07 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.05 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.05 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.04 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.04 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.04 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.03 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.03 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.03 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.03 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.03 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.02 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.02 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.01 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.01 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.01 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.0 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.99 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.96 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.96 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.95 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.94 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.94 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.93 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 98.92 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.92 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.92 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.91 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.91 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.91 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.9 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.9 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.89 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.88 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.87 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.86 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.86 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.85 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.85 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.85 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 98.85 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.84 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.84 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.84 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.84 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.83 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.83 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.83 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.82 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.82 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.82 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.81 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.81 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.81 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.8 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.8 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.8 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.8 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.79 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.78 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.77 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.77 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.77 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.77 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.76 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.76 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.76 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.76 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.75 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.75 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.74 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.72 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.71 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.71 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.7 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.7 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.68 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.66 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.62 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.61 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.61 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.6 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.59 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.59 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.58 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.57 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.57 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.56 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.55 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.55 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.54 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.54 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.53 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.53 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.52 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.52 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.51 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.5 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.49 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.49 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.48 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.48 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.47 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.44 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.43 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.43 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.42 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.41 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.41 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.41 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.4 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.39 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.39 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.39 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.38 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.36 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.35 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.35 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.34 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.31 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.31 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.3 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.3 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.28 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.25 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.22 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.22 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.21 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.2 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.19 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.17 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.16 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.15 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.1 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.04 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.02 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.01 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.98 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 97.95 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.92 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.91 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.91 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.88 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.84 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.83 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.83 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.83 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 97.71 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.69 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.63 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.59 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.53 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.43 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.41 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.4 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.39 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.35 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.27 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.23 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.22 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.17 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.16 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.14 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.07 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.07 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.01 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.82 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 96.82 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 96.79 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.75 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 96.71 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 96.47 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 96.14 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.56 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 95.37 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.3 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 94.27 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 94.21 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 93.35 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 93.32 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 92.65 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 92.02 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 91.62 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 91.48 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 89.46 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 88.25 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 88.06 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 87.67 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 87.58 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 84.78 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 83.65 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 83.45 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 83.39 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 83.3 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 82.24 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 81.34 |
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-90 Score=720.00 Aligned_cols=404 Identities=25% Similarity=0.334 Sum_probs=341.4
Q ss_pred HhhhhhhHHHHHH-----H----Hhh--hhcCcccceeeccccCCCCCCC-------CCCCCCCCCCceeeeecccccCC
Q 008244 12 LGLGLAGILLMTK-----K----LKK--NIKQDFGAFIEKLQLLPPPQPL-------PPKAPHPLTGLSFAVSDLFDIEG 73 (573)
Q Consensus 12 ~~~~l~~~~~~~~-----~----~~~--~~~~~~na~~~~~~~~~~~~a~-------~~~~~gpL~Gvp~~vKD~~~~~g 73 (573)
++.+|+++++.+| + ++| +.|| +|||++..+++|+++|+ +++..||||||||+|||+|+++|
T Consensus 2 ~~~~l~~~~~~g~~s~~el~~a~l~ri~~~~~-lna~~~~~~~~Al~~A~~~d~~~~~g~~~gpL~GvPi~vKD~~~v~G 80 (434)
T 2dc0_A 2 DLLEAKRLLETGRTTPLALLEEALERAKAFQD-RNALAYLDEEAARKEALALTEELRRGQVRGPLHGLPLTVKDLFPVKG 80 (434)
T ss_dssp CHHHHHHHHHTTSCCHHHHHHHHHHHHHHTGG-GCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEETTSCBTT
T ss_pred CHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCC-CcEEEEcCHHHHHHHHHHHHHHHhcCCCCCCcCCeeEEEEeccccCC
Confidence 5677777766554 2 343 7799 99999998877766542 35668999999999999999999
Q ss_pred cccCCCchhhhhcCCCC-CCChHHHHHHHhCCCeEEeecchhhhhcccCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHh
Q 008244 74 YVTGFGHPEWARTHSAA-SRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVA 152 (573)
Q Consensus 74 ~~tt~Gs~~~~~~~~~~-~~da~~v~~L~~aGai~~gkt~~~e~~~~~~~~~~~~G~t~NP~~~~~~~GGSSgGsaaaVa 152 (573)
++||+||+.+ . ++ .+|+++|+|||+||||++||||||||+++.+|+|++||+|+||||++|+||||||||||+||
T Consensus 81 ~~tt~Gs~~~-~---~~a~~dA~vV~rL~~aGAii~GKTn~~Efa~~~~~~n~~~G~t~NP~~~~~~pGGSSgGsAaaVA 156 (434)
T 2dc0_A 81 MPTRAGTKAP-L---PPLPEEARAVRRLREAGALLFAKTNMHEIALGITGENPWTGPVRNAVDPSRQAGGSSGGSAVAVA 156 (434)
T ss_dssp BCCCTTCSSC-C---CCCCSSCHHHHHHHHTTCEEEEEECCSGGGCCSSCCCTTTCCCBCSSCTTBBCCSSSHHHHHHHH
T ss_pred cccCCCCccc-C---CCCCCCHHHHHHHHHCCCEEEEEeChhHHhcCCCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHH
Confidence 9999999988 2 55 89999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCCccccccCCCCcccccccccCcccccCCCCccccCCCCCCCCCCCcccccccCHHHHHHHHHHhcCCCcccC--CCC
Q 008244 153 ADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQ--RSP 230 (573)
Q Consensus 153 ag~~~~a~GtD~gGSiRiPAa~cGv~GlkPT~G~v~~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~~--~~~ 230 (573)
+|++|+|+|||||||||+||+||||||||||+||||+.|++|+++++|++|||+|+++|+..+++++.+. ..+. .++
T Consensus 157 ag~~~~alGtDtgGSIRiPAa~cGv~GlKPT~G~vs~~g~~~~~~s~d~~Gp~arsv~D~a~~l~~l~g~-~~d~~~~~~ 235 (434)
T 2dc0_A 157 LGIGLASLGTDTGGSIRIPAGFNGVVGFKPSYGRVSLEGALPLSRSTDHAGPLTRSVRDAHFLTEILAGE-SIPLEGVQN 235 (434)
T ss_dssp HTSSSCEEEECSSSTTHHHHHHHTCEEEECSTTSSCCTTSCCSCTTTCCEEEEESSHHHHHHHHHHHHTS-CCCCCCCCS
T ss_pred cCCCceeeecCCChhhhhhHHhCCCEEEECCCCCCCCCCCCCCCCccCeeCcccCCHHHHHHHHHHHhCC-CCCcccccC
Confidence 9999999999999999999999999999999999999999999999999999999999999999998876 3332 345
Q ss_pred ceEEEcccchhhcCCChHHHHHHHHHHHHHHc--CCccceeccCCccccccCCChhhhhhhhhhHHHHHHHHHHHHHHhh
Q 008244 231 RQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNN 308 (573)
Q Consensus 231 ~rl~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~lg~~v~~~~p~~~~~~~~~~~l~~~~~~~~~~e~~~~ 308 (573)
.||++..+.+ ....++++.++++++++.|. |++|++ ++ .| +.+. ...+..+...|.+..
T Consensus 236 lrig~~~~~~--~~~~~~~v~~a~~~a~~~L~~~G~~v~~-~~--------~p-~~~~-------~~~~~~~~~~e~~~~ 296 (434)
T 2dc0_A 236 PVFGVPLDFL--EGRLGVEVRKAFTRLLEDLPALRAEVRE-VS--------LP-LEGV-------YEVYTRLVRYEAARI 296 (434)
T ss_dssp CEEEECHHHH--TTCSCHHHHHHHHHHHHHTTTTTCEEEE-CC--------CC-CTTH-------HHHHHHHHHHHHHHH
T ss_pred CEEEEECccc--cCCCCHHHHHHHHHHHHHHHHCCCEEEE-eC--------CC-cHHH-------HHHHHHHHHHHHHHH
Confidence 6777765433 23358899999999999986 666532 22 22 2211 223333455566667
Q ss_pred hHHHHHhhCCCCCHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHhhcCCCCEEEEcCCCCCCCCCCCCCCC---h-HH
Q 008244 309 HNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEML---S-ED 384 (573)
Q Consensus 309 ~~~~~~~~~~~~~~~~~~~~~~g~~~s~~~~~~a~~~r~~~~~~~~~~~~~~DvLl~Pt~~~~ap~~~~~~~~---~-~~ 384 (573)
+..++....+.+++.++.++..+..++..+|.++++.|..+++++.++|+++|+||+||+|.++|+++..... . ..
T Consensus 297 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~a~~~~~~~~~~~~~~~~ 376 (434)
T 2dc0_A 297 HEKALKEHPEGFSPQVREALLAGLALTEKDYRDAVAEREALRLELVKALRGVDALLLPVQPLPAPPLGTEEVELESGRKG 376 (434)
T ss_dssp SHHHHHHCGGGSCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHTTSSEEEEESCSSSCCBTTCCEEEETTEEEE
T ss_pred HHHHHHhchhhcCHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhcCCEEEECCCCCCCccCcccccccccchhh
Confidence 7777777777899999999999999999999999999999999999999999999999999999999865210 0 11
Q ss_pred HHHhhhhhhccccccCCceeeecCccCCCCCceeEEEeccCCcHHHHHHHHHHHHH
Q 008244 385 YQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS 440 (573)
Q Consensus 385 ~~~~~~~~t~~~nl~G~PaisvP~g~~~glPvGlq~~~~~~~d~~ll~~a~~le~~ 440 (573)
....+..||.++|++|+|+||||+|+.+|||+|||++|++++|..||+++..+|++
T Consensus 377 ~~~~~~~~t~~~nl~G~PaisvP~g~~~GlPvGvqlvg~~~~d~~lL~~A~~lE~~ 432 (434)
T 2dc0_A 377 HREAFITLTLPFSLLGVPTLALPFAKVEGMPVGLQVVGAYGEDGKVLALGGWLEAR 432 (434)
T ss_dssp HHHHHHTTTHHHHHTTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHTT
T ss_pred hhhhhhhhhhhhhhhCCCeEEEecCCCCCCCeEEEEECCCCchHHHHHHHHHHHHh
Confidence 11233568999999999999999998889999999999999999999999999864
|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A | Back alignment and structure |
|---|
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 573 | ||||
| d2gi3a1 | 475 | c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf | 3e-49 | |
| d2f2aa1 | 485 | c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf | 5e-46 | |
| d1m22a_ | 490 | c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon | 4e-27 | |
| d1ocka_ | 412 | c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap | 3e-22 | |
| d1mt5a_ | 537 | c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid | 7e-21 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-11 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-08 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.001 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 1e-10 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 1e-10 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 1e-08 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 8e-07 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-06 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 2e-05 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 5e-05 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 9e-05 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 1e-04 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 3e-04 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 3e-04 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 4e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 7e-04 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 0.001 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 0.001 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 0.003 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Score = 175 bits (445), Expect = 3e-49
Identities = 79/399 (19%), Positives = 155/399 (38%), Gaps = 27/399 (6%)
Query: 57 PLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEF 116
G+ A+ D G T + + +TVV + E G +GK +DEF
Sbjct: 57 KFWGIPVAIKDNILTLGMRTTCASRILE--NYESVFDATVVKKMKEAGFVVVGKANLDEF 114
Query: 117 AYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCG 176
A + + NP ++PGGSS G+A AV+A +V +LG DT G VR P++ CG
Sbjct: 115 AMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCG 174
Query: 177 ILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHV-----------------L 219
++G++P+YG VS G++ ++SLD +G + + + +
Sbjct: 175 VVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDF 234
Query: 220 LQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQV-LKHENLGEYFDS 278
L + + + ++ + +K E+L + +K ++ +
Sbjct: 235 LSEIEEGVSGMKFAVPEEIYEHDIEEGVSERFEEALKLLERLGAKVERVKIPHIKYSVAT 294
Query: 279 KVPSLKGFHKTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEML-----E 333
+N + ++ R + K ++++ ++ I
Sbjct: 295 YYVIAPAEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAA 354
Query: 334 ISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLL 393
E +R ++ ++ +L ++TPT+ K+G + Y F+
Sbjct: 355 YYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFT-- 412
Query: 394 SIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLD 432
A+++G ++VP G+ + P V I R D +
Sbjct: 413 IPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFR 451
|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485 | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 | Back information, alignment and structure |
|---|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 573 | |||
| d2gi3a1 | 475 | Glutamyl-tRNA(Gln) amidotransferase subunit A {The | 100.0 | |
| d2f2aa1 | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta | 100.0 | |
| d1mt5a_ | 537 | Fatty acid amide hydrolase (oleamide hydrolase) {R | 100.0 | |
| d1ocka_ | 412 | Malonamidase E2 {Bradyrhizobium japonicum [TaxId: | 100.0 | |
| d1m22a_ | 490 | Peptide amidase Pam {Stenotrophomonas maltophilia | 100.0 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.58 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.56 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.47 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.44 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.41 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.4 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.38 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.33 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.33 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.25 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.24 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.23 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.22 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.17 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.16 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.15 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.12 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.1 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.09 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.09 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.08 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.07 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.07 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.05 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.03 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.0 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.96 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.92 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.87 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.86 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.79 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.79 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.56 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.5 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.34 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.31 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.28 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.25 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.14 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.13 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.13 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.12 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 97.95 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.82 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.46 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.09 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.06 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 96.85 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.85 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 95.46 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 95.27 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 95.22 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 87.13 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 85.35 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=7.4e-85 Score=692.92 Aligned_cols=386 Identities=22% Similarity=0.312 Sum_probs=311.9
Q ss_pred hhcCcccceeeccccCCCCCCCCCCCCCCCCCceeeeecccccCCcccCCCchhhhhcCCCCCCChHHHHHHHhCCCeEE
Q 008244 29 NIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCI 108 (573)
Q Consensus 29 ~~~~~~na~~~~~~~~~~~~a~~~~~~gpL~Gvp~~vKD~~~~~g~~tt~Gs~~~~~~~~~~~~da~~v~~L~~aGai~~ 108 (573)
++||.|||||+..++.+++ .+||||||||+|||+|+++|++||+||+.+++ +++.+||++|++||++|||++
T Consensus 35 ~~~~~lna~~~~~~~~a~~------~~gpL~GvPi~vKD~~~~~g~~tt~Gs~~~~~--~~~~~da~~v~~L~~aGaii~ 106 (475)
T d2gi3a1 35 RLDPHVKAFISVRENVSVE------KKGKFWGIPVAIKDNILTLGMRTTCASRILEN--YESVFDATVVKKMKEAGFVVV 106 (475)
T ss_dssp HHHHHHCCEEEECCCCCCC------CCSTTTTCEEEEETTBCCSSSCCCTTCGGGTT--CCCCSCCHHHHHHHHHTCEEE
T ss_pred HHCCcCCEEEEcCHHHhhh------ccCCCCCCEEEEEcccCCCCCccCccChhhcC--CCCCCCcceeeehhhcCCccc
Confidence 8899999999998876654 35899999999999999999999999999986 489999999999999999999
Q ss_pred eecchhhhhcccCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHhhcCCccccccCCCCcccccccccCcccccCCCCccc
Q 008244 109 GKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVS 188 (573)
Q Consensus 109 gkt~~~e~~~~~~~~~~~~G~t~NP~~~~~~~GGSSgGsaaaVaag~~~~a~GtD~gGSiRiPAa~cGv~GlkPT~G~v~ 188 (573)
||||||||+++.+|+|.+||+|+||||++++||||||||||+||+|++|+|+|||||||||+||+||||||||||+||||
T Consensus 107 Gktn~~e~~~~~~~~~~~~G~t~nP~~~~~~~GGSSgGsaaavAag~~~~a~GtD~gGSiR~PA~~~Gv~G~kPt~G~i~ 186 (475)
T d2gi3a1 107 GKANLDEFAMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCGVVGYKPTYGLVS 186 (475)
T ss_dssp EEECCSGGGCCSSSTTCSSCCCCBTTBTTBCCCSSSHHHHHHHHTTSSSEEEEEESSSTTHHHHHHHTSEEEECCTTSBC
T ss_pred cccchhhcccccccccchhcccccccccccccCcccccchhhhhhcCcceEeecCCCccchhhhHHhCceeecCCCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCCCCCcccccccCHHHHHHHHHHhcCCCccc----------------CCCCceEEEcccchhhcCCChHHHHH
Q 008244 189 HMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAA----------------QRSPRQIIIADDCFELLKIPADRVVQ 252 (573)
Q Consensus 189 ~~G~~p~~~~~d~~G~~ar~~~d~~~v~~~~~~~~~~~----------------~~~~~rl~i~~~~~~~~~~~~~~~~~ 252 (573)
+.|++|+++++|++|||||+++|+..+++++.+.+..+ ..++.|+.+..+.+ ....++++.+
T Consensus 187 ~~g~~~~~~~~d~~GpmaRsv~D~alll~v~~g~d~~d~~s~~~~~~~~~~~~~~~~~~ri~~~~~~~--~~~~~~~v~~ 264 (475)
T d2gi3a1 187 RYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIEEGVSGMKFAVPEEIY--EHDIEEGVSE 264 (475)
T ss_dssp CTTBCCSCTTTCEEEEEESSHHHHHHHHHHHBSCBTTBTTCCSCCCCSSTTTTSCCTTCEEEEEGGGG--GSCCCHHHHH
T ss_pred CCCCCCCCCCCCccCCccCCHHHHHHHhhhhhccccccccccccccccchhccccccccceeeeeccc--cCCCCHHHHH
Confidence 99999999999999999999999999999887643211 23456776655443 2335788999
Q ss_pred HHHHHHHHHc--CCccceeccCCccccccCCChhhhhhhhhhHHHHHHHHHHHHHHhhhH------------------HH
Q 008244 253 VVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNHN------------------EW 312 (573)
Q Consensus 253 ~~~~a~~~l~--G~~vv~~~~lg~~v~~~~p~~~~~~~~~~~l~~~~~~~~~~e~~~~~~------------------~~ 312 (573)
+++++++.|. |++|++ ++ .|.+.+... .+..+...+....+. .+
T Consensus 265 a~~~a~~~L~~~G~~V~e-v~--------~p~~~~~~~-------~~~~i~~~e~~~~l~~~~~~~~~~~~~~~~~~~~~ 328 (475)
T d2gi3a1 265 RFEEALKLLERLGAKVER-VK--------IPHIKYSVA-------TYYVIAPAEASSNLARFDGVKYGLRIKEKGLREMY 328 (475)
T ss_dssp HHHHHHHHHHHTTCEEEE-EC--------CTTGGGHHH-------HHHHHHHHHHHTC----------------------
T ss_pred HHHHHHHHHHHCCCEEEE-eC--------CCchHHHHH-------HHHHHHHHHHHHHHHHhhcchhhhhcccccHHHHH
Confidence 9999999886 777643 22 233322111 111111122221111 11
Q ss_pred HHhhCCCCCHHHHHHHHHhhcCC-----HHHHHHHHHHHHHHHHHHHhhcCCCCEEEEcCCCCCCCCCCCCCCChHHHHH
Q 008244 313 IESVKPALDPDISAEIGEMLEIS-----ETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQN 387 (573)
Q Consensus 313 ~~~~~~~~~~~~~~~~~~g~~~s-----~~~~~~a~~~r~~~~~~~~~~~~~~DvLl~Pt~~~~ap~~~~~~~~~~~~~~ 387 (573)
.......+.+.++.++..+.... ..++.++.+.|..++..+.++|+++|+||+||++.++|+++....+...+
T Consensus 329 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~ll~Pt~~~~a~~~~~~~~~~~~~-- 406 (475)
T d2gi3a1 329 MKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYY-- 406 (475)
T ss_dssp --CCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSEEEEESCSSCCCBTTTCCCHHHHH--
T ss_pred HhhhhcccCHHHHHHHHhcchhhchHHHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEeCCCCCCCCCcccccchHHHh--
Confidence 22223345677777776664433 33445677888999999999999999999999999999998754322222
Q ss_pred hhhhhhccccccCCceeeecCccCCCCCceeEEEeccCCcHHHHHHHHHHHHHHH
Q 008244 388 RAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYASLQ 442 (573)
Q Consensus 388 ~~~~~t~~~nl~G~PaisvP~g~~~glPvGlq~~~~~~~d~~ll~~a~~le~~l~ 442 (573)
.+..||.++|++|+|+||||+|+++|||+||||+|++++|..||++|++||++..
T Consensus 407 ~~~~~t~~~Nl~G~PaisvP~G~s~GlPvGvQlig~~~~D~~LL~~A~~~E~~~~ 461 (475)
T d2gi3a1 407 LMDIFTIPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIEKNSP 461 (475)
T ss_dssp TTTTTTHHHHHHTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHHHCT
T ss_pred hhhHHHHHHHHHCCCeEEEeCCCCCCCCEeEEEECCCCCHHHHHHHHHHHHHcCC
Confidence 2334899999999999999999999999999999999999999999999997543
|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|