Citrus Sinensis ID: 008260

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570--

MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADIKTSRNYRTSNSDP

cccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccEEcccccccHHHHHHHEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccEEEEEccccEEEccccccccccEEEEcccccccccccccccEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEEEccccccccccccccccccEEEEEEccEEEEEEcccccccccEEEEEEEccccEEEEEEEEccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEcccccccccccccEEEEEcccEEEEEcccccccccccEEEEEccccEEEcccccccccccccccEEEEEccEEEEEEEccccccccccEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHcccccEEEEEcccccccccEEcEEEEEcccccHHHHHHccccEEEEcccccEEEccccccHHHHHHHHHHHHHHHcccccccccccc

ccHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHcccccccccccccccHHHHcccHcHccccccccHHHHHHHHHHHHccccccccccccccccccEEEEEcccccccccccccEEEEcccEEEEEcccccccccccEEEEcccccccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEEccccEEEEccccccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEccccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEcccccccccccEEEEEccccccccccEEEEccccccccccccccccccccccEEEccccccccccccHcHHcccccccEccccccccccccccEEEcccccEEEEEEcccccEEEEEEEcccccHHHHHEEEEHHHHHHHHHHcccccccccccccc

mamarassglaypeRFYAAAsyagfdgspnssakeltskfsnDSALLLYALYQQatvgpcnvpkpsswspveqskwkSWQGLGNMATTEAMRLFVKILeeedpgwysrasnsvaepivdvemnhdskTEAVKengnsfpetktistengnlmetqdkdvvseglgsvvvydqwiappisgqrpkaryehgaavvqdkmyiyggnhngrylsdmhiLDLRSWAWSKIQAKAVAestespspalltpcaghslipwENKLLSiaghtkdpseiIQVKVFdlqtcswstlktygkppvsrggqsvtLVGTSLVIfggedakrsllndlhildletmtwdeidavgvppsprsdhAAAVHAERYLLIfgggshaacfndlhvldlqtmewsrptqqgeiptpraghagvtiGENWFLGLSLVVSSYSGEDVIVAFGgyngrynnevhvlkpshkstlsskmietpvpdsvsavqnntnptrdleselevgqegkiREIVVdnvdseplvcGLRIAMRQKDCTICQFienlsffrfstsasqyyAGSHVICYLFVVTLDFLADiktsrnyrtsnsdp

mamarassglayPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEavkengnsfpetktistengnlmeTQDKDVVSEGLGSVVVYDQWIappisgqrpkaRYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWstlktygkppvsrggqsvTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIEtpvpdsvsavqnntnptrdleselevgqegkireivvdnvdsePLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADiktsrnyrtsnsdp

MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSalllyalyqqaTVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFlglslvvssysgEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADIKTSRNYRTSNSDP

*************ERFYAAASYA********************SALLLYALYQQATVGPCNVPK***W**VEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYS****************************************************VSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAV*********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGV*******HAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSR**********RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVL********************************************KIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADIK************

**********AYPERFYAAASYAG*******************SALLLYALYQQATVG************V*********************LFVKILEEEDPGWYSRASNSVAEPIVDVEMNHD****************KTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKA**********ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQ**EIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKST*************************************KIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLS**************SHVICYLFVVTLDFLADIKT***********

*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNV*************WKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKI**************ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADIKTSR*********

*********LAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVA****SPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGRYNNEVHVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSEPLVCGLRIAMRQKDCTICQFIENLSFFRFSTSASQYYAGSHVICYLFVVTLDFLADIKTS**********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		572	2.2.26 [Sep-21-2011]
Q9MA55		668	Acyl-CoA-binding domain-c	yes	no	0.867	0.742	0.717	0.0
Q8RWD9		648	Acyl-CoA-binding domain-c	no	no	0.853	0.753	0.684	0.0
Q7M3S9		943	RING finger protein B OS=	no	no	0.398	0.241	0.3	2e-25
Q5EA50		372	Rab9 effector protein wit	yes	no	0.405	0.623	0.280	1e-20
P51611		2090	Host cell factor 1 OS=Mes	N/A	no	0.374	0.102	0.286	3e-20
Q61191		2045	Host cell factor 1 OS=Mus	yes	no	0.374	0.104	0.286	3e-20
P51610		2035	Host cell factor 1 OS=Hom	yes	no	0.374	0.105	0.286	6e-20
Q9V4C8		1500	Host cell factor OS=Droso	no	no	0.438	0.167	0.280	7e-20
Q7Z6M1		372	Rab9 effector protein wit	no	no	0.402	0.618	0.266	5e-19
Q58CV6		382	Kelch domain-containing p	no	no	0.444	0.664	0.273	5e-19

>sp\|Q9MA55\|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1	Back alignment and function desciption

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/538 (71%), Positives = 439/538 (81%), Gaps = 42/538 (7%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAM RA+SG AYPERFYAAASY G DGS +SSAK + SKF +D+ALLLYALYQQATVGPC
Sbjct: 1   MAMPRATSGPAYPERFYAAASYVGLDGS-DSSAKNVISKFPDDTALLLYALYQQATVGPC 59

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           N PKPS+W PVEQSKWKSWQGLG M + EAMRLFVKILEE+DPGWYSRASN + +P+VDV
Sbjct: 60  NTPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEDDPGWYSRASNDIPDPVVDV 119

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++N  +K E V ENG++F ETKTISTENG L ETQDKDVVSE   +V VY+QW AP  SG
Sbjct: 120 QINR-AKDEPVVENGSTFSETKTISTENGRLAETQDKDVVSEDSNTVSVYNQWTAPQTSG 178

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAV+QDKMYIYGGNHNGRYL D+H+LDL+SW WS+++ K   ES E+ +P
Sbjct: 179 QRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESQETSTP 238

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
            LL PCAGHSLI W+NKLLSI GHTKDPSE +QVKVFD  T +WS LKTYGKPPVSRGGQ
Sbjct: 239 TLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGKPPVSRGGQ 298

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVT+VG +LVIFGG+DAKRSLLNDLHILDL+TMTWDEIDAVGV PSPRSDHAAAVHAER+
Sbjct: 299 SVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERF 358

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           LLIFGGGSHA CF+DLHVLDLQTMEWSRP QQG+ PTPRAGHAGVTIGENWF+       
Sbjct: 359 LLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNK 418

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSLVVSSY+GEDV+VAFGGYNGRYNNE+
Sbjct: 419 SGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEI 478

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVD 500
           ++LKPSHKSTL +K +E P+P S+SAV N T  TRD+ESE+EV QEG++REIV+DNV+
Sbjct: 479 NLLKPSHKSTLQTKTLEAPLPGSLSAVNNAT--TRDIESEVEVSQEGRVREIVMDNVN 534

Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8RWD9\|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1	Back alignment and function description

>sp\|Q7M3S9\|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2	Back alignment and function description

>sp\|Q5EA50\|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1	Back alignment and function description

>sp\|P51611\|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1	Back alignment and function description

>sp\|Q61191\|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2	Back alignment and function description

>sp\|P51610\|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2	Back alignment and function description

>sp\|Q9V4C8\|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2	Back alignment and function description

>sp\|Q7Z6M1\|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1	Back alignment and function description

>sp\|Q58CV6\|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		572
255542698		675	acyl-CoA binding protein, putative [Rici	0.881	0.746	0.773	0.0
296089677		674	unnamed protein product [Vitis vinifera]	0.881	0.747	0.764	0.0
225450825		675	PREDICTED: acyl-CoA-binding domain-conta	0.879	0.745	0.765	0.0
428754002		669	acyl-CoA binding protein 4 [Vernicia for	0.870	0.744	0.767	0.0
224125222		686	predicted protein [Populus trichocarpa]	0.881	0.734	0.769	0.0
224123550		644	predicted protein [Populus trichocarpa]	0.856	0.760	0.764	0.0
449454077		671	PREDICTED: acyl-CoA-binding domain-conta	0.874	0.745	0.745	0.0
357511945		664	Acyl-CoA-binding domain-containing prote	0.860	0.740	0.731	0.0
356576793		659	PREDICTED: acyl-CoA-binding domain-conta	0.856	0.743	0.735	0.0
225450823		651	PREDICTED: acyl-CoA-binding domain-conta	0.844	0.741	0.764	0.0

>gi\|255542698\|ref\|XP_002512412.1\| acyl-CoA binding protein, putative [Ricinus communis] gi\|223548373\|gb\|EEF49864.1\| acyl-CoA binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/542 (77%), Positives = 470/542 (86%), Gaps = 38/542 (7%)

Query: 1   MAMARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPC 60
           MAMARASSGLAYPERFYAAA+YAGFDGSP+S++  ++SKF +D+ALLLYALYQQAT+GPC
Sbjct: 1   MAMARASSGLAYPERFYAAATYAGFDGSPDSASSTVSSKFQSDTALLLYALYQQATIGPC 60

Query: 61  NVPKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDV 120
           + PKPS+W  VE SKWKSWQGLGNMA+TEAMRLFVKILEEEDPGWYSRASNSV EP+VD+
Sbjct: 61  SAPKPSTWKAVELSKWKSWQGLGNMASTEAMRLFVKILEEEDPGWYSRASNSVPEPVVDM 120

Query: 121 EMNHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISG 180
           ++NH+ K E++ ENGNS+PETKTIS+ENGN++ETQDKDVVSEGLGSV VYDQWI PPISG
Sbjct: 121 QLNHNPKVESIVENGNSYPETKTISSENGNVIETQDKDVVSEGLGSVAVYDQWITPPISG 180

Query: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP 240
           QRPKARYEHGAAVVQDKMYIYGGNHNGRYL+D+H+LDLRSW+WSK+ AK  AES ES S 
Sbjct: 181 QRPKARYEHGAAVVQDKMYIYGGNHNGRYLNDLHVLDLRSWSWSKVDAKVEAESNESKSS 240

Query: 241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQ 300
             LTPCAGHSLI WENKLLSIAGHTKDPSE +QVKVFDLQT +WSTLKTYGKPPVSRGGQ
Sbjct: 241 PTLTPCAGHSLISWENKLLSIAGHTKDPSEYMQVKVFDLQTRTWSTLKTYGKPPVSRGGQ 300

Query: 301 SVTLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERY 360
           SVTLVGTSLVIFGG+DAKRSLLNDLHILDLE+MTWDEIDAVGVPPSPRSDHAAAVHAERY
Sbjct: 301 SVTLVGTSLVIFGGQDAKRSLLNDLHILDLESMTWDEIDAVGVPPSPRSDHAAAVHAERY 360

Query: 361 LLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWFL------- 413
           +LIFGGGSHA CFNDLHVLD + MEW+RPTQQG++P+PRAGHAGVT+GENWF+       
Sbjct: 361 ILIFGGGSHATCFNDLHVLDSKNMEWTRPTQQGKLPSPRAGHAGVTVGENWFIAGGGDNK 420

Query: 414 -------------------------------GLSLVVSSYSGEDVIVAFGGYNGRYNNEV 442
                                          GLSL+VSSY+GED++V+FGGYNGRY+N+V
Sbjct: 421 SGVSETIVLNMSTLVWSVVTSVEGRVPLASEGLSLMVSSYNGEDILVSFGGYNGRYSNDV 480

Query: 443 HVLKPSHKSTLSSKMIETPVPDSVSAVQNNTNPTRDLESELEVGQEGKIREIVVDNVDSE 502
           +VLKPSHKSTL SK+IETPVPDSVSAV N TN TRDLESE E GQEGKIREIV+DNVD E
Sbjct: 481 NVLKPSHKSTLQSKIIETPVPDSVSAVHNATNATRDLESESEAGQEGKIREIVMDNVDPE 540

Query: 503 PL 504
           P+
Sbjct: 541 PM 542

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296089677\|emb\|CBI39496.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450825\|ref\|XP_002284019.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|428754002\|gb\|AFZ62126.1\| acyl-CoA binding protein 4 [Vernicia fordii]	Back alignment and taxonomy information

>gi\|224125222\|ref\|XP_002319530.1\| predicted protein [Populus trichocarpa] gi\|222857906\|gb\|EEE95453.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224123550\|ref\|XP_002330149.1\| predicted protein [Populus trichocarpa] gi\|222871605\|gb\|EEF08736.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449454077\|ref\|XP_004144782.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi\|449526493\|ref\|XP_004170248.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357511945\|ref\|XP_003626261.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi\|124360024\|gb\|ABN08040.1\| Acyl-coA-binding protein, ACBP; Serine/threonine protein phosphatase, BSU1 [Medicago truncatula] gi\|355501276\|gb\|AES82479.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356576793\|ref\|XP_003556514.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|225450823\|ref\|XP_002284025.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		572
TAIR\|locus:2143676		648	ACBP5 "acyl-CoA binding protei	0.713	0.629	0.734	1.1e-167
TAIR\|locus:2184352		514	AT5G04420 [Arabidopsis thalian	0.456	0.507	0.5	3e-69
TAIR\|locus:2183008		708	AT5G18590 [Arabidopsis thalian	0.419	0.338	0.359	2.6e-43
DICTYBASE\|DDB_G0270750		485	DDB_G0270750 "Kelch repeat-con	0.379	0.447	0.330	1.5e-25
UNIPROTKB\|F1SKQ3		370	RABEPK "Uncharacterized protei	0.396	0.613	0.286	3.6e-23
DICTYBASE\|DDB_G0268860		943	rngB "Kelch repeat-containing	0.393	0.238	0.307	1.6e-21
UNIPROTKB\|Q5EA50		372	RABEPK "Rab9 effector protein	0.403	0.620	0.281	2.1e-21
ZFIN\|ZDB-GENE-070424-100		411	zgc:163014 "zgc:163014" [Danio	0.377	0.525	0.319	5.8e-21
MGI\|MGI:2139530		380	Rabepk "Rab9 effector protein	0.396	0.597	0.298	6.9e-21
RGD\|1310612		372	Rabepk "Rab9 effector protein	0.396	0.610	0.290	8e-20

TAIR\|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1631 (579.2 bits), Expect = 1.1e-167, P = 1.1e-167
 Identities = 301/410 (73%), Positives = 343/410 (83%)

Query:     3 MARASSGLAYPERFYAAASYAGFDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNV 62
             M RASSGL+YPERFYAAASY G DGS  SS K+L+SKFSND+           T+GPC++
Sbjct:     4 MVRASSGLSYPERFYAAASYVGLDGS-QSSVKQLSSKFSNDTSLLLYTLHQQATLGPCSI 62

Query:    63 PKPSSWSPVEQSKWKSWQGLGNMATTEAMRLFVKILEEEDPGWYSRASNSVAEPIVDVEM 122
             PKPS+W+PVEQSKWKSWQGLG M + EAMRLFVKILEE DPGWY R SNSV +P V V++
Sbjct:    63 PKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEADPGWYPRTSNSVLDPAVHVQI 122

Query:   123 NHDSKTEAVKENGNSFPETKTISTENGNLMETQDKDVVSEGLGSVVVYDQWIAPPISGQR 182
             N  +K E   E+G SF ETKTI++E+G L ETQDKDVV E   +V VY+QW AP  SGQ 
Sbjct:   123 N-STKAEPSFESGASFGETKTITSEDGRLTETQDKDVVLEDPDTVSVYNQWTAPRTSGQP 181

Query:   183 PKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPAL 242
             PKARY+HGAAV+QDKMY+YGGNHNGRYL D+H+LDL++W WS+++ K V  S E+ SPA 
Sbjct:   182 PKARYQHGAAVIQDKMYMYGGNHNGRYLGDLHVLDLKNWTWSRVETKVVTGSQETSSPAK 241

Query:   243 LTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSV 302
             LT CAGHSLIPW+N+LLSI GHTKDPSE + V VFDL  CSWS LKTYGKPP+SRGGQSV
Sbjct:   242 LTHCAGHSLIPWDNQLLSIGGHTKDPSESMPVMVFDLHCCSWSILKTYGKPPISRGGQSV 301

Query:   303 TLVGTSLVIFGGEDAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLL 362
             TLVG SLVIFGG+DAKRSLLNDLHILDL+TMTW+EIDAVG PP+PRSDHAAAVHAERYLL
Sbjct:   302 TLVGKSLVIFGGQDAKRSLLNDLHILDLDTMTWEEIDAVGSPPTPRSDHAAAVHAERYLL 361

Query:   363 IFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPRAGHAGVTIGENWF 412
             IFGGGSHA CF+DLHVLDLQTMEWSR TQQG+ PTPRAGHAGVTIGENW+
Sbjct:   362 IFGGGSHATCFDDLHVLDLQTMEWSRHTQQGDAPTPRAGHAGVTIGENWY 411

GO:0000062 "fatty-acyl-CoA binding" evidence=IEA;ISS;IDA

GO:0005737 "cytoplasm" evidence=ISM

GO:0006869 "lipid transport" evidence=RCA;IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009416 "response to light stimulus" evidence=TAS

GO:0006306 "DNA methylation" evidence=RCA

GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA

GO:0009560 "embryo sac egg cell differentiation" evidence=RCA

GO:0031047 "gene silencing by RNA" evidence=RCA

GO:0031048 "chromatin silencing by small RNA" evidence=RCA

GO:0051567 "histone H3-K9 methylation" evidence=RCA

TAIR\|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0268860 rngB "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-070424-100 zgc:163014 "zgc:163014" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:2139530 Rabepk "Rab9 effector protein with kelch motifs" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1310612 Rabepk "Rab9 effector protein with kelch motifs" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9MA55	ACBP4_ARATH	No assigned EC number	0.7174	0.8671	0.7425	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		572
pfam00887		87	pfam00887, ACBP, Acyl CoA binding protein	5e-23
cd00435		85	cd00435, ACBP, Acyl CoA binding protein (ACBP) bin	7e-20
PTZ00458		90	PTZ00458, PTZ00458, acyl CoA binding protein; Prov	1e-10
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	5e-10
COG4281		87	COG4281, ACB, Acyl-CoA-binding protein [Lipid meta	2e-09
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	9e-09
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	2e-08
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	3e-08
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	4e-08
pfam13854		42	pfam13854, Kelch_5, Kelch motif	3e-07
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	3e-07
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	3e-06
pfam01344		46	pfam01344, Kelch_1, Kelch motif	5e-06
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-05
pfam13964		50	pfam13964, Kelch_6, Kelch motif	4e-05
pfam07646		48	pfam07646, Kelch_2, Kelch motif	6e-05
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	8e-05
pfam13854		42	pfam13854, Kelch_5, Kelch motif	2e-04
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	5e-04
pfam07646		48	pfam07646, Kelch_2, Kelch motif	7e-04
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	8e-04
pfam13964		50	pfam13964, Kelch_6, Kelch motif	8e-04
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	0.001
TIGR03548		323	TIGR03548, mutarot_permut, cyclically-permuted mut	0.004

>gnl\|CDD\|216174 pfam00887, ACBP, Acyl CoA binding protein	Back alignment and domain information

 Score = 93.0 bits (232), Expect = 5e-23
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 12/89 (13%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKF--SNDSALLLYALYQQATVGPCNVPKPSSWSPV 71
           E F AA  +           K+L      SN+  L LYALY+QAT G  N P+P  +  +
Sbjct: 3   EEFEAAVKFV----------KKLPKDGRPSNEEKLKLYALYKQATEGDVNTPRPGMFDVI 52

Query: 72  EQSKWKSWQGLGNMATTEAMRLFVKILEE 100
            ++KW +W+ L  M+  EAM+ +V+++EE
Sbjct: 53  GKAKWDAWKKLKGMSKEEAMKKYVELVEE 81

Length = 87

>gnl\|CDD\|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity	Back alignment and domain information

>gnl\|CDD\|185637 PTZ00458, PTZ00458, acyl CoA binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		572
PLN02153		341	epithiospecifier protein	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
PLN02193		470	nitrile-specifier protein	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
PLN02153		341	epithiospecifier protein	100.0
KOG1230		521	consensus Protein containing repeated kelch motifs	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
PLN02193		470	nitrile-specifier protein	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
PHA02790		480	Kelch-like protein; Provisional	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	99.98
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	99.97
PHA02713		557	hypothetical protein; Provisional	99.97
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	99.97
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	99.97
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	99.97
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	99.97
PHA03098		534	kelch-like protein; Provisional	99.96
PTZ00458		90	acyl CoA binding protein; Provisional	99.96
PHA02790		480	Kelch-like protein; Provisional	99.96
cd00435		85	ACBP Acyl CoA binding protein (ACBP) binds thiol e	99.95
KOG1230		521	consensus Protein containing repeated kelch motifs	99.95
KOG0817		142	consensus Acyl-CoA-binding protein [Lipid transpor	99.94
PF00887		87	ACBP: Acyl CoA binding protein; InterPro: IPR00058	99.94
COG4281		87	ACB Acyl-CoA-binding protein [Lipid metabolism]	99.92
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.69
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.67
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.56
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.5
KOG3878		469	consensus Protein involved in maintenance of Golgi	99.1
PF13964		50	Kelch_6: Kelch motif	99.08
PF13964		50	Kelch_6: Kelch motif	99.06
PLN02772		398	guanylate kinase	98.98
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.86
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.83
PLN02772		398	guanylate kinase	98.81
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.79
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.79
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.78
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.77
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.74
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.65
PF13854		42	Kelch_5: Kelch motif	98.6
PF13854		42	Kelch_5: Kelch motif	98.51
smart00612		47	Kelch Kelch domain.	98.38
smart00612		47	Kelch Kelch domain.	98.35
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.3
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	98.26
PF03089		337	RAG2: Recombination activating protein 2; InterPro	97.93
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	97.7
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	97.68
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	97.29
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	96.53
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	96.02
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	95.72
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	95.54
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	95.52
smart00295		207	B41 Band 4.1 homologues. Also known as ezrin/radix	95.45
PF12768		281	Rax2: Cortical protein marker for cell polarity	95.32
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	95.21
PF12768		281	Rax2: Cortical protein marker for cell polarity	95.18
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	95.18
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	94.97
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	94.7
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	94.7
KOG2055		514	consensus WD40 repeat protein [General function pr	94.68
PF00373		126	FERM_M: FERM central domain; InterPro: IPR019748 T	94.43
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	94.02
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	93.8
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	93.51
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	93.39
PRK13684		334	Ycf48-like protein; Provisional	93.27
KOG0310		487	consensus Conserved WD40 repeat-containing protein	92.85
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	92.84
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	92.11
PRK04792		448	tolB translocation protein TolB; Provisional	91.93
PRK05137		435	tolB translocation protein TolB; Provisional	91.8
PF12217		367	End_beta_propel: Catalytic beta propeller domain o	91.73
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	91.57
PRK04792		448	tolB translocation protein TolB; Provisional	91.3
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	91.01
PRK04922		433	tolB translocation protein TolB; Provisional	90.86
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	90.54
PRK13684		334	Ycf48-like protein; Provisional	90.41
PF09910		339	DUF2139: Uncharacterized protein conserved in arch	90.37
smart00284		255	OLF Olfactomedin-like domains.	90.34
PRK04922		433	tolB translocation protein TolB; Provisional	90.32
PRK00178		430	tolB translocation protein TolB; Provisional	90.19
PF12217		367	End_beta_propel: Catalytic beta propeller domain o	89.88
PRK11028		330	6-phosphogluconolactonase; Provisional	89.46
smart00284		255	OLF Olfactomedin-like domains.	89.19
KOG2055		514	consensus WD40 repeat protein [General function pr	88.7
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	88.64
PRK00178		430	tolB translocation protein TolB; Provisional	87.7
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	87.68
PLN00033		398	photosystem II stability/assembly factor; Provisio	87.12
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	87.04
KOG0310		487	consensus Conserved WD40 repeat-containing protein	86.78
PRK03629		429	tolB translocation protein TolB; Provisional	86.7
PRK04043		419	tolB translocation protein TolB; Provisional	86.44
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	86.05
PRK02889		427	tolB translocation protein TolB; Provisional	84.23
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	84.03
KOG2321		703	consensus WD40 repeat protein [General function pr	83.21
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	82.18
KOG2321		703	consensus WD40 repeat protein [General function pr	82.1
PRK11028		330	6-phosphogluconolactonase; Provisional	81.13
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	80.95
PRK02889		427	tolB translocation protein TolB; Provisional	80.94
PRK05137		435	tolB translocation protein TolB; Provisional	80.62
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	80.29

>PLN02153 epithiospecifier protein	Back alignment and domain information

Probab=100.00  E-value=1.3e-37  Score=322.93  Aligned_cols=258  Identities=22%  Similarity=0.369  Sum_probs=213.3

Q ss_pred             ceEEecccC-CCCCCCCcceeEEEECCEEEEEccCCC--CcccCcEEEEEcCCCcEEEeeecccccCCCCCCCCCCC-CC
Q 008260          171 DQWIAPPIS-GQRPKARYEHGAAVVQDKMYIYGGNHN--GRYLSDMHILDLRSWAWSKIQAKAVAESTESPSPALLT-PC  246 (572)
Q Consensus       171 ~~W~~~~~~-g~~p~~R~~~s~~~~~~~lyv~GG~~~--~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~~~p~-~R  246 (572)
                      +.|..+... +.+|.+|.+|++++++++|||+||...  ....+++++||+.+++|+.++++.          ..|. .+
T Consensus         7 ~~W~~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~~----------~~p~~~~   76 (341)
T PLN02153          7 GGWIKVEQKGGKGPGPRCSHGIAVVGDKLYSFGGELKPNEHIDKDLYVFDFNTHTWSIAPANG----------DVPRISC   76 (341)
T ss_pred             CeEEEecCCCCCCCCCCCcceEEEECCEEEEECCccCCCCceeCcEEEEECCCCEEEEcCccC----------CCCCCcc
Confidence            579988764 457999999999999999999999743  345689999999999999987653          1122 34


Q ss_pred             cceeEEEeCCEEEEEeccCCCCCcceeEEEEECCCCceEEeccCC--CCCCCCcceEEEEECCEEEEEecCCCCC-----
Q 008260          247 AGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYG--KPPVSRGGQSVTLVGTSLVIFGGEDAKR-----  319 (572)
Q Consensus       247 ~~hs~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~~~~W~~~~~~g--~~p~~R~~~~~~~~~~~iyv~GG~~~~~-----  319 (572)
                      .+|++++++++||+|||.... ..++++++||+.+++|+.++...  ..|.+|..|++++++++||||||.+...     
T Consensus        77 ~~~~~~~~~~~iyv~GG~~~~-~~~~~v~~yd~~t~~W~~~~~~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~  155 (341)
T PLN02153         77 LGVRMVAVGTKLYIFGGRDEK-REFSDFYSYDTVKNEWTFLTKLDEEGGPEARTFHSMASDENHVYVFGGVSKGGLMKTP  155 (341)
T ss_pred             CceEEEEECCEEEEECCCCCC-CccCcEEEEECCCCEEEEeccCCCCCCCCCceeeEEEEECCEEEEECCccCCCccCCC
Confidence            589999999999999998765 55789999999999999987431  2388999999999999999999986432     


Q ss_pred             CCCCceEEEECCCCcEEEeeCCCCCCCcccceEEEEEcCCEEEEEeCCCC--------CcCcCcEEEEECCCCcEEeecc
Q 008260          320 SLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSH--------AACFNDLHVLDLQTMEWSRPTQ  391 (572)
Q Consensus       320 ~~~~~v~~yd~~t~~W~~v~~~g~~p~~R~~~~~~~~~~~~lyv~GG~~~--------~~~~~~v~~yd~~t~~W~~v~~  391 (572)
                      ..++++++||+.+++|+.++.++.+|.+|.+|+++++++ +|||+||.+.        ...++++++||+.+++|+++..
T Consensus       156 ~~~~~v~~yd~~~~~W~~l~~~~~~~~~r~~~~~~~~~~-~iyv~GG~~~~~~~gG~~~~~~~~v~~yd~~~~~W~~~~~  234 (341)
T PLN02153        156 ERFRTIEAYNIADGKWVQLPDPGENFEKRGGAGFAVVQG-KIWVVYGFATSILPGGKSDYESNAVQFFDPASGKWTEVET  234 (341)
T ss_pred             cccceEEEEECCCCeEeeCCCCCCCCCCCCcceEEEECC-eEEEEeccccccccCCccceecCceEEEEcCCCcEEeccc
Confidence            135789999999999999988766678999999988855 6999998642        1235789999999999999987


Q ss_pred             CCCCCCCccccEEEEECCccccceeeeeeccCCCCEEEEEcCCC----------CCccCcEEEEeCCCCccccccc
Q 008260          392 QGEIPTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYN----------GRYNNEVHVLKPSHKSTLSSKM  457 (572)
Q Consensus       392 ~g~~p~~R~~~~~~~~~~~~~iG~s~~~~~~~g~~~l~v~GG~~----------~~~~~dv~~yd~~~~~~~~~~~  457 (572)
                      .+.+|.+|..|+++++++                 +||||||..          +...+++|+||+.+++|.....
T Consensus       235 ~g~~P~~r~~~~~~~~~~-----------------~iyv~GG~~~~~~~~~~~~~~~~n~v~~~d~~~~~W~~~~~  293 (341)
T PLN02153        235 TGAKPSARSVFAHAVVGK-----------------YIIIFGGEVWPDLKGHLGPGTLSNEGYALDTETLVWEKLGE  293 (341)
T ss_pred             cCCCCCCcceeeeEEECC-----------------EEEEECcccCCccccccccccccccEEEEEcCccEEEeccC
Confidence            777899999999999987                 899999973          2356899999999999986543

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PTZ00458 acyl CoA binding protein; Provisional	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>KOG0817 consensus Acyl-CoA-binding protein [Lipid transport and metabolism]	Back alignment and domain information

>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters []	Back alignment and domain information

>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>KOG3878 consensus Protein involved in maintenance of Golgi structure and ER-Golgi transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>smart00295 B41 Band 4	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>smart00284 OLF Olfactomedin-like domains	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>smart00284 OLF Olfactomedin-like domains	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		572
2lbb_A		96	Solution Structure Of Acyl Coa Binding Protein From		8e-07
2cop_A		109	Solution Structure Of Rsgi Ruh-040, An Acbp Domain		2e-06
2wh5_A		106	Crystal Structure Of Human Acyl-Coa Binding Domain		4e-06
3flv_A		119	The Crystal Structure Of Human Acyl-Coenzymea Bindi		6e-05

>pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96

Back alignment and structure

Iteration: 1

Score = 52.0 bits (123), Expect = 8e-07, Method: Composition-based stats. Identities = 27/81 (33%), Positives = 36/81 (44%) Query: 25 FDGSPNSSAKELTSKFSNDSXXXXXXXXXXXTVGPCNVPKPSSWSPVEQSKWKSWQGLGN 84 FD + + T SND TVG CN PKP E+ KW++W L Sbjct: 14 FDAAVKYVSNTTTMMASNDDKLCFYKYYKQATVGDCNKPKPGMLQLQEKYKWEAWNALRG 73 Query: 85 MATTEAMRLFVKILEEEDPGW 105 M+T A +VK+L+ P W Sbjct: 74 MSTESAKEAYVKLLDTLAPSW 94

PyMOL of 2lbb

>pdb|2COP|A Chain A, Solution Structure Of Rsgi Ruh-040, An Acbp Domain From Human Cdna Length = 109

Back alignment and structure

>pdb|2WH5|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 4 Complexed With Stearoyl-Coa Length = 106

Back alignment and structure

>pdb|3FLV|A Chain A, The Crystal Structure Of Human Acyl-Coenzymea Binding Domain Containing 5 Length = 119

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		572
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	3e-35
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	9e-33
2cqu_A		116	Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi	1e-29
2lbb_A		96	Acyl COA binding protein; protein binding, structu	1e-24
1st7_A		86	ACBP, acyl-COA-binding protein; four helix bundle,	1e-24
2cb8_A		87	Acyl-COA-binding protein; acyl-coenzyme A binding	2e-24
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	3e-24
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	3e-09
3fp5_A		106	Acyl-COA binding protein; ACBP, cacao disease, fat	6e-24
1hbk_A		89	ACBP, acyl-COA binding protein; fatty acid metabol	9e-24
2cop_A		109	Acyl-coenzyme A binding domain containing 6; acyl	1e-23
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	5e-23
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	2e-20
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	3e-04
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	1e-22
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	4e-20
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	6e-12
3flv_A		119	Acyl-COA-binding domain-containing protein 5; lipi	1e-22
2wh5_A		106	Acyl-COA-binding domain-containing protein 4; alte	3e-22
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	9e-22
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	6e-18
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	7e-17
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	5e-11
3epy_A		89	Acyl-COA-binding domain-containing protein 7; acyl	1e-21
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	1e-21
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	8e-20
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	2e-21
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	4e-21
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	7e-06
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	3e-04
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	7e-20
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	2e-17
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-07
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	5e-06
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	3e-05

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

 Score =  139 bits (352), Expect = 3e-35
 Identities = 50/299 (16%), Positives = 93/299 (31%), Gaps = 55/299 (18%)

Query: 170 YDQWIAPPISGQRPKARYEHGAAVV--QDKMYIYGG-NHNGRYLSDMHILDLRSWAWSKI 226
            D       S + P AR  H    +   +++ + GG     + LSD  I D+++  WS I
Sbjct: 424 IDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDMKTREWSMI 483

Query: 227 QAKAVAESTESPSPALLTPCAGHSLIPW-ENKLLSIAGHTKDPSEIIQVKVFDLQTCSWS 285
                         +L      HS     +  +L + G T+ P+    + ++++    + 
Sbjct: 484 -------------KSLSHTRFRHSACSLPDGNVLILGGVTEGPA----MLLYNVTEEIFK 526

Query: 286 TLKTYGKPPVSRGGQSVTLVGT----SLVIFGGEDAKRSLLNDLHILDLE----TMTWDE 337
            +    +   +    +           +++ GG   + ++ +   I   +    T     
Sbjct: 527 DVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENATEPITV 586

Query: 338 IDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACF---NDLHVLDLQTMEWSRPTQQGE 394
           I  +  P   R          R LLI GG S +  F   N +  LD  +   +       
Sbjct: 587 IKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRR 646

Query: 395 IPTP----RAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYN----GRYNNEVHVL 445
           I        AG + V+                    + +  GG      G   N    L
Sbjct: 647 IWEDHSLMLAGFSLVSTSMG---------------TIHIIGGGATCYGFGSVTNVGLKL 690

PyMOL of 2zwa

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116	Back alignment and structure

>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96	Back alignment and structure

>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86	Back alignment and structure

>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106	Back alignment and structure

>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89	Back alignment and structure

>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119	Back alignment and structure

>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		572
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
1hbk_A		89	ACBP, acyl-COA binding protein; fatty acid metabol	99.97
2cop_A		109	Acyl-coenzyme A binding domain containing 6; acyl	99.97
1st7_A		86	ACBP, acyl-COA-binding protein; four helix bundle,	99.97
3epy_A		89	Acyl-COA-binding domain-containing protein 7; acyl	99.97
2cqu_A		116	Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi	99.96
2lbb_A		96	Acyl COA binding protein; protein binding, structu	99.96
2cb8_A		87	Acyl-COA-binding protein; acyl-coenzyme A binding	99.96
3fp5_A		106	Acyl-COA binding protein; ACBP, cacao disease, fat	99.95
2wh5_A		106	Acyl-COA-binding domain-containing protein 4; alte	99.95
3flv_A		119	Acyl-COA-binding domain-containing protein 5; lipi	99.95
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	99.95
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	99.94
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.96
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.91
1mix_A		206	Talin; focal adhesion, integrin binding, FERM doma	97.76
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.62
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.53
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.53
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.48
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.05
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	96.95
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.8
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	96.72
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	96.7
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	96.47
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	96.45
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	96.34
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	96.34
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	96.14
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.12
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	96.08
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	95.94
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	95.94
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	95.93
3jro_A		753	Fusion protein of protein transport protein SEC13	95.77
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	95.75
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	95.74
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	95.67
3jrp_A		379	Fusion protein of protein transport protein SEC13	95.66
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	95.63
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	95.49
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	95.48
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	95.48
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	95.43
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	95.35
3ow8_A		321	WD repeat-containing protein 61; structural genomi	95.34
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	95.33
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	95.29
3v9f_A		781	Two-component system sensor histidine kinase/RESP	95.29
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	95.25
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	95.19
3ow8_A		321	WD repeat-containing protein 61; structural genomi	95.18
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	95.17
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	95.15
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	95.12
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	95.05
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	95.0
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	94.88
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	94.77
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	94.76
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	94.74
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	94.73
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	94.58
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	94.55
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	94.52
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	94.5
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	94.44
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	94.4
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	94.4
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	94.36
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	94.33
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	94.31
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	94.31
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	94.28
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	94.27
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	94.27
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	94.24
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	94.23
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	94.18
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	94.07
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	94.03
3jro_A		753	Fusion protein of protein transport protein SEC13	93.64
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	93.61
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	93.59
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	93.57
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	93.54
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	93.46
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	93.45
4f7g_A		222	Talin-1; alpha-helix bundle, integrin activation,	93.4
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	93.34
4a2l_A		795	BT_4663, two-component system sensor histidine kin	93.23
3ju4_A		670	Endo-N-acetylneuraminidase; endonf, polysia, high-	93.13
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	93.1
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	93.04
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	93.04
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	92.94
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	92.9
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	92.83
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	92.76
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	92.35
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	92.2
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	92.2
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	92.18
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	92.16
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	92.05
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	92.02
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	92.01
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	91.99
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	91.92
3qij_A		296	Protein 4.1; cytoskeleton, structural genomics, st	91.84
1ef1_A		294	Moesin; membrane, FERM domain, tail domain, membra	91.79
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	91.78
3v9f_A		781	Two-component system sensor histidine kinase/RESP	91.68
1h4r_A		314	Merlin; FERM, neurofibromatosis, NF2, structural p	91.64
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	91.55
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	91.55
4a2l_A		795	BT_4663, two-component system sensor histidine kin	91.52
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	91.49
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	91.48
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	91.44
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	91.4
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	91.35
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	91.31
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	91.02
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	90.98
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	90.97
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	90.92
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	90.9
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	90.85
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	90.8
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	90.79
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	90.73
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	90.58
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	90.55
1pex_A		207	Collagenase-3, MMP-13; C-terminal hemopexin-like d	90.52
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	90.33
2pm7_B		297	Protein transport protein SEC13, protein transport	90.22
3ivf_A		371	Talin-1; FERM domain, cell membrane, cell projecti	90.15
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	90.15
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	90.09
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	89.95
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	89.9
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	89.88
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	89.77
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	89.44
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	89.36
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	89.34
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	89.31
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	89.25
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	89.13
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	89.08
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	88.97
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	88.94
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	88.84
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	88.8
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	88.58
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	88.27
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	88.07
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	88.01
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	87.9
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	87.72
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	87.68
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	87.62
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	87.6
3ott_A		758	Two-component system sensor histidine kinase; beta	87.5
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	87.09
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	87.08
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	86.95
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	86.94
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	86.89
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	86.85
2pm7_B		297	Protein transport protein SEC13, protein transport	86.36
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	86.35
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	86.16
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	86.1
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	85.97
2ece_A		462	462AA long hypothetical selenium-binding protein;	85.89
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	85.82
2i1j_A		575	Moesin; FERM, coiled-coil, C-ermad, ERM, radixin,	85.61
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	85.59
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	85.59
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	85.32
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	85.28
3au4_A		555	Myosin-X; protein-protein complex, motor protein c	85.26
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	85.11
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	84.99
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	84.69
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	84.58
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	84.5
3ott_A		758	Two-component system sensor histidine kinase; beta	84.36
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	84.35
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	84.03
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	83.4
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	83.3
1gen_A		218	Gelatinase A; hydrolase, hemopexin domain, metallo	83.04
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	82.95
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	82.53
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	82.46
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	82.24
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	81.66
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	81.39
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	81.32
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	81.18
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	81.04
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	80.94
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	80.64
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	80.46
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	80.27
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	80.22
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	80.14

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

Probab=100.00  E-value=1.4e-39  Score=330.06  Aligned_cols=248  Identities=17%  Similarity=0.302  Sum_probs=221.9

Q ss_pred             ceeeec----ceEEecccCCCCCCCCcceeEEEECCEEEEEccCCCCcccCcEEEEEcCCCcEEEeeecccccCCCCCCC
Q 008260          165 GSVVVY----DQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNHNGRYLSDMHILDLRSWAWSKIQAKAVAESTESPSP  240 (572)
Q Consensus       165 ~~~~~~----~~W~~~~~~g~~p~~R~~~s~~~~~~~lyv~GG~~~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~~~~~~  240 (572)
                      ..+.+|    ++|..++   .+|.+|.+|++++++++|||+||..+...++++++||+.+++|+.++++           
T Consensus        30 ~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~-----------   95 (302)
T 2xn4_A           30 RSVECYDFKEERWHQVA---ELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANM-----------   95 (302)
T ss_dssp             CCEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTEEEEESCBCSSSBCCCEEEEETTTTEEEEECCC-----------
T ss_pred             CcEEEEcCcCCcEeEcc---cCCcccccceEEEECCEEEEEeCcCCCccccceEEECCCCCceeeCCCC-----------
Confidence            445555    5999987   4899999999999999999999988777889999999999999999865           


Q ss_pred             CCCCCCcceeEEEeCCEEEEEeccCCCCCcceeEEEEECCCCceEEeccCCCCCCCCcceEEEEECCEEEEEecCCCCC-
Q 008260          241 ALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGEDAKR-  319 (572)
Q Consensus       241 ~~p~~R~~hs~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~~~~W~~~~~~g~~p~~R~~~~~~~~~~~iyv~GG~~~~~-  319 (572)
                        |.+|.+|+++.++++||++||.... ..++++++||+.+++|+.++   ++|.+|..|++++++++||++||.+... 
T Consensus        96 --p~~r~~~~~~~~~~~iyv~GG~~~~-~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~~  169 (302)
T 2xn4_A           96 --RDRRSTLGAAVLNGLLYAVGGFDGS-TGLSSVEAYNIKSNEWFHVA---PMNTRRSSVGVGVVGGLLYAVGGYDVASR  169 (302)
T ss_dssp             --SSCCBSCEEEEETTEEEEEEEECSS-CEEEEEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTEEEEECCEETTTT
T ss_pred             --CccccceEEEEECCEEEEEcCCCCC-ccCceEEEEeCCCCeEeecC---CCCCcccCceEEEECCEEEEEeCCCCCCC
Confidence              5899999999999999999998765 67899999999999999997   6899999999999999999999997654 


Q ss_pred             CCCCceEEEECCCCcEEEeeCCCCCCCcccceEEEEEcCCEEEEEeCCCCCcCcCcEEEEECCCCcEEeeccCCCCCCCc
Q 008260          320 SLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEIPTPR  399 (572)
Q Consensus       320 ~~~~~v~~yd~~t~~W~~v~~~g~~p~~R~~~~~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~t~~W~~v~~~g~~p~~R  399 (572)
                      ..++++++||+.+++|+.+.++   |.+|..|++++++ ++|||+||.+.....+++++||+++++|+.+.   .+|.+|
T Consensus       170 ~~~~~~~~yd~~~~~W~~~~~~---p~~r~~~~~~~~~-~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~---~~~~~r  242 (302)
T 2xn4_A          170 QCLSTVECYNATTNEWTYIAEM---STRRSGAGVGVLN-NLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVA---DMNMCR  242 (302)
T ss_dssp             EECCCEEEEETTTTEEEEECCC---SSCCBSCEEEEET-TEEEEECCBSSSSBCCCEEEEETTTTEEEEEC---CCSSCC
T ss_pred             ccccEEEEEeCCCCcEEECCCC---ccccccccEEEEC-CEEEEECCCCCCcccceEEEEeCCCCCEeeCC---CCCCcc
Confidence            3578999999999999999766   8999999999885 57999999888777899999999999999996   488999


Q ss_pred             cccEEEEECCccccceeeeeeccCCCCEEEEEcCCCCC-ccCcEEEEeCCCCcccccc
Q 008260          400 AGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNGR-YNNEVHVLKPSHKSTLSSK  456 (572)
Q Consensus       400 ~~~~~~~~~~~~~iG~s~~~~~~~g~~~l~v~GG~~~~-~~~dv~~yd~~~~~~~~~~  456 (572)
                      .+|+++++++                 +|||+||.++. .++++++||+.++.|....
T Consensus       243 ~~~~~~~~~~-----------------~i~v~GG~~~~~~~~~v~~yd~~~~~W~~~~  283 (302)
T 2xn4_A          243 RNAGVCAVNG-----------------LLYVVGGDDGSCNLASVEYYNPTTDKWTVVS  283 (302)
T ss_dssp             BSCEEEEETT-----------------EEEEECCBCSSSBCCCEEEEETTTTEEEECS
T ss_pred             ccCeEEEECC-----------------EEEEECCcCCCcccccEEEEcCCCCeEEECC
Confidence            9999999977                 89999999774 6899999999999998754

PyMOL of 2xn4

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1	Back alignment and structure

>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1	Back alignment and structure

>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis}	Back alignment and structure

>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A	Back alignment and structure

>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0	Back alignment and structure

>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens}	Back alignment and structure

>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens}	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A*	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A	Back alignment and structure

>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		572
d1hbka_		89	a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium	4e-26
d1hb6a_		86	a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t	1e-22
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	5e-10
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	3e-06
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	6e-06
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	3e-05
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	2e-04
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	3e-04

>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89	Back information, alignment and structure


class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Plasmodium falciparum [TaxId: 5833]

 Score = 99.9 bits (249), Expect = 4e-26
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 14  ERFYAAASYAGFDGSPNSSAKELTSKFSNDSALLLYALYQQATVGPCNVPKPSSWSPVEQ 73
           + F    S+       N   +  T    N+  L LY  Y+Q+T+G CN+ +PS+   +++
Sbjct: 4   QVFEECVSFI------NGLPR--TINLPNELKLDLYKYYKQSTIGNCNIKEPSAHKYIDR 55

Query: 74  SKWKSWQGLGNMATTEAMRLFVKILEEEDPGW 105
            K+++W+ + N+   +A + +V I+ E  P W
Sbjct: 56  KKYEAWKSVENLNREDAQKRYVDIVSEIFPYW 87

PyMOL of d1hbka_

>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		572
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	99.97
d1hbka_		89	Acyl-CoA binding protein {Plasmodium falciparum [T	99.96
d1hb6a_		86	Acyl-CoA binding protein {Cow (Bos taurus) [TaxId:	99.95
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.95
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.84
d1mixa1		114	Talin {Chicken (Gallus gallus) [TaxId: 9031]}	96.82
d1gg3a1		106	Erythroid membrane protein 4.1R {Human (Homo sapie	96.71
d1h4ra1		111	Merlin {Human (Homo sapiens) [TaxId: 9606]}	96.69
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	96.65
d1ef1a1		111	Moesin {Human (Homo sapiens) [TaxId: 9606]}	96.57
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	95.82
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	95.24
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	94.22
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	93.97
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	93.84
d1v0ea1		516	Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34	93.45
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	93.2
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	93.12
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	92.99
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	92.88
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	92.68
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	92.5
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	92.26
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	92.0
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	91.98
d2al6a1		123	Focal adhesion kinase 1 {Chicken (Gallus gallus) [	91.17
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	90.35
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	90.3
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	90.03
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	89.99
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	88.86
d1tbga_		340	beta1-subunit of the signal-transducing G protein	87.52
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	87.38
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	87.14
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	87.1
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	86.71
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	86.56
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	86.16
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	85.87
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	85.81
d1gena_		200	Gelatinase A (MMP-2), C-terminal domain {Human (Ho	85.77
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	84.75
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	83.07
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	82.85
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	82.64
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	81.89

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.4e-34  Score=284.13  Aligned_cols=250  Identities=18%  Similarity=0.268  Sum_probs=220.0

Q ss_pred             Cceeeec----ceEEecccCCCCCCCCcceeEEEECCEEEEEccCC----CCcccCcEEEEEcCCCcEEEeeecccccCC
Q 008260          164 LGSVVVY----DQWIAPPISGQRPKARYEHGAAVVQDKMYIYGGNH----NGRYLSDMHILDLRSWAWSKIQAKAVAEST  235 (572)
Q Consensus       164 ~~~~~~~----~~W~~~~~~g~~p~~R~~~s~~~~~~~lyv~GG~~----~~~~~~~v~~yd~~t~~W~~~~~~~~~~~~  235 (572)
                      +..+++|    ++|+.+++   +|.+|.+|++++++++|||+||..    ....++++++||+.+++|+.++++      
T Consensus        18 ~~~~~~yd~~t~~W~~~~~---~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~------   88 (288)
T d1zgka1          18 LSYLEAYNPSNGTWLRLAD---LQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPM------   88 (288)
T ss_dssp             CCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCC------
T ss_pred             CceEEEEECCCCeEEECCC---CCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccc------
Confidence            4556666    48999874   899999999999999999999953    235678999999999999998765      


Q ss_pred             CCCCCCCCCCCcceeEEEeCCEEEEEeccCCCCCcceeEEEEECCCCceEEeccCCCCCCCCcceEEEEECCEEEEEecC
Q 008260          236 ESPSPALLTPCAGHSLIPWENKLLSIAGHTKDPSEIIQVKVFDLQTCSWSTLKTYGKPPVSRGGQSVTLVGTSLVIFGGE  315 (572)
Q Consensus       236 ~~~~~~~p~~R~~hs~~~~~~~iyv~GG~~~~~~~~~~v~~yd~~~~~W~~~~~~g~~p~~R~~~~~~~~~~~iyv~GG~  315 (572)
                             |.+|.+|+++.++++||++||.... ..+++++.||+.++.|....   .++.+|.+|+++.+.+++|++||.
T Consensus        89 -------p~~r~~~~~~~~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~---~~~~~r~~~~~~~~~~~~~~~GG~  157 (288)
T d1zgka1          89 -------SVPRNRIGVGVIDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVA---PMLTRRIGVGVAVLNRLLYAVGGF  157 (288)
T ss_dssp             -------SSCCBTCEEEEETTEEEEECCEETT-EECCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTEEEEECCB
T ss_pred             -------cceecceeccccceeeEEecceecc-cccceeeeeccccCcccccc---ccccccccceeeeeeecceEecCc
Confidence                   6899999999999999999998765 67788999999999999886   678899999999999999999998


Q ss_pred             CCCCCCCCceEEEECCCCcEEEeeCCCCCCCcccceEEEEEcCCEEEEEeCCCCCcCcCcEEEEECCCCcEEeeccCCCC
Q 008260          316 DAKRSLLNDLHILDLETMTWDEIDAVGVPPSPRSDHAAAVHAERYLLIFGGGSHAACFNDLHVLDLQTMEWSRPTQQGEI  395 (572)
Q Consensus       316 ~~~~~~~~~v~~yd~~t~~W~~v~~~g~~p~~R~~~~~~~~~~~~lyv~GG~~~~~~~~~v~~yd~~t~~W~~v~~~g~~  395 (572)
                      +... ..++++.||+.+++|......   +.++..++++...+ .|+++||.+....+++++.||+.+++|+.+.   ++
T Consensus       158 ~~~~-~~~~~~~~d~~~~~~~~~~~~---~~~~~~~~~~~~~~-~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~---~~  229 (288)
T d1zgka1         158 DGTN-RLNSAECYYPERNEWRMITAM---NTIRSGAGVCVLHN-CIYAAGGYDGQDQLNSVERYDVETETWTFVA---PM  229 (288)
T ss_dssp             CSSC-BCCCEEEEETTTTEEEECCCC---SSCCBSCEEEEETT-EEEEECCBCSSSBCCCEEEEETTTTEEEECC---CC
T ss_pred             cccc-ccceEEEeecccccccccccc---ccccccccccceee-eEEEecCccccccccceeeeeecceeeeccc---Cc
Confidence            7665 478899999999999998765   78888899888865 6999999988888999999999999999985   47


Q ss_pred             CCCccccEEEEECCccccceeeeeeccCCCCEEEEEcCCCC-CccCcEEEEeCCCCcccccccC
Q 008260          396 PTPRAGHAGVTIGENWFLGLSLVVSSYSGEDVIVAFGGYNG-RYNNEVHVLKPSHKSTLSSKMI  458 (572)
Q Consensus       396 p~~R~~~~~~~~~~~~~iG~s~~~~~~~g~~~l~v~GG~~~-~~~~dv~~yd~~~~~~~~~~~~  458 (572)
                      |.+|.+|+++.+++                 +||||||.++ ..++++|+||+++++|.+....
T Consensus       230 p~~r~~~~~~~~~~-----------------~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~  276 (288)
T d1zgka1         230 KHRRSALGITVHQG-----------------RIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRM  276 (288)
T ss_dssp             SSCCBSCEEEEETT-----------------EEEEECCBCSSCBCCEEEEEETTTTEEEEEEEC
T ss_pred             cCcccceEEEEECC-----------------EEEEEecCCCCeecceEEEEECCCCEEEECCCC
Confidence            89999999999977                 8999999977 4789999999999999887533

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure