Citrus Sinensis ID: 008330

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MGRFISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccEEcccccEEEEEEEccccccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHcccHHHccccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHccccccccccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccEEEcccccccccccccccEEEEcccccEEEEcccccccEEccccccccccEEEEEccccEEEEEcccccEEEEEccccccEEEEccEEccccccccccccEEEEEEccccccccccccccccccccccccccccccccc
cccccccHHHcccHHHHHHHHHHHHHHHHHcccccccccEccccEEEcccccEEEEEEEEcccccccccccccccccHHHHHHHHHHccccEEEEcccHHHHHccccccccHHHHHHHcccccccccHccccccHccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccEEcccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEccccEEEccccccccccccccccccccccHHHHHHHHHHcccccccccccccccEEEEcccccEEEEEccccccEEEcccccccccEEccccEEEEEcccEEEEEcccccccEEccccccccccEEEEEcccEEEEEEcccccEEEEEccccccEEEcccEEccccccccccccEEEEEEccccccccccHHccccccccccHHHHHHHHccc
MGRFISFSFLTSHPLLLLLIIFPIIIIiqqskpaiglplstnsrwivdenghRVKLACVNWVSHLEPVVaeglskqpmdMLSKRVVDMGFncvrltwplylatndslASLTVRQSFQKLGLLEAiggiqsnnpsivdlPLIKAFQAVVASLGNNNVMVILDnhiskpgwccsnsdgngffgdqyfnpdlwiKGLTKMATIFNGVRNVVGMSLrnelrgpkqnvKDWYRYMQLGAEAVHAANPEVLVILSglnfdkdlSFVRNQAVNLTFTGKLVFEAHwygftdgqawvdgnpnqvcgrvVDNVMRLSGFlleqgwplfvsefgadlrgnnvndnrylnCFFGVAAELDWDWALWTLVGSYYLREGVIGLNeyyglfdwnwcdirnSSFLERISslqspfrgpgvfetglhkviyhpatglcvqrksfldpltlgpcteseawsytphktislkGAYFCLqakhvgkpaklgiictdcgstweIISDskmhlsskadngttvcldvdssntivtntckclsrdktcdpasqwfklvdstrsstttksffqfnpildlpgkdFIWKFFGLF
MGRFISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGmslrnelrgpkqnVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNtckclsrdktcdpasQWFKLVDstrsstttksffqfnpildlpgkDFIWKFFGLF
MGRFISFSFLTSHpllllliifpiiiiiQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDstrsstttksFFQFNPILDLPGKDFIWKFFGLF
***FISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGL*
*****S*SFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSL***************KVIYHPATGLCVQRKS*L**L*L*PCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKL*********TWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDS***************ILDLPGKDFIWKFFGLF
MGRFISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
***FISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRFISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query570 2.2.26 [Sep-21-2011]
P23548397 Endoglucanase OS=Paenibac yes no 0.375 0.539 0.241 2e-08
P54583562 Endoglucanase E1 OS=Acido yes no 0.478 0.485 0.240 5e-08
P19487484 Major extracellular endog yes no 0.328 0.386 0.271 2e-05
>sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 96/253 (37%), Gaps = 39/253 (15%)

Query: 46  IVDENGHRVKLACVNWVSHLEP-VVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATN 104
           IVDE+G       +NW     P     GL  + MD +  +V   G+N +RL +       
Sbjct: 46  IVDESGKEAAFNGLNWFGLETPNYTLHGLWSRSMDDMLDQVKKEGYNLIRLPY------- 98

Query: 105 DSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHI 164
                    Q F      ++I      NP +V L  I+    ++   G   + +ILD H 
Sbjct: 99  -------SNQLFDSSSRPDSID--YHKNPDLVGLNPIQIMDKLIEKAGQRGIQIILDRH- 148

Query: 165 SKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPK---- 220
            +PG   S      ++  QY     WI     +A  +     V+G  L NE  G      
Sbjct: 149 -RPG---SGGQSELWYTSQYPE-SRWISDWKMLADRYKNNPTVIGADLHNEPHGQASWGT 203

Query: 221 -QNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFD-----------KDLSFVRNQAVNLT 268
                DW    Q    A+ + NP  L+++ G++ +            +L+ V N  V L 
Sbjct: 204 GNASTDWRLAAQRAGNAILSVNPNWLILVEGVDHNVQGNNSQYWWGGNLTGVANYPVVLD 263

Query: 269 FTGKLVFEAHWYG 281
              ++V+  H YG
Sbjct: 264 VPNRVVYSPHDYG 276

Paenibacillus polymyxa (taxid: 1406)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 4
>sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 Back     alignment and function description
>sp|P19487|GUNA_XANCP Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) GN=engXCA PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
255547996566 hydrolase, hydrolyzing O-glycosyl compou 0.989 0.996 0.771 0.0
224102379544 predicted protein [Populus trichocarpa] 0.942 0.987 0.763 0.0
224110842513 predicted protein [Populus trichocarpa] 0.898 0.998 0.777 0.0
225424600552 PREDICTED: uncharacterized protein LOC10 0.942 0.972 0.729 0.0
356511061557 PREDICTED: uncharacterized protein LOC10 0.898 0.919 0.732 0.0
449435438549 PREDICTED: uncharacterized protein LOC10 0.914 0.948 0.710 0.0
356541382544 PREDICTED: endoglucanase-like [Glycine m 0.928 0.972 0.677 0.0
356528434574 PREDICTED: uncharacterized protein LOC10 0.915 0.909 0.679 0.0
356511059571 PREDICTED: endoglucanase E1-like [Glycin 0.980 0.978 0.640 0.0
357463207655 Endoglucanase [Medicago truncatula] gi|3 0.907 0.789 0.642 0.0
>gi|255547996|ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223546106|gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/570 (77%), Positives = 497/570 (87%), Gaps = 6/570 (1%)

Query: 1   MGRFISFSFLTSHPLLLLLIIFPIIIIIQQSKPAIGLPLSTNSRWIVDENGHRVKLACVN 60
           MG+F+SFS L+    +L+     I  II QS+    LPLSTNSRWIVDENG RVKLACVN
Sbjct: 1   MGKFLSFSSLS----VLITFFIAISAIIPQSQ-VTALPLSTNSRWIVDENGQRVKLACVN 55

Query: 61  WVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLG 120
           WVSHLE VVAEGLSKQPMDM++K++V MGFNCVRLTWPLYL TND+LASL+VRQSFQ LG
Sbjct: 56  WVSHLEAVVAEGLSKQPMDMIAKKIVSMGFNCVRLTWPLYLVTNDTLASLSVRQSFQGLG 115

Query: 121 LLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFF 180
           LLE+I GIQ+NNPSI+DLPLIKA+QAVV+SLG+NNVMVILDNHISKPGWCCSN DGNGFF
Sbjct: 116 LLESISGIQANNPSIIDLPLIKAYQAVVSSLGDNNVMVILDNHISKPGWCCSNFDGNGFF 175

Query: 181 GDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAA 240
           GD YFNPDLWIKGLT+MAT+FNGV NV+GMSLRNELRG KQNV DWYRYM+ GAEAVH+A
Sbjct: 176 GDTYFNPDLWIKGLTQMATLFNGVTNVIGMSLRNELRGQKQNVNDWYRYMEKGAEAVHSA 235

Query: 241 NPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRV 300
           NP+VLVILSGLN+DKD SF+RN+ VNL+FTGK+VFE HWYGF+DGQAW  GNPNQVCGRV
Sbjct: 236 NPDVLVILSGLNYDKDFSFLRNRPVNLSFTGKVVFEVHWYGFSDGQAWRSGNPNQVCGRV 295

Query: 301 VDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGS 360
           VDN+MR+SGFLLEQGWP+FVSEFG D RG NVNDNRYL CF GVAAELDWDWALWTLVGS
Sbjct: 296 VDNLMRISGFLLEQGWPMFVSEFGVDQRGTNVNDNRYLGCFIGVAAELDWDWALWTLVGS 355

Query: 361 YYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATG 420
           YYLR+GVIGLNEYYG+ +WNWCD+RNSSFL++IS+LQSPF+GPG+ ET  HKVI+HP+TG
Sbjct: 356 YYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISALQSPFQGPGLSETNPHKVIFHPSTG 415

Query: 421 LCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGS 480
           LCVQRKS L+PL LG CT+SEAW YT   T++L+G YFCLQA  +GKPAKLGIICTD  S
Sbjct: 416 LCVQRKSMLEPLRLGSCTDSEAWRYTSENTLTLRGTYFCLQADELGKPAKLGIICTDSTS 475

Query: 481 TWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTR 540
            W++ISDSKMHLSSK  NGT VCLDVDS+NTIV +TCKCLSRD TCDP SQWFKLV+STR
Sbjct: 476 KWDVISDSKMHLSSKITNGTAVCLDVDSNNTIVISTCKCLSRDNTCDPESQWFKLVNSTR 535

Query: 541 SSTTTKSFFQFNPI-LDLPGKDFIWKFFGL 569
           SS T K   + N I LDLP K+F WKF GL
Sbjct: 536 SSATAKPSLRINSILLDLPAKEFFWKFLGL 565

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102379|ref|XP_002312657.1| predicted protein [Populus trichocarpa] gi|222852477|gb|EEE90024.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110842|ref|XP_002315653.1| predicted protein [Populus trichocarpa] gi|222864693|gb|EEF01824.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424600|ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511061|ref|XP_003524250.1| PREDICTED: uncharacterized protein LOC100790415 [Glycine max] Back     alignment and taxonomy information
>gi|449435438|ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541382|ref|XP_003539156.1| PREDICTED: endoglucanase-like [Glycine max] Back     alignment and taxonomy information
>gi|356528434|ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max] Back     alignment and taxonomy information
>gi|356511059|ref|XP_003524249.1| PREDICTED: endoglucanase E1-like [Glycine max] Back     alignment and taxonomy information
>gi|357463207|ref|XP_003601885.1| Endoglucanase [Medicago truncatula] gi|355490933|gb|AES72136.1| Endoglucanase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
TAIR|locus:2031850552 AT1G13130 [Arabidopsis thalian 0.885 0.914 0.621 4.8e-181
TAIR|locus:2093571508 AT3G26140 [Arabidopsis thalian 0.868 0.974 0.594 7.6e-167
TAIR|locus:2093551551 AT3G26130 [Arabidopsis thalian 0.908 0.940 0.569 1.6e-164
TAIR|locus:2157482526 AT5G17500 [Arabidopsis thalian 0.871 0.944 0.578 2.1e-157
TAIR|locus:2149005488 AT5G16700 [Arabidopsis thalian 0.589 0.688 0.585 2.5e-136
UNIPROTKB|G4N8V8423 MGG_03374 "Beta-1,6-galactanas 0.615 0.829 0.309 7.1e-45
ASPGD|ASPL0000037062412 AN9166 [Emericella nidulans (t 0.392 0.543 0.383 1.5e-35
UNIPROTKB|G4MKY3480 MGG_05381 "Beta-1,6-galactanas 0.382 0.454 0.324 2.2e-31
UNIPROTKB|G4NBI5411 MGG_00530 "Endoglucanase E1" [ 0.529 0.734 0.268 4.4e-21
TAIR|locus:2031850 AT1G13130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1757 (623.6 bits), Expect = 4.8e-181, P = 4.8e-181
 Identities = 318/512 (62%), Positives = 397/512 (77%)

Query:    29 QQSKPAIGLPLSTNSRWIVDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDM 88
             Q + P +  PLST+SRWIVDENG RVKL C NW SHL+PVVAEGLSKQP+D ++K++V+M
Sbjct:    25 QNTVPNMSYPLSTSSRWIVDENGLRVKLVCANWPSHLQPVVAEGLSKQPVDAVAKKIVEM 84

Query:    89 GFNCVRLTWPLYLATNDSLAS-LTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAV 147
             GFNCVRLTWPL L TN++LA+ +TVRQSFQ LGL + I G Q+NNPSI+DLPLI+A++ V
Sbjct:    85 GFNCVRLTWPLDLMTNETLANNVTVRQSFQSLGLNDDIVGFQTNNPSIIDLPLIEAYKTV 144

Query:   148 VASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNV 207
             V +LGNN+VMVILDNH++KPGWCC+N DGNGFFGDQ+F+P +W+  L KMA  FNGV NV
Sbjct:   145 VTTLGNNDVMVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNV 204

Query:   208 VGMSLRNELRGPKQNVKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNL 267
             VGMSLRNELRGPKQNV DW++YMQ GAEAVH+AN +VLVILSGL+FD DLSFVR++ V L
Sbjct:   205 VGMSLRNELRGPKQNVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRPVKL 264

Query:   268 TFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADL 327
             +FTGKLVFE HWY F+DG +W   NPN +CGRV++ +    G+LL QG+PLF+SEFG D 
Sbjct:   265 SFTGKLVFELHWYSFSDGNSWAANNPNDICGRVLNRIGNGGGYLLNQGFPLFLSEFGIDE 324

Query:   328 RGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNS 387
             RG N NDNRY  C  G AAE D DW+LW L GSYYLR+G +G+NEYYG+ D +W  +RNS
Sbjct:   325 RGVNTNDNRYFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNS 384

Query:   388 SFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDP--LTLGPCTESEAWSY 445
             SFL++IS LQSP +GPG   T  + +++HP TGLC+ R S  DP  LTLGPC  SE WSY
Sbjct:   385 SFLQKISFLQSPLQGPGP-RTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSY 442

Query:   446 TPHKTISLKGAYFCLQAKHVGKPAKLG-IICTDCGSTWEIISDSKMHLSSKADNGTTVCL 504
             T  K + +K    CLQ+     P  +    C+  GS W+ IS S+MHL+S   N T++CL
Sbjct:   443 TK-KALRIKDQQLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCL 501

Query:   505 DVDSSNTIVTNTCKCLSRDKTCDPASQWFKLV 536
             DVD++N +V N CKCLS+DK+C+P SQWFK++
Sbjct:   502 DVDTANNVVANACKCLSKDKSCEPMSQWFKII 533
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2093571 AT3G26140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093551 AT3G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157482 AT5G17500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149005 AT5G16700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8V8 MGG_03374 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037062 AN9166 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKY3 MGG_05381 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBI5 MGG_00530 "Endoglucanase E1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.4LOW CONFIDENCE prediction!
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 5e-11
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 7e-04
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 9e-04
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information 
 Score = 63.1 bits (154), Expect = 5e-11
 Identities = 61/278 (21%), Positives = 98/278 (35%), Gaps = 48/278 (17%)

Query: 85  VVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSI-VDLPLIKA 143
           V D GFN VRL  P+                          GG   NNP   +D   +  
Sbjct: 31  VKDWGFNVVRL--PVS------------------------WGGYVPNNPDYLIDENWLNR 64

Query: 144 FQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNG 203
              VV    +N + VI+D H         + +GN      +F   LW    T++AT +  
Sbjct: 65  VDEVVDYAIDNGMYVIIDWHHD---TWPGDPNGNIDTAKAFFK-KLW----TQIATRYG- 115

Query: 204 VRNVVGMSLRNELRGPKQN--VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSFVR 261
               V   L NE  G        D   Y Q   +A+ AA P  L+I+ G ++ ++     
Sbjct: 116 NNPNVIFELMNEPHGVDPATWDDDVKDYAQEAIDAIRAAGPNNLIIVGGPSWSQNPDGAA 175

Query: 262 NQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVS 321
               +      L++  H+Y  +       G  ++        +   + + L+ G P+F+ 
Sbjct: 176 LN--DPNDDDNLIYSVHFYAPSHFSGTWFGCEDKTNLA--QRLRAAANYALDNGIPVFIG 231

Query: 322 EFGADLRGNNVND--NRYLNCFFGVAAELDWDWALWTL 357
           EFG         D   ++L+       E    W  W+ 
Sbjct: 232 EFGGGNADGPCRDEAEKWLDY----LKENGISWTGWSN 265

Length = 269
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 570
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 100.0
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.92
PRK10150604 beta-D-glucuronidase; Provisional 99.52
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 99.49
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 99.31
TIGR03356427 BGL beta-galactosidase. 99.17
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.14
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 99.13
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 99.1
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 99.07
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.98
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 98.94
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 98.9
COG3934587 Endo-beta-mannanase [Carbohydrate transport and me 98.77
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 98.37
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.32
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 98.32
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.3
COG3250808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 98.26
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 98.2
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.18
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 98.18
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.15
PF01229486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 98.14
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 98.07
PLN03059 840 beta-galactosidase; Provisional 98.05
PRK13511469 6-phospho-beta-galactosidase; Provisional 98.01
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 97.97
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 97.86
PLN02998497 beta-glucosidase 97.85
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 97.85
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.85
PLN02814504 beta-glucosidase 97.85
PLN02849503 beta-glucosidase 97.79
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 97.31
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 97.15
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 97.03
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 96.95
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 96.88
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 96.88
PF14488166 DUF4434: Domain of unknown function (DUF4434) 96.83
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 96.74
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 96.66
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 96.57
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 96.47
PLN02361401 alpha-amylase 96.04
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 95.91
PLN02784894 alpha-amylase 95.84
PRK12313633 glycogen branching enzyme; Provisional 95.69
KOG2230867 consensus Predicted beta-mannosidase [Carbohydrate 95.68
COG5520433 O-Glycosyl hydrolase [Cell envelope biogenesis, ou 95.64
PLN00196428 alpha-amylase; Provisional 95.54
PRK05402726 glycogen branching enzyme; Provisional 95.27
TIGR01515613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 95.07
KOG0496 649 consensus Beta-galactosidase [Carbohydrate transpo 95.06
PRK12568730 glycogen branching enzyme; Provisional 95.01
PRK14706639 glycogen branching enzyme; Provisional 94.34
PRK147051224 glycogen branching enzyme; Provisional 94.24
smart00642166 Aamy Alpha-amylase domain. 94.2
PLN02447758 1,4-alpha-glucan-branching enzyme 94.06
PRK10785598 maltodextrin glucosidase; Provisional 93.82
PF02055496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 93.78
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 93.74
TIGR02104605 pulA_typeI pullulanase, type I. Pullulan is an unu 93.54
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 93.4
PRK09441479 cytoplasmic alpha-amylase; Reviewed 93.18
PLN02960897 alpha-amylase 93.16
TIGR02402542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 93.09
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 93.07
PF13200316 DUF4015: Putative glycosyl hydrolase domain 92.95
KOG2233666 consensus Alpha-N-acetylglucosaminidase [Intracell 92.5
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 91.28
COG1649418 Uncharacterized protein conserved in bacteria [Fun 90.76
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 90.33
PLN02877970 alpha-amylase/limit dextrinase 90.14
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 90.09
COG0296628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 89.63
KOG3738559 consensus Predicted polypeptide N-acetylgalactosam 88.22
TIGR02403543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 87.88
PRK10933551 trehalose-6-phosphate hydrolase; Provisional 87.83
COG1523697 PulA Type II secretory pathway, pullulanase PulA a 87.77
TIGR02456539 treS_nterm trehalose synthase. Trehalose synthase 86.95
TIGR02100688 glgX_debranch glycogen debranching enzyme GlgX. Th 85.96
PRK09505683 malS alpha-amylase; Reviewed 85.29
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 85.25
PRK03705658 glycogen debranching enzyme; Provisional 84.95
PRK09997258 hydroxypyruvate isomerase; Provisional 83.27
TIGR02103898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 80.59
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 80.36
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=100.00  E-value=1.2e-36  Score=309.53  Aligned_cols=268  Identities=22%  Similarity=0.359  Sum_probs=201.1

Q ss_pred             EcCCCCEEEEEEeeCCCCCCccccCCCCCChHHHHHHHHHHcCCcEEEecccccccccCccccchhhhhhhhccchhhcc
Q 008330           47 VDENGHRVKLACVNWVSHLEPVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVRQSFQKLGLLEAIG  126 (570)
Q Consensus        47 Vd~~G~~v~L~GVNw~g~~~~~v~~Gl~~~~~~~~~~~i~~~GfN~VRlPi~~~~~~~~~~~n~tv~~s~~~lg~~~~~~  126 (570)
                      ||.+|++|.++|+|.....         ....+++++.|+++|||+||||+.+..+.+                      
T Consensus         1 ~~~~G~~v~~~G~n~~w~~---------~~~~~~~~~~~~~~G~n~VRi~v~~~~~~~----------------------   49 (281)
T PF00150_consen    1 VDQNGKPVNWRGFNTHWYN---------PSITEADFDQLKALGFNTVRIPVGWEAYQE----------------------   49 (281)
T ss_dssp             ECTTSEBEEEEEEEETTSG---------GGSHHHHHHHHHHTTESEEEEEEESTSTST----------------------
T ss_pred             CCCCCCeEEeeeeecccCC---------CCCHHHHHHHHHHCCCCEEEeCCCHHHhcC----------------------
Confidence            7999999999999975111         015789999999999999999999854331                      


Q ss_pred             CcccCCCCC-CCchHHHHHHHHHHHHhcCCCEEEEecCCCCCCccccCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCC
Q 008330          127 GIQSNNPSI-VDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVR  205 (570)
Q Consensus       127 g~~~~nP~~-~~~t~l~~ld~vV~~a~~~Gl~VILD~H~~~~~w~~~~~dgng~~~d~~~~~~~~~~~w~~iA~ryk~~p  205 (570)
                          .+|.. .+.+.+++|+++|++|.++||+||||+|.. |+|+...   +. +.......+.+.++|+.||+|||+++
T Consensus        50 ----~~~~~~~~~~~~~~ld~~v~~a~~~gi~vild~h~~-~~w~~~~---~~-~~~~~~~~~~~~~~~~~la~~y~~~~  120 (281)
T PF00150_consen   50 ----PNPGYNYDETYLARLDRIVDAAQAYGIYVILDLHNA-PGWANGG---DG-YGNNDTAQAWFKSFWRALAKRYKDNP  120 (281)
T ss_dssp             ----TSTTTSBTHHHHHHHHHHHHHHHHTT-EEEEEEEES-TTCSSST---ST-TTTHHHHHHHHHHHHHHHHHHHTTTT
T ss_pred             ----CCCCccccHHHHHHHHHHHHHHHhCCCeEEEEeccC-ccccccc---cc-cccchhhHHHHHhhhhhhccccCCCC
Confidence                12232 467899999999999999999999999997 5663221   11 11111124556789999999999999


Q ss_pred             cEEEEeccCCCCCCCCC-------hhHHHHHHHHHHHHHHhcCCCcEEEEeCCCCCCcchh-hhhcccCcCCCCCEEEEE
Q 008330          206 NVVGMSLRNELRGPKQN-------VKDWYRYMQLGAEAVHAANPEVLVILSGLNFDKDLSF-VRNQAVNLTFTGKLVFEA  277 (570)
Q Consensus       206 ~Vig~dL~NEP~~~~~~-------~~~W~~~~~~~~~aIr~~dp~~lIiVeG~~w~~dl~~-~~~~p~~l~~~~nlVys~  277 (570)
                      .|++|||+|||+.....       ...|.+++++++++||+++|+++|++++..|+.+... ....|.  ..++++||++
T Consensus       121 ~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~~~~~~~~Ir~~~~~~~i~~~~~~~~~~~~~~~~~~P~--~~~~~~~~~~  198 (281)
T PF00150_consen  121 PVVGWELWNEPNGGNDDANWNAQNPADWQDWYQRAIDAIRAADPNHLIIVGGGGWGADPDGAAADNPN--DADNNDVYSF  198 (281)
T ss_dssp             TTEEEESSSSGCSTTSTTTTSHHHTHHHHHHHHHHHHHHHHTTSSSEEEEEEHHHHTBHHHHHHHSTT--TTTTSEEEEE
T ss_pred             cEEEEEecCCccccCCccccccccchhhhhHHHHHHHHHHhcCCcceeecCCCccccccchhhhcCcc--cccCceeEEe
Confidence            99999999999886321       2678899999999999999999999999888877665 444552  1358999999


Q ss_pred             eecCCCCC-CCCCCCCCcchhhHHHHHHHHHHHHHHhcCCCeEEeccccCCCCCCcchHHHHHHHHHHHHHCCCceEEec
Q 008330          278 HWYGFTDG-QAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWT  356 (570)
Q Consensus       278 H~Y~~~~~-~~w~~~~~~~~~~~~~~~~~~~~g~l~~~g~Pv~iGEFG~~~~~~~~~~~~~~~~~~~~~~~~gigw~~W~  356 (570)
                      |.|.+..+ ..+... .......+...+.....++.+.+.||+|||||....+.. ....+...++++++++++||++|+
T Consensus       199 H~Y~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~g~pv~~gE~G~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~W~  276 (281)
T PF00150_consen  199 HFYDPYDFSDQWNPG-NWGDASALESSFRAALNWAKKNGKPVVVGEFGWSNNDGN-GSTDYADAWLDYLEQNGIGWIYWS  276 (281)
T ss_dssp             EEETTTCHHTTTSTC-SHHHHHHHHHHHHHHHHHHHHTTSEEEEEEEESSTTTSC-HHHHHHHHHHHHHHHTTCEEEECE
T ss_pred             eEeCCCCcCCccccc-cchhhhHHHHHHHHHHHHHHHcCCeEEEeCcCCcCCCCC-cCHHHHHHHHHHHHHCCCeEEEEe
Confidence            99997654 222210 011122344555666666777899999999999855433 346777888999999999999999


Q ss_pred             cC
Q 008330          357 LV  358 (570)
Q Consensus       357 ~~  358 (570)
                      |+
T Consensus       277 ~~  278 (281)
T PF00150_consen  277 WK  278 (281)
T ss_dssp             ES
T ss_pred             cC
Confidence            97

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>KOG2230 consensus Predicted beta-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5520 O-Glycosyl hydrolase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>KOG0496 consensus Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
1vrx_A358 Endocellulase E1 From Acidothermus Cellulolyticus M 2e-10
1ece_A358 Acidothermus Cellulolyticus Endocellulase E1 Cataly 1e-09
4dm1_A377 Contribution Of Disulfide Bond Toward Thermostabili 4e-05
2zum_A458 Functional Analysis Of Hyperthermophilic Endocellul 6e-05
3axx_A458 Functional Analysis Of Hyperthermophilic Endocellul 7e-05
3qhm_A458 Crystal Analysis Of The Complex Structure, E342a-Ce 1e-04
3qho_A458 Crystal Analysis Of The Complex Structure, Y299f-Ce 2e-04
3qhn_A458 Crystal Analysis Of The Complex Structure, E201a-Ce 4e-04
4dm2_A377 Contribution Of Disulfide Bond Toward Thermostabili 4e-04
>pdb|1VRX|A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g Length = 358 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 122/306 (39%), Gaps = 43/306 (14%)
Query: 41  TNSRWIVDENGHRVKLACVNWVSHLE-PVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPL 99
           T+ R I+D N   V++A +NW        V  GL  +    +  ++  +G+N +RL +  
Sbjct: 8   TSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPY-- 65
Query: 100 YLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVI 159
              ++D L   T+  S     + + + G+ S          ++    +VA  G   + +I
Sbjct: 66  ---SDDILKPGTMPNSINFYQMNQDLQGLTS----------LQVMDKIVAYAGQIGLRII 112
Query: 160 LDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNELRGP 219
           LD H  +P  C   S     +     +   WI  L  +A  + G   VVG  L NE   P
Sbjct: 113 LDRH--RPD-CSGQS---ALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDP 166
Query: 220 K-----QNVKDWYRYMQLGAEAVHAANPEVLVILSGLN--------FDKDLSFVRNQAVN 266
                     DW    +    AV + NP +L+ + G+         +  +L       V 
Sbjct: 167 ACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVV 226
Query: 267 LTFTGKLVFEAHWYGFTDG-QAWVDGN--PNQVCGRVVDNVMRLSGFLLEQG-WPLFVSE 322
           L    +LV+ AH Y  + G Q W      PN + G    N     G+L  Q   P+++ E
Sbjct: 227 LNVPNRLVYSAHDYATSVGPQTWFSDPTFPNNMPGIWNKNW----GYLFNQNIAPVWLGE 282
Query: 323 FGADLR 328
           FG  L+
Sbjct: 283 FGTTLQ 288
>pdb|1ECE|A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose Length = 358 Back     alignment and structure
>pdb|4DM1|A Chain A, Contribution Of Disulfide Bond Toward Thermostability In Hyperthermostable Endocellulase Length = 377 Back     alignment and structure
>pdb|2ZUM|A Chain A, Functional Analysis Of Hyperthermophilic Endocellulase From The Archaeon Pyrococcus Horikoshii Length = 458 Back     alignment and structure
>pdb|3AXX|A Chain A, Functional Analysis Of Hyperthermophilic Endocellulase From The Archaeon Pyrococcus Horikoshii Length = 458 Back     alignment and structure
>pdb|3QHM|A Chain A, Crystal Analysis Of The Complex Structure, E342a-Cellotetraose, Of Endocellulase From Pyrococcus Horikoshii Length = 458 Back     alignment and structure
>pdb|3QHO|A Chain A, Crystal Analysis Of The Complex Structure, Y299f-Cellotetraose, Of Endocellulase From Pyrococcus Horikoshii Length = 458 Back     alignment and structure
>pdb|3QHN|A Chain A, Crystal Analysis Of The Complex Structure, E201a-Cellotetraose, Of Endocellulase From Pyrococcus Horikoshii Length = 458 Back     alignment and structure
>pdb|4DM2|A Chain A, Contribution Of Disulfide Bond Toward Thermostability In Hyperthermostable Endocellulase Length = 377 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 6e-72
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 8e-57
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 4e-24
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 2e-21
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 4e-21
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 4e-20
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 8e-20
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 1e-19
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 1e-17
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 1e-17
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 2e-17
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 6e-17
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 1e-16
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 1e-16
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 1e-16
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 2e-16
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 7e-16
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 9e-16
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 8e-15
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 4e-14
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 1e-13
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 2e-13
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 1e-12
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 8e-12
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 7e-06
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 3e-04
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 7e-04
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
 Score =  233 bits (596), Expect = 6e-72
 Identities = 74/387 (19%), Positives = 131/387 (33%), Gaps = 55/387 (14%)

Query: 38  PLSTNSRWIVDENGHRVKLACVNWVSHLEP-VVAEGLSKQPMDMLSKRVVDMGFNCVRLT 96
              T+ R I+D N   V++A +NW        V  GL  +    +  ++  +G+N +RL 
Sbjct: 5   YWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLP 64

Query: 97  WPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNV 156
           +     ++D L   T+  S                N  +  L  ++    +VA  G   +
Sbjct: 65  Y-----SDDILKPGTMPNSI----------NFYQMNQDLQGLTSLQVMDKIVAYAGQIGL 109

Query: 157 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL 216
            +ILD H             +  +     +   WI  L  +A  + G   VVG  L NE 
Sbjct: 110 RIILDRHRPDCSG------QSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEP 163

Query: 217 RGP-----KQNVKDWYRYMQLGAEAVHAANPEVLVILSGLN--------FDKDLSFVRNQ 263
             P          DW    +    AV + NP +L+ + G+         +  +L      
Sbjct: 164 HDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQY 223

Query: 264 AVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQ-GWPLFVSE 322
            V L    +LV+ AH Y  +        +P      +     +  G+L  Q   P+++ E
Sbjct: 224 PVVLNVPNRLVYSAHDYATSVYPQTWFSDPTF-PNNMPGIWNKNWGYLFNQNIAPVWLGE 282

Query: 323 FGADLRGNNVNDNRYLNCF------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGL 376
           FG  L+     D  +L                 + W  W+               +  G+
Sbjct: 283 FGTTLQST--TDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGI 331

Query: 377 FDWNWCDIRNSSFLERISSLQSPFRGP 403
              +W  +        ++ ++S    P
Sbjct: 332 LKDDWQTVDT-VKDGYLAPIKSSIFDP 357
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 100.0
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 100.0
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 100.0
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 100.0
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 100.0
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 100.0
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 100.0
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 100.0
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 100.0
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 100.0
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 100.0
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 100.0
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 100.0
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 100.0
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 100.0
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 100.0
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 100.0
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 100.0
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 100.0
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 100.0
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 100.0
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 100.0
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 100.0
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 100.0
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 100.0
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 100.0
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.98
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.97
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.96
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.95
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.95
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.95
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.94
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.94
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.85
2w61_A555 GAS2P, glycolipid-anchored surface protein 2; glyc 99.76
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.74
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 99.68
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 99.56
3cmg_A667 Putative beta-galactosidase; structural genomics, 99.53
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.53
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.5
3fn9_A692 Putative beta-galactosidase; structural genomics, 99.46
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.4
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.39
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.37
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 99.37
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 99.36
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.34
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 99.34
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.3
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.28
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 99.27
2je8_A848 Beta-mannosidase; glycoside hydrolase, hydrolase; 99.19
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.19
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 99.18
3d3a_A612 Beta-galactosidase; protein structure initiative I 99.17
3gm8_A801 Glycoside hydrolase family 2, candidate beta-GLYC; 99.15
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.15
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.14
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 99.12
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.12
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 99.11
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 99.11
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.1
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.05
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 99.04
3kzs_A463 Glycosyl hydrolase family 5; structural genomics, 99.04
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 99.03
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.02
3u7v_A552 Beta-galactosidase; structural genomics, PSI-biolo 99.02
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.0
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 99.0
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 98.97
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 98.95
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.94
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 98.93
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 98.88
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 98.88
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 98.88
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 98.87
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 98.86
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 98.83
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 98.79
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.78
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 98.76
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 98.76
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.75
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 98.74
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 98.73
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.73
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 98.67
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 98.65
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 98.64
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 98.6
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.53
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.51
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 98.45
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 98.44
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.42
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 98.4
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.4
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.37
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 98.35
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 98.35
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 98.34
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 98.34
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 98.31
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 98.3
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 98.28
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 98.28
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.27
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 98.26
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 98.26
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.25
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 98.25
4e8d_A595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 98.25
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 98.25
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 98.24
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 98.23
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 98.23
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.21
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.21
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 98.19
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.19
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 98.18
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.14
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 98.13
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.12
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 98.08
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.06
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.05
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.05
1qw9_A502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 98.05
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 98.04
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.03
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 98.02
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 97.99
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 97.99
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 97.94
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 97.93
2c7f_A513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 97.92
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 97.91
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 97.9
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 97.9
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 97.88
3a07_A118 Actinohivin; carbohydrate-binding module family 13 97.85
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 97.82
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 97.79
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 97.7
3clw_A507 Conserved exported protein; structural genomics, u 97.62
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 97.6
3vny_A488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 97.57
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 97.56
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 97.55
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 97.52
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 97.51
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.51
4aw7_A591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 97.5
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 97.48
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.48
2y2w_A574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 97.41
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 97.4
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 97.38
3ug3_A504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 97.34
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.34
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 97.2
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 97.08
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 97.07
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 97.06
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 96.98
3tp4_A475 Computational design of enzyme; structural genomic 96.9
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 96.9
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 96.89
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 96.87
2vrq_A496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 96.85
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 96.83
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 96.7
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 96.66
3phz_A286 Ricin B-related lectin; beta trefoil, saccharide b 96.62
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 96.4
3ef2_A293 Agglutinin, lectin; beta-trefoil, calcium-binding, 96.31
3ik2_A517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 96.28
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 96.19
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 96.04
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 95.95
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 95.94
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 95.9
2yih_A524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 95.74
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 95.5
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 95.33
3k1d_A722 1,4-alpha-glucan-branching enzyme; mycobacterium t 95.13
3kl0_A401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 94.8
3edf_A601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 94.67
1m7x_A617 1,4-alpha-glucan branching enzyme; alpha/beta barr 94.26
4gqr_A496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 94.14
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 94.12
1j0h_A588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 94.09
3dhu_A449 Alpha-amylase; structural genomics, hydrolase, gly 94.08
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 93.89
1wzl_A585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 93.74
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 93.64
3ii1_A535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 93.16
3zss_A695 Putative glucanohydrolase PEP1A; alpha-glucan bios 93.14
4aie_A549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 92.99
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 92.98
2wan_A921 Pullulanase; hydrolase, glycoside hydrolase, polys 92.76
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 92.7
3faw_A877 Reticulocyte binding protein; TIM barrel, beta bar 92.57
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 92.46
1hvx_A515 Alpha-amylase; hydrolase, glycosyltransferase, the 92.01
1g94_A448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 91.86
3bh4_A483 Alpha-amylase; calcium, carbohydrate metabolism, g 90.99
2guy_A478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 90.75
1zja_A557 Trehalulose synthase; sucrose isomerase, alpha-amy 90.65
1lwj_A441 4-alpha-glucanotransferase; alpha-amylase family, 90.52
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 90.46
1ud2_A480 Amylase, alpha-amylase; calcium-free, alkaline, hy 90.29
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 90.17
2aaa_A484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 90.05
2e8y_A718 AMYX protein, pullulanase; multiple domain, beta-a 89.9
2zic_A543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 89.75
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 89.72
2ze0_A555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 89.58
1m53_A570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 89.5
2z1k_A475 (NEO)pullulanase; hydrolase, structural genomics, 89.35
2wc7_A488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 89.34
1jae_A471 Alpha-amylase; glycosidase, carbohydrate metabolis 89.0
1uok_A558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 88.89
1wpc_A485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 88.62
3aj7_A589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 88.44
1mxg_A435 Alpha amylase; hyperthermostable, family 13 glycos 88.4
2bhu_A602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 88.16
3czg_A644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 87.81
1g5a_A628 Amylosucrase; glycosyltransferase, glycoside hydro 87.76
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 87.01
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 86.97
3vgf_A558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 86.45
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 85.74
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 85.72
1gjw_A637 Maltodextrin glycosyltransferase; alpha-amylase, m 85.46
1xez_A721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 85.03
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 85.01
2vr5_A718 Glycogen operon protein GLGX; hydrolase, glycosida 84.84
1bf2_A750 Isoamylase; hydrolase, glycosidase, debranching en 84.44
1ua7_A422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 84.4
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 84.08
2wsk_A657 Glycogen debranching enzyme; carbohydrate metaboli 83.97
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 83.96
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 83.94
1wza_A488 Alpha-amylase A; hydrolase, halophilic, thermophil 83.76
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 82.69
2ya0_A714 Putative alkaline amylopullulanase; hydrolase, gly 82.61
3m07_A618 Putative alpha amylase; IDP00968, csgid, structura 82.44
3aml_A755 OS06G0726400 protein; starch-branching, transferas 82.3
3bc9_A599 AMYB, alpha amylase, catalytic region; acarbose, t 81.27
1ji1_A637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 80.27
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 80.05
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
Probab=100.00  E-value=4.5e-59  Score=505.77  Aligned_cols=332  Identities=21%  Similarity=0.353  Sum_probs=283.4

Q ss_pred             CCCCCCeEecCCeEEc---CCC--CEEEEEEeeCCCCCC-ccccCCCCCChHHHHHHHHHHcCCcEEEecccccccccCc
Q 008330           33 PAIGLPLSTNSRWIVD---ENG--HRVKLACVNWVSHLE-PVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDS  106 (570)
Q Consensus        33 ~~~~~~L~t~G~~IVd---~~G--~~v~L~GVNw~g~~~-~~v~~Gl~~~~~~~~~~~i~~~GfN~VRlPi~~~~~~~~~  106 (570)
                      ..+.++|+|+|++|||   ++|  ++|+|+||||+|++. ..+++|+|.++++++++.|+++|||+||||++++.+.+..
T Consensus        35 ~~~~~~l~v~G~~iv~~~~~~G~~~~v~l~GVN~~G~e~~~~~~~Gl~~~~~~~~i~~ik~~G~N~VRipi~~~~l~~~~  114 (458)
T 3qho_A           35 TPTGIYYEVRGDTIYMINVTSGEETPIHLFGVNWFGFETPNHVVHGLWKRNWEDMLLQIKSLGFNAIRLPFCTESVKPGT  114 (458)
T ss_dssp             CSSSEEEEEETTEEEEEETTTCCEEECCCEEEECCCTTSTTCSCTTTTTSCHHHHHHHHHHTTCCEEEEEEETGGGSTTC
T ss_pred             CCCCCeEEEECCEEEEecCCCCCcceEEEEEEecCcccccccccCCCCCCCHHHHHHHHHHcCCCEEEEeeeHHHhCCCC
Confidence            4467889999999999   488  999999999999985 6789999999999999999999999999999998776421


Q ss_pred             cccchhhhhhhhccchhhccCcccCCCCCCCchHHHHHHHHHHHHhcCCCEEEEecCCCCCCccccCCCCCCCCCCCCCC
Q 008330          107 LASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFN  186 (570)
Q Consensus       107 ~~n~tv~~s~~~lg~~~~~~g~~~~nP~~~~~t~l~~ld~vV~~a~~~Gl~VILD~H~~~~~w~~~~~dgng~~~d~~~~  186 (570)
                      .   +             ....+..||.+.+.+.++.||++|++|.++|||||||+|...+.    . ....|+.+. +.
T Consensus       115 ~---p-------------~~~~~~~np~~~~~~~l~~ld~vV~~a~~~Gi~VIldlH~~~~~----~-~~~~W~~~~-~~  172 (458)
T 3qho_A          115 Q---P-------------IGIDYSKNPDLRGLDSLQIMEKIIKKAGDLGIFVLLDYHRIGCT----H-IEPLWYTED-FS  172 (458)
T ss_dssp             C---C-------------CCCCTTTCGGGTTCCHHHHHHHHHHHHHHTTCEEEEEEEESSSS----S-CCSSSCBTT-BC
T ss_pred             C---c-------------cccccccCccccchHHHHHHHHHHHHHHHCCCEEEEecccCCCc----c-CCCccCCch-hh
Confidence            0   0             01124568888888999999999999999999999999997532    1 122454443 57


Q ss_pred             HHHHHHHHHHHHHHhCCCCcEEEEeccCCCCCCC-----------------CChhHHHHHHHHHHHHHHhcCCCcEEEEe
Q 008330          187 PDLWIKGLTKMATIFNGVRNVVGMSLRNELRGPK-----------------QNVKDWYRYMQLGAEAVHAANPEVLVILS  249 (570)
Q Consensus       187 ~~~~~~~w~~iA~ryk~~p~Vig~dL~NEP~~~~-----------------~~~~~W~~~~~~~~~aIr~~dp~~lIiVe  249 (570)
                      .++|+++|++||+|||++|+|++|||+|||++..                 .+..+|+.++++++++||++||+++|+|+
T Consensus       173 ~~~~~~~w~~lA~ryk~~p~Vi~~eL~NEP~~~~~~~~~~~~~~~~~W~~~~~~~~w~~~~~~ai~aIRa~dp~~lIiv~  252 (458)
T 3qho_A          173 EEDFINTWIEVAKRFGKYWNVIGADLKNEPHSVTSPPAAYTDGTGATWGMGNPATDWNLAAERIGKAILKVAPHWLIFVE  252 (458)
T ss_dssp             HHHHHHHHHHHHHHHTTSTTEEEEECSSCCCCSSCTTGGGTSSSSCBSSSSCTTTBHHHHHHHHHHHHHHHCTTCEEEEC
T ss_pred             HHHHHHHHHHHHHHhCCCCCEEEEEccCCCCcccccccccccccccccCCCCcHHHHHHHHHHHHHHHHHhCCCCEEEEc
Confidence            8999999999999999999999999999999631                 13468999999999999999999999999


Q ss_pred             CCCCCC-----------------cchhhhhcccCcCCCCCEEEEEeecCCCCC-CCCCCCCCcchhhHHHHHHHHHHHHH
Q 008330          250 GLNFDK-----------------DLSFVRNQAVNLTFTGKLVFEAHWYGFTDG-QAWVDGNPNQVCGRVVDNVMRLSGFL  311 (570)
Q Consensus       250 G~~w~~-----------------dl~~~~~~p~~l~~~~nlVys~H~Y~~~~~-~~w~~~~~~~~~~~~~~~~~~~~g~l  311 (570)
                      |..|++                 +|+.+++.|++++ .+|+||++|.|+++++ |+|+.+ .+..|.++.+.|+++++|+
T Consensus       253 G~~w~~~~~~~~~~~~~~~wwg~~l~~v~~~Pi~l~-~~nlvYs~H~Y~~~~~~~~~~~~-~~~~~~~~~~~w~~~~g~l  330 (458)
T 3qho_A          253 GTQFTNPKTDSSYKWGYNAWWGGNLMAVKDYPVNLP-RNKLVYSPHVFGPDVYNQPYFGP-AKGFPDNLPDIWYHHFGYV  330 (458)
T ss_dssp             CBSCCCHHHHHTSTTTTCCCTTCBCGGGTTSCCCSC-TTTEEECCBCCCTTTCCCGGGSG-GGTTTTTHHHHHHHHTTHH
T ss_pred             CCcccCccccccccccccCcCCCCchhhhcCCCcCC-CCCEEEEEEECCCCCCCCccccC-ccchHHHHHHHHHhhhhhH
Confidence            998865                 8999999999876 6999999999999987 788743 2345678899999999999


Q ss_pred             H-hcCCCeEEeccccCCCC-CCcchHHHHHHHHHHHHHCCC-ceEEeccCceeecccCccCCCceeeeecCCCCCccchh
Q 008330          312 L-EQGWPLFVSEFGADLRG-NNVNDNRYLNCFFGVAAELDW-DWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSS  388 (570)
Q Consensus       312 ~-~~g~Pv~iGEFG~~~~~-~~~~~~~~~~~~~~~~~~~gi-gw~~W~~~G~y~~r~~~~~~~et~Gll~~dw~~~~~~~  388 (570)
                      . +++.||+|||||..+.. .++.+.+|++++++|+++++| +|++|+++         ++++||+|||++||.+++.+ 
T Consensus       331 ~~~~~~Pl~igEfG~~~~~g~~~~~~~w~~~~~~yl~~~~i~~w~~W~~n---------p~s~dt~Gll~~dW~t~~~~-  400 (458)
T 3qho_A          331 KLELGYSVVIGEFGGKYGHGGDPRDVIWQNKLVDWMIENKFCDFFYWSWN---------PDSGDTGGILQDDWTTIWED-  400 (458)
T ss_dssp             HHTTCCCBCBCBCCCCTTSSSCTHHHHHHHHHHHHHHHTTCCCEEESCSS---------SCCTTTCCSBCTTSSSBCHH-
T ss_pred             hhcCCCcEEEEecCCCcCCCCCcchHHHHHHHHHHHHhcCCCCEEEEecC---------CCCCCCCcccccccCCcChH-
Confidence            7 69999999999999853 445578999999999999997 89999998         88899999999999999987 


Q ss_pred             HHHHHHhcccccC
Q 008330          389 FLERISSLQSPFR  401 (570)
Q Consensus       389 ~~~~~~~l~~~~~  401 (570)
                         ++++|++.+.
T Consensus       401 ---k~~~l~~~~~  410 (458)
T 3qho_A          401 ---KYNNLKRLMD  410 (458)
T ss_dssp             ---HHHHHGGGGC
T ss_pred             ---HHHHHHHHhc
Confidence               6688888774
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 570
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 2e-42
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 3e-21
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 2e-19
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 9e-18
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 2e-17
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 6e-17
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 1e-16
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 5e-12
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 6e-12
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 2e-11
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 6e-11
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 1e-10
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 4e-08
d1uuqa_410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 3e-07
d2c0ha1350 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue 5e-06
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 1e-05
d1rh9a1370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 0.001
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

 Score =  154 bits (388), Expect = 2e-42
 Identities = 67/386 (17%), Positives = 124/386 (32%), Gaps = 53/386 (13%)

Query: 38  PLSTNSRWIVDENGHRVKLACVNWVSHLE-PVVAEGLSKQPMDMLSKRVVDMGFNCVRLT 96
              T+ R I+D N   V++A +NW        V  GL  +    +  ++  +G+N +RL 
Sbjct: 5   YWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLP 64

Query: 97  WPLYLATNDSLASLTVRQSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNV 156
           +   +    ++ +                      N  +  L  ++    +VA  G   +
Sbjct: 65  YSDDILKPGTMPNSI---------------NFYQMNQDLQGLTSLQVMDKIVAYAGQIGL 109

Query: 157 MVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKGLTKMATIFNGVRNVVGMSLRNEL 216
            +ILD            S  +  +     +   WI  L  +A  + G   VVG  L NE 
Sbjct: 110 RIILDR------HRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEP 163

Query: 217 RGPK-----QNVKDWYRYMQLGAEAVHAANPEVLVILSGLNF--------DKDLSFVRNQ 263
             P          DW    +    AV + NP +L+ + G+            +L      
Sbjct: 164 HDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQY 223

Query: 264 AVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEF 323
            V L    +LV+ AH Y  +        +P                   +   P+++ EF
Sbjct: 224 PVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEF 283

Query: 324 GADLRGNNVNDNRYLNCF------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLF 377
           G  L+     D  +L                 + W  W+               +  G+ 
Sbjct: 284 GTTLQST--TDQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGIL 332

Query: 378 DWNWCDIRNSSFLERISSLQSPFRGP 403
             +W  + ++     ++ ++S    P
Sbjct: 333 KDDWQTV-DTVKDGYLAPIKSSIFDP 357
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 100.0
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 100.0
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 100.0
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 100.0
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 100.0
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 100.0
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.97
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.96
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.96
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.95
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.95
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.93
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.78
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 99.75
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.7
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.65
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.51
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 99.42
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 99.29
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 99.15
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 99.13
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 99.07
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 99.03
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.01
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.95
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.94
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.89
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 98.85
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 98.84
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 98.77
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 98.75
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 98.72
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.71
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.71
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 98.71
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.7
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 98.7
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 98.69
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 98.69
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 98.68
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.67
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 98.64
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 98.6
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.54
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 98.53
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.53
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.51
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 98.46
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.43
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.41
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 98.4
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 98.38
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.36
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 98.36
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.35
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 98.29
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.2
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 98.14
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.14
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 98.12
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 98.07
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 97.99
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 97.99
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 97.93
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 97.89
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 97.87
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 97.86
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.84
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 97.77
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 97.73
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.63
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 97.58
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.58
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.5
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 97.47
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.47
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 97.46
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 97.36
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.34
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.33
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.28
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.18
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 97.12
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 97.05
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 96.9
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 96.88
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 96.77
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 96.69
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 96.69
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 96.68
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 96.62
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 96.46
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 96.34
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 96.31
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 96.28
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 95.42
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 95.33
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 95.31
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 95.21
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 95.09
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 95.04
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 95.0
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 94.89
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 94.78
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 94.74
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 94.43
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 94.42
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 94.39
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 94.24
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 94.17
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 93.68
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 93.49
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 92.99
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 92.91
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 92.62
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 92.32
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 92.01
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 91.95
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 90.93
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 90.68
d1bf2a3475 Isoamylase, central domain {Pseudomonas amyloderam 90.62
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 90.6
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 90.54
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 90.18
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 89.31
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 89.0
d2fhfa5563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 88.56
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 87.72
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 85.87
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 85.8
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 84.43
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 81.61
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 81.12
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 80.09
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 80.06
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

Probab=100.00  E-value=4.4e-50  Score=416.56  Aligned_cols=334  Identities=21%  Similarity=0.380  Sum_probs=260.4

Q ss_pred             CCCCeEecCCeEEcCCCCEEEEEEeeCCCCCC-ccccCCCCCChHHHHHHHHHHcCCcEEEecccccccccCccccchhh
Q 008330           35 IGLPLSTNSRWIVDENGHRVKLACVNWVSHLE-PVVAEGLSKQPMDMLSKRVVDMGFNCVRLTWPLYLATNDSLASLTVR  113 (570)
Q Consensus        35 ~~~~L~t~G~~IVd~~G~~v~L~GVNw~g~~~-~~v~~Gl~~~~~~~~~~~i~~~GfN~VRlPi~~~~~~~~~~~n~tv~  113 (570)
                      ..++|||+|++|||.+|++|+||||||+|++. ...++|++.++.+++++.||++|||+||||+.++++.+..+..    
T Consensus         2 ~~g~l~~~G~~~~d~~G~~~~l~GvN~~g~~~~~~~~~~~~~~~~~~~~~~i~~~G~N~VRlpv~~~~~~~~~~~~----   77 (358)
T d1ecea_           2 GGGYWHTSGREILDANNVPVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPN----   77 (358)
T ss_dssp             CCSCCEEETTEEECTTSCEECCEEEECCCBTTTTCSCTTTTTSCHHHHHHHHHHTTCCEEEEEEEGGGGSTTCCCC----
T ss_pred             CCCeEEeeCCEEECCCCCEEEEEEEccCcccccccccccCCccHHHHHHHHHHHcCCCEEEecCcHHHccCCCCCC----
Confidence            45899999999999999999999999999986 4689999999999999999999999999999999887632110    


Q ss_pred             hhhhhccchhhccCcccCCCCCCCchHHHHHHHHHHHHhcCCCEEEEecCCCCCCccccCCCCCCCCCCCCCCHHHHHHH
Q 008330          114 QSFQKLGLLEAIGGIQSNNPSIVDLPLIKAFQAVVASLGNNNVMVILDNHISKPGWCCSNSDGNGFFGDQYFNPDLWIKG  193 (570)
Q Consensus       114 ~s~~~lg~~~~~~g~~~~nP~~~~~t~l~~ld~vV~~a~~~Gl~VILD~H~~~~~w~~~~~dgng~~~d~~~~~~~~~~~  193 (570)
                                 ....+..+|.+.+.+++++|+++|++|.++||+||||+|...+.+      .+.+|.+.....+.|+++
T Consensus        78 -----------~~~~~~~~~~~~~~~~~~~ld~~v~~a~~~Gl~Vildlh~~~~~~------~~~~~~~~~~~~~~~~~~  140 (358)
T d1ecea_          78 -----------SINFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSG------QSALWYTSSVSEATWISD  140 (358)
T ss_dssp             -----------SCCCSSSCTTTTTCCHHHHHHHHHHHHHHTTCEEEEEEEESBTTB------CCSSSCCSSSCHHHHHHH
T ss_pred             -----------CccccccChhhhchhHHHHHHHHHHHHHHCCCceeeecccccccC------CCccccCChHHHHHHHHH
Confidence                       122345688888899999999999999999999999999865331      233333334678999999


Q ss_pred             HHHHHHHhCCCCcEEEEeccCCCCCCC-----CChhHHHHHHHHHHHHHHhcCCCcEEEEeCCC--------CCCcchhh
Q 008330          194 LTKMATIFNGVRNVVGMSLRNELRGPK-----QNVKDWYRYMQLGAEAVHAANPEVLVILSGLN--------FDKDLSFV  260 (570)
Q Consensus       194 w~~iA~ryk~~p~Vig~dL~NEP~~~~-----~~~~~W~~~~~~~~~aIr~~dp~~lIiVeG~~--------w~~dl~~~  260 (570)
                      |++||+||+++|+|++|||+|||....     .....|++++++++++||+++|+++|+|+|..        |+.++...
T Consensus       141 ~~~ia~~~~~~~~v~~~el~NEP~~~~~~~~~~~~~~~~~~~~~~~~~Ir~~d~~~~v~v~g~~~~~~~~~~~~~~~~~~  220 (358)
T d1ecea_         141 LQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGA  220 (358)
T ss_dssp             HHHHHHHTTTCTTEEEEECSSCCCTTCBSSCCCTTTBHHHHHHHHHHHHHHHCTTSEEEEECBSEETTEECSTTTBCTTT
T ss_pred             HHHHHHhhcCccceEeeeeccccccCCcCCccchhhhHHHHHHHHHHHHHhhCCCcEEEEeccccCccccccccccccch
Confidence            999999999999999999999998753     23567899999999999999999999999865        34455555


Q ss_pred             hhcccCcCCCCCEEEEEeecCCCCCC-CCCCCCCcchhhHHHHHHHHHHHHHH-hcCCCeEEeccccCCCCCCcchHHHH
Q 008330          261 RNQAVNLTFTGKLVFEAHWYGFTDGQ-AWVDGNPNQVCGRVVDNVMRLSGFLL-EQGWPLFVSEFGADLRGNNVNDNRYL  338 (570)
Q Consensus       261 ~~~p~~l~~~~nlVys~H~Y~~~~~~-~w~~~~~~~~~~~~~~~~~~~~g~l~-~~g~Pv~iGEFG~~~~~~~~~~~~~~  338 (570)
                      ...++.++..+++||++|.|+++.+. .+....  ..+..+...+.+.+++.. +.++||+|||||+.....  ...+|.
T Consensus       221 ~~~~~~~~~~~~~v~~~H~Y~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~Pv~igEfG~~~~~~--~~~~~~  296 (358)
T d1ecea_         221 GQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDP--TFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQTWL  296 (358)
T ss_dssp             TTSCCCCSSSSCEEEEEECCCTTTCCCGGGSCT--TTTTTHHHHHHHHTHHHHHTTSSCEEEEECCCCCCSH--HHHHHH
T ss_pred             hhCCccCCccCceEEEeeecCCCcCCccccccc--hhhhhHHHHHHHHHHHHHHhcCCeEEEecCCCCCCCC--ChHHHH
Confidence            55566556678999999999987652 222111  122334445555555443 378999999999987643  245666


Q ss_pred             HHHHHHH------HHCCCceEEeccCceeecccCccCCCceeeeecCCCCCccchhHHHHHHhcccccCCC
Q 008330          339 NCFFGVA------AELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  403 (570)
Q Consensus       339 ~~~~~~~------~~~gigw~~W~~~G~y~~r~~~~~~~et~Gll~~dw~~~~~~~~~~~~~~l~~~~~~p  403 (570)
                      +++.+++      .+.+++|+||+|+         ++.++++|++.+||.+++.++ ...++.++..+-+|
T Consensus       297 ~~~~~~~~~~~~~~~~~~gw~~W~~k---------~~~~~~~G~~~~dw~~~~~~~-~~~i~~~~~~~~~~  357 (358)
T d1ecea_         297 KTLVQYLRPTAQYGADSFQWTFWSWN---------PDSGDTGGILKDDWQTVDTVK-DGYLAPIKSSIFDP  357 (358)
T ss_dssp             HHHHHHTCCHHHHTTSSCEEEESCSC---------SCCTTTCCSBCTTSSSBCHHH-HHHHGGGCCCCCCC
T ss_pred             HHHHHHHHHHHHhcccCceEEEEcCC---------CCCCCCcceecCCCCCCChhh-hhhccccccccCCC
Confidence            6666654      3678999999998         666889999999999998764 55677777666554
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure