Citrus Sinensis ID: 008358


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MASSIVEGAERDLEKGIISPQLSQKSIGESSLTPSPSPSPSSATAPALVLSNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRVRSIRKREKNARMRSGSNSWYPSDYSNSEIDRIYAL
cHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHHccccccccccccHHHHccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHHHcccccHHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
cHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccccHEEEEEEHHHHHHHHHHHHHEEHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccEEEEc
MASSIVEGAErdlekgiispqlsqksigessltpspspspssatapalvlsnsgkridqagKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDsqmvgnlsgaefdTEVAEIRSSVVNELLKYstkegltrknrsgfdplhiAAVQGHHAIVQVLLdhdpslsqttgpsnatplvsaaTRGHTAVVNELLskdgglleisrSNGKNALHFAARQGHVDVVKALLskdpqlarrtdkkgqTALHMAVKGQSCEVVKLLLEADAAIVMlpdkfgntalhvATRKKRTEIVTELLslpdtnvnaltrDHKTALDiaeglpsseeASEIKDCLARCGAvranelnqprdELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFAsiftvpggdddngkAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRVRSIRKReknarmrsgsnswypsdysnseiDRIYAL
massivegaerdlekgiispqlsqksIGESSLTPSPSPSPSSATAPALVLsnsgkridqagKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKystkegltrknrSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTEllslpdtnvnaltRDHKTALDIAEGLPSSEEASEIKDCLARCGAVranelnqprdelrKTVTQIKKDvhtqleqtrrtnknvhnISKELRKLHREGINNATNSVTVVAVLFATVAFASIftvpggdddnGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLvrgetkaekRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTyyvvkskrvrsirkreknarmrsgsnswypsdysnseidriyal
MASSIVEGAERDLEKGIISPQLSQKSIGEssltpspspspssatapalvlsNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGInnatnsvtvvavlfatvafaSIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYvvkskrvrsirkrekNARMRSGSNSWYPSDYSNSEIDRIYAL
**************************************************************************DTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLD************************HTAVVNELLSKDGGLLEISR*NGKNALHFAARQGHVDVVKALL****************ALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDH*TAL****************DCLARCGAV**********************************************LHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSK*************************************
MASSIVEGAERDLEKGIISPQLSQKSIGESSLTPSPSPSPSSATAPALVLSNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELRKTVTQIKKDVH*********************KLHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRV***************************EIDRIYAL
********AERDLEKGIISPQLS**********************PALVLSNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQL**************AVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEG*********IKDCLARCGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRV******************WYPSDYSNSEIDRIYAL
MAS****GAERDLEKGIISPQLSQKSIGESSLTPSPSPSPSSATAPALVLSNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRVRSIR*********************NSEIDRIYAL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSIVEGAERDLEKGIISPQLSQKSIGESSLTPSPSPSPSSATAPALVLSNSGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYVVKSKRVRSIRKREKNARMRSGSNSWYPSDYSNSEIDRIYAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query568 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing yes no 0.991 0.954 0.787 0.0
Q9ZU96532 Ankyrin repeat-containing no no 0.818 0.874 0.416 1e-97
Q6AWW5524 Ankyrin repeat-containing no no 0.802 0.870 0.417 1e-92
Q9ULH0 1771 Kinase D-interacting subs yes no 0.392 0.125 0.346 8e-20
Q9EQG6 1762 Kinase D-interacting subs yes no 0.392 0.126 0.346 2e-19
Q7T163 1672 Kinase D-interacting subs yes no 0.413 0.140 0.334 5e-18
Q804S51030 E3 ubiquitin-protein liga yes no 0.492 0.271 0.310 5e-18
Q80YE7 1442 Death-associated protein no no 0.323 0.127 0.336 1e-16
Q86YT61006 E3 ubiquitin-protein liga no no 0.461 0.260 0.298 2e-16
Q6GNY11011 E3 ubiquitin-protein liga N/A no 0.492 0.276 0.291 2e-16
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/592 (78%), Positives = 512/592 (86%), Gaps = 29/592 (4%)

Query: 2   ASSIVEGAERDLEKG-IISPQLSQKSIGESSLTPSPSPSPS-SATAPALVLSNSGKRIDQ 59
           ASS V+G ERD+EKG +I  Q S+       + PSP+PSPS +ATAPALVLSNSGKR+DQ
Sbjct: 3   ASSYVDG-ERDMEKGGMILLQSSENQ--NPMIDPSPTPSPSATATAPALVLSNSGKRMDQ 59

Query: 60  AGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRS 119
           AGKKKYVKQVTGRHNDTELHLAAQRGDL AV+QIL  I+SQM G LSG EFD EVAEIR+
Sbjct: 60  AGKKKYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRA 119

Query: 120 SVVNE-----------------------LLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAI 156
           S+VNE                       LLKYS++E + +KNRSG+DPLHIAA+QGHHAI
Sbjct: 120 SIVNEVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAI 179

Query: 157 VQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFA 216
           V+VLLDHD +LSQT GPSNATPLVSAA RGHT VVN+LLSK G LLEISRSN KNALH A
Sbjct: 180 VEVLLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLA 239

Query: 217 ARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKF 276
           ARQGHV+V+KALLSKDPQLARR DKKGQTALHMAVKGQS EVVKLLL+AD AIVM PDK 
Sbjct: 240 ARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKS 299

Query: 277 GNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLAR 336
            NTALHVATRKKR EIV  LLSLPDTN N LTRDHKTALDIAEGLP SEE+S IK+CLAR
Sbjct: 300 CNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLAR 359

Query: 337 CGAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNAT 396
            GA+RANELNQPRDELR TVTQIK DVH QLEQT+RTNKNVHNISKELRKLHREGINNAT
Sbjct: 360 SGALRANELNQPRDELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNAT 419

Query: 397 NSVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQ 456
           NSVTVVAVLFATVAFA+IFTVPGGD+++G AVVV RASFKIFFIFNA+ALFTSLAVVVVQ
Sbjct: 420 NSVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVVGRASFKIFFIFNALALFTSLAVVVVQ 479

Query: 457 ITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIM 516
           ITLVRGETKAEKRVVEVINKLMWLAS+CTSVAF+ASSYIVVGR++EWAA LVTVVGG+IM
Sbjct: 480 ITLVRGETKAEKRVVEVINKLMWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGVIM 539

Query: 517 AGVLGTMTYYVVKSKRVRSIRKREKNARMRSGSNSWYPSDYSNSEIDRIYAL 568
           AGVLGTMTYYVVKSKR RS+RK+ K+AR RSGSNSW+ SD+SNSE+D I+A+
Sbjct: 540 AGVLGTMTYYVVKSKRTRSMRKKVKSAR-RSGSNSWHHSDFSNSEVDPIFAI 590





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 Back     alignment and function description
>sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 Back     alignment and function description
>sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 Back     alignment and function description
>sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 Back     alignment and function description
>sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 Back     alignment and function description
>sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 Back     alignment and function description
>sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query568
224100903588 predicted protein [Populus trichocarpa] 0.992 0.959 0.810 0.0
255571695570 ankyrin repeat-containing protein, putat 0.915 0.912 0.862 0.0
15230470590 ankyrin repeats-containing protein [Arab 0.991 0.954 0.787 0.0
356576855585 PREDICTED: ankyrin repeat-containing pro 0.917 0.890 0.801 0.0
15795155 1100 ankyrin-like protein [Arabidopsis thalia 0.991 0.511 0.755 0.0
449464198590 PREDICTED: ankyrin repeat-containing pro 0.989 0.952 0.781 0.0
225448809589 PREDICTED: ankyrin repeat-containing pro 0.992 0.957 0.768 0.0
128168562596 IGN1 [Lotus japonicus] gi|128168568|dbj| 0.957 0.912 0.753 0.0
356536512592 PREDICTED: ankyrin repeat-containing pro 0.917 0.880 0.791 0.0
225439834638 PREDICTED: ankyrin repeat-containing pro 0.985 0.877 0.716 0.0
>gi|224100903|ref|XP_002312060.1| predicted protein [Populus trichocarpa] gi|222851880|gb|EEE89427.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  941 bits (2433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/592 (81%), Positives = 520/592 (87%), Gaps = 28/592 (4%)

Query: 1   MASSIVEGAERDLEKGIISPQLSQKSIGESSLTPSPSPSPSSATAPALVLSNSGKRIDQA 60
           MAS + EG+ERDLEKG++ PQL+Q  + + S         S++TAPALVLSNSGKRIDQA
Sbjct: 1   MASPMEEGSERDLEKGLVQPQLNQNPLTDPS---PTPSPSSTSTAPALVLSNSGKRIDQA 57

Query: 61  GKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSS 120
           GKKKYVKQVTGRHNDTELHLAAQRG+L  V+ IL  I+SQMVG LSGA+FDTEVAEIR+S
Sbjct: 58  GKKKYVKQVTGRHNDTELHLAAQRGNLADVQHILNDINSQMVGTLSGADFDTEVAEIRAS 117

Query: 121 VVNE-----------------------LLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIV 157
           VVNE                       LLKYS KE LTRKNRSG+DPLHIAAVQGHHAIV
Sbjct: 118 VVNEVNELGETALFTAADKGHLEVVKELLKYSNKECLTRKNRSGYDPLHIAAVQGHHAIV 177

Query: 158 QVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAA 217
           QVLLDHDPSLSQT GPSNATPLVSAATRGHTAVV ELLSKDG LLEISRSNGKNALH AA
Sbjct: 178 QVLLDHDPSLSQTHGPSNATPLVSAATRGHTAVVIELLSKDGSLLEISRSNGKNALHLAA 237

Query: 218 RQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFG 277
           RQGHVD+VKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLL+ADAAIVMLPDKFG
Sbjct: 238 RQGHVDIVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLDADAAIVMLPDKFG 297

Query: 278 NTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARC 337
           NTALHVATRKKR EIV ELL LPDTNVNALTRDHKTALDIAE L  SEE+S+IK+CL R 
Sbjct: 298 NTALHVATRKKRAEIVNELLLLPDTNVNALTRDHKTALDIAEELVLSEESSDIKECLYRY 357

Query: 338 GAVRANELNQPRDELRKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATN 397
           GA+RANELNQPRDELRKTVTQIK DVHTQLEQTRRTNKNVHNISKELRKLHREGINNATN
Sbjct: 358 GALRANELNQPRDELRKTVTQIKNDVHTQLEQTRRTNKNVHNISKELRKLHREGINNATN 417

Query: 398 SVTVVAVLFATVAFASIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQI 457
           SVTVVAVLFATVAFA+IFTVPGGD ++G AVVV   SFKIFFIFNAIALFTSLAVVVVQI
Sbjct: 418 SVTVVAVLFATVAFAAIFTVPGGDLNSGMAVVVSHTSFKIFFIFNAIALFTSLAVVVVQI 477

Query: 458 TLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMA 517
           TLVRGETKAE+RVVEVINKLMWLASVCTSVAF+AS+YIVVGR HEWAA+L+T+VGG+IM 
Sbjct: 478 TLVRGETKAERRVVEVINKLMWLASVCTSVAFMASAYIVVGRTHEWAAVLITIVGGVIMT 537

Query: 518 GVLGTMTYYVVKSKRVRSIRKREKNARMRSGSNS-WYPSDYSNSEIDRIYAL 568
            VLGTMTYYVVKSKR+RS+RKR+K++R RSGSNS  + S++SNSE+DRIYAL
Sbjct: 538 AVLGTMTYYVVKSKRIRSMRKRDKHSR-RSGSNSGHHNSEFSNSEVDRIYAL 588




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255571695|ref|XP_002526791.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223533867|gb|EEF35597.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15230470|ref|NP_187842.1| ankyrin repeats-containing protein [Arabidopsis thaliana] gi|75308849|sp|Q9C7A2.1|Y3236_ARATH RecName: Full=Ankyrin repeat-containing protein At3g12360 gi|12321945|gb|AAG51002.1|AC069474_1 ankyrin-like protein; 93648-91299 [Arabidopsis thaliana] gi|332641667|gb|AEE75188.1| ankyrin repeats-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356576855|ref|XP_003556545.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] Back     alignment and taxonomy information
>gi|15795155|dbj|BAB03143.1| ankyrin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449464198|ref|XP_004149816.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis sativus] gi|449518239|ref|XP_004166150.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225448809|ref|XP_002282204.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Vitis vinifera] gi|297736432|emb|CBI25303.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|128168562|dbj|BAF48666.1| IGN1 [Lotus japonicus] gi|128168568|dbj|BAF48667.1| IGN1 [Lotus japonicus] Back     alignment and taxonomy information
>gi|356536512|ref|XP_003536781.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] Back     alignment and taxonomy information
>gi|225439834|ref|XP_002277535.1| PREDICTED: ankyrin repeat-containing protein At3g12360 [Vitis vinifera] gi|297741528|emb|CBI32660.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query568
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.897 0.864 0.697 1.5e-177
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.892 0.835 0.636 1.9e-161
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.897 0.770 0.403 6.1e-94
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.890 0.931 0.420 3.1e-90
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.887 0.803 0.413 1.4e-89
TAIR|locus:2065434532 AT2G01680 "AT2G01680" [Arabido 0.797 0.851 0.399 6.6e-81
TAIR|locus:2181768524 ANK1 "ankyrin-like1" [Arabidop 0.818 0.887 0.393 2.6e-79
TAIR|locus:2046628601 AT2G24600 "AT2G24600" [Arabido 0.360 0.341 0.274 8.9e-23
TAIR|locus:2157553598 AT5G54710 "AT5G54710" [Arabido 0.779 0.740 0.261 1.3e-21
TAIR|locus:2009046573 AT1G34050 "AT1G34050" [Arabido 0.760 0.753 0.232 3.5e-20
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1724 (611.9 bits), Expect = 1.5e-177, P = 1.5e-177
 Identities = 360/516 (69%), Positives = 406/516 (78%)

Query:    53 SGKRIDQAGKKKYVKQVTGRHNDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDT 112
             + +R D A  ++ +K +   ++  E  L+ +  D   V +I   I ++ V  L      T
Sbjct:    81 AAQRGDLAAVQQILKDI---NSQMEGILSGEEFD-AEVAEIRASIVNE-VNELGETALFT 135

Query:   113 EVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTG 172
                +    VV ELLKYS++E + +KNRSG+DPLHIAA+QGHHAIV+VLLDHD +LSQT G
Sbjct:   136 AADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEVLLDHDATLSQTFG 195

Query:   173 PSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKD 232
             PSNATPLVSAA RGHT VVN+LLSK G LLEISRSN KNALH AARQGHV+V+KALLSKD
Sbjct:   196 PSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAARQGHVEVIKALLSKD 255

Query:   233 PQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEI 292
             PQLARR DKKGQTALHMAVKGQS EVVKLLL+AD AIVM PDK  NTALHVATRKKR EI
Sbjct:   256 PQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEI 315

Query:   293 VTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDEL 352
             V  LLSLPDTN N LTRDHKTALDIAEGLP SEE+S IK+CLAR GA+RANELNQPRDEL
Sbjct:   316 VELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRDEL 375

Query:   353 RKTVTQIKKDVHTQLEQTRRTNKNVHNISKELRKLHREGIXXXXXXXXXXXXXXXXXXXX 412
             R TVTQIK DVH QLEQT+RTNKNVHNISKELRKLHREGI                    
Sbjct:   376 RSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFA 435

Query:   413 SIFTVPGGDDDNGKAVVVRRASFKIFFIFNAIALFTSLAVVVVQITLVRGETKAEKRVVE 472
             +IFTVPGGD+++G AVVV RASFKIFFIFNA+ALFTSLAVVVVQITLVRGETKAEKRVVE
Sbjct:   436 AIFTVPGGDNNDGSAVVVGRASFKIFFIFNALALFTSLAVVVVQITLVRGETKAEKRVVE 495

Query:   473 VINKLMWLASVCTSVAFIASSYIVVGRRHEWAAILVTVVGGLIMAGVLGTMTYYXXXXXX 532
             VINKLMWLAS+CTSVAF+ASSYIVVGR++EWAA LVTVVGG+IMAGVLGTMTYY      
Sbjct:   496 VINKLMWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGVIMAGVLGTMTYYVVKSKR 555

Query:   533 XXXXXXXXXNARMRSGSNSWYPSDYSNSEIDRIYAL 568
                      +AR RSGSNSW+ SD+SNSE+D I+A+
Sbjct:   556 TRSMRKKVKSAR-RSGSNSWHHSDFSNSEVDPIFAI 590


GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IPI
GO:0034613 "cellular protein localization" evidence=IDA
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065434 AT2G01680 "AT2G01680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157553 AT5G54710 "AT5G54710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C7A2Y3236_ARATHNo assigned EC number0.78710.99110.9542yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00080423
hypothetical protein (588 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
pfam13962114 pfam13962, PGG, Domain of unknown function 5e-30
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-28
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-16
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-13
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-12
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-10
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-08
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 2e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-06
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-06
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 1e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
PHA02743166 PHA02743, PHA02743, Viral ankyrin protein; Provisi 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PRK00733 666 PRK00733, hppA, membrane-bound proton-translocatin 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-04
smart0024830 smart00248, ANK, ankyrin repeats 7e-04
pfam00335221 pfam00335, Tetraspannin, Tetraspanin family 8e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam03030 669 pfam03030, H_PPase, Inorganic H+ pyrophosphatase 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.003
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score =  113 bits (285), Expect = 5e-30
 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 8/115 (6%)

Query: 389 REGINNATNSVTVVAVLFATVAFASIFTVPGG------DDDNGKAVVV-RRASFKIFFIF 441
            E +    NS+ VVA L ATV FA+ FT PGG          G  ++  +   FK FF+ 
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 442 NAIALFTSLAVVVVQITLVRGETKAEKRVVEVINKLMWLASVCTSVAFIASSYIV 496
           N IA   SL  V++ + +V   ++   R++  +  L+WL+ +   VAF A SY V
Sbjct: 61  NTIAFVASLVAVILLLYIVPSFSRRLPRLL-ALLTLLWLSLLSLMVAFAAGSYRV 114


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222925 PHA02743, PHA02743, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|234827 PRK00733, hppA, membrane-bound proton-translocating pyrophosphatase; Validated Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|215864 pfam00335, Tetraspannin, Tetraspanin family Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|217327 pfam03030, H_PPase, Inorganic H+ pyrophosphatase Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 568
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 99.98
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02917661 ankyrin-like protein; Provisional 99.97
PHA02730672 ankyrin-like protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02730672 ankyrin-like protein; Provisional 99.97
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.96
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.95
PHA02792631 ankyrin-like protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02792631 ankyrin-like protein; Provisional 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
PF13962113 PGG: Domain of unknown function 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.83
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.83
PHA02741169 hypothetical protein; Provisional 99.82
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.81
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.79
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.75
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.71
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.63
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.43
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.38
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.37
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.3
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.29
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.29
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.26
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.26
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.26
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.72
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.61
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.61
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.61
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.58
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.57
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.53
PF1360630 Ank_3: Ankyrin repeat 98.52
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.49
PF1360630 Ank_3: Ankyrin repeat 98.48
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.43
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.38
KOG0522560 consensus Ankyrin repeat protein [General function 98.37
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.29
KOG0522 560 consensus Ankyrin repeat protein [General function 98.24
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.16
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.12
KOG0520975 consensus Uncharacterized conserved protein, conta 98.06
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.05
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.93
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.82
KOG0511516 consensus Ankyrin repeat protein [General function 97.8
KOG2384223 consensus Major histocompatibility complex protein 97.78
KOG0520975 consensus Uncharacterized conserved protein, conta 97.78
KOG0511 516 consensus Ankyrin repeat protein [General function 97.64
KOG2384223 consensus Major histocompatibility complex protein 97.55
KOG2505591 consensus Ankyrin repeat protein [General function 96.5
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.31
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.95
KOG2505591 consensus Ankyrin repeat protein [General function 93.84
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.45
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.81
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.82
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 89.39
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 84.94
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 82.45
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 81.03
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-36  Score=322.34  Aligned_cols=266  Identities=19%  Similarity=0.243  Sum_probs=230.6

Q ss_pred             hhhcCCCCChHhHHHHHcCCHHHHHHHHh-cCCccccccCCCCchHHHHHhhhhHHHHHHhhhcC---------------
Q 008358           67 KQVTGRHNDTELHLAAQRGDLGAVKQILY-GIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYST---------------  130 (568)
Q Consensus        67 ~~~~~~~g~t~Lh~Aa~~g~~~~v~~LL~-~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~---------------  130 (568)
                      .+..+..|.||||.|++.|+.++|++|++ +.+.+..+..+.+|++.|+..++.++++.|++.+.               
T Consensus        28 ~n~~~~~~~tpL~~A~~~g~~~iv~~Ll~~Ga~~n~~~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~~i  107 (434)
T PHA02874         28 INISVDETTTPLIDAIRSGDAKIVELFIKHGADINHINTKIPHPLLTAIKIGAHDIIKLLIDNGVDTSILPIPCIEKDMI  107 (434)
T ss_pred             CCCcCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCcchhccCCHHHH
Confidence            34566789999999999999999999997 45555566677889999999999999999987643               


Q ss_pred             ------cccccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCccc
Q 008358          131 ------KEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEI  204 (568)
Q Consensus       131 ------~~~~~~~~~~g~TpLh~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~Aa~~g~~~~v~~Ll~~~~~~~~~  204 (568)
                            +.+++.+|..|.||||+|+..|+.++|++|+++|+++ +..|..|.||||+|+..|+.+++++|+++ +.+++.
T Consensus       108 ~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~-n~~d~~g~tpLh~A~~~~~~~iv~~Ll~~-g~~~n~  185 (434)
T PHA02874        108 KTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADV-NIEDDNGCYPIHIAIKHNFFDIIKLLLEK-GAYANV  185 (434)
T ss_pred             HHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCC-CCcCCCCCCHHHHHHHCCcHHHHHHHHHC-CCCCCC
Confidence                  3457788999999999999999999999999999998 67889999999999999999999999998 566788


Q ss_pred             cCcCCChHHHHHHHcCCHHHHHHHHcCCCccccccCCCCCCHHHHHHhCCCHHHHHHHHHcCCccccCCCCCCChHHHHH
Q 008358          205 SRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVA  284 (568)
Q Consensus       205 ~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~d~~G~TpLh~A  284 (568)
                      .+..|.||||+|+..|+.+++++|++.++++ +..+..|.||||.|+..+. +++++|+ .|++ ++.+|.+|+||||+|
T Consensus       186 ~~~~g~tpL~~A~~~g~~~iv~~Ll~~g~~i-~~~~~~g~TpL~~A~~~~~-~~i~~Ll-~~~~-in~~d~~G~TpLh~A  261 (434)
T PHA02874        186 KDNNGESPLHNAAEYGDYACIKLLIDHGNHI-MNKCKNGFTPLHNAIIHNR-SAIELLI-NNAS-INDQDIDGSTPLHHA  261 (434)
T ss_pred             CCCCCCCHHHHHHHcCCHHHHHHHHhCCCCC-cCCCCCCCCHHHHHHHCCh-HHHHHHH-cCCC-CCCcCCCCCCHHHHH
Confidence            8999999999999999999999999999987 6778899999999999865 5666666 5777 788999999999999


Q ss_pred             HHcC-cHHHHHHHhcCCCCCcccccCCCCCHHHHHhhCCCchhhHHHHHHHHHcCcccc
Q 008358          285 TRKK-RTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRA  342 (568)
Q Consensus       285 ~~~g-~~~iv~~Ll~~~g~~~~~~d~~G~T~L~~A~~~~~~~~~~~i~~~L~~~ga~~~  342 (568)
                      +..+ +.+++++|++ .|++++.+|..|+||||+|++....   ..+++.|+..+....
T Consensus       262 ~~~~~~~~iv~~Ll~-~gad~n~~d~~g~TpL~~A~~~~~~---~~~ik~ll~~~~~~~  316 (434)
T PHA02874        262 INPPCDIDIIDILLY-HKADISIKDNKGENPIDTAFKYINK---DPVIKDIIANAVLIK  316 (434)
T ss_pred             HhcCCcHHHHHHHHH-CcCCCCCCCCCCCCHHHHHHHhCCc---cHHHHHHHHhcCchh
Confidence            9876 7899999999 8999999999999999999986532   245566777766543



>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-15
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-12
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 9e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-12
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-11
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-08
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 5e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 7e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-09
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-09
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 9e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-09
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-09
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-09
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 9e-09
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
1uoh_A226 Human Gankyrin Length = 226 1e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-08
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-07
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-07
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-07
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-06
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-07
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-07
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-07
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 5e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 8e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 5e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 8e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-04
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 6e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 8e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 9e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 4e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 2e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 3e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-04
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 5e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 6e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 7e-04
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 8e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 8e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 8e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 81.6 bits (200), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 56/122 (45%), Positives = 69/122 (56%), Gaps = 3/122 (2%) Query: 177 TPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLA 236 TPL AA GH VV +LL + G + NG+ LH AAR GH++VVK LL + Sbjct: 4 TPLHLAARNGHLEVV-KLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVN 62 Query: 237 RRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTEL 296 + DK G+T LH+A + EVVKLLLEA A V DK G T LH+A R E+V L Sbjct: 63 AK-DKNGRTPLHLAARNGHLEVVKLLLEA-GADVNAKDKNGRTPLHLAARNGHLEVVKLL 120 Query: 297 LS 298 L Sbjct: 121 LE 122
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query568
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-27
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-42
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-27
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-32
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-41
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-39
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-40
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-39
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-37
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-33
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-40
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-35
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-39
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-38
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-26
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-38
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-38
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-37
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-37
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-34
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-37
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-30
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-36
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-21
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-36
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-36
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-35
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-25
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-35
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-05
2rfa_A232 Transient receptor potential cation channel subfa 6e-35
2rfa_A232 Transient receptor potential cation channel subfa 5e-29
2rfa_A232 Transient receptor potential cation channel subfa 1e-18
2rfa_A232 Transient receptor potential cation channel subfa 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 7e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-34
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-33
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-30
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-32
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-22
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-28
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-31
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-31
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-15
2pnn_A273 Transient receptor potential cation channel subfa 1e-30
2pnn_A273 Transient receptor potential cation channel subfa 6e-24
2pnn_A273 Transient receptor potential cation channel subfa 2e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-30
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-21
2etb_A256 Transient receptor potential cation channel subfam 1e-30
2etb_A256 Transient receptor potential cation channel subfam 1e-22
2etb_A256 Transient receptor potential cation channel subfam 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-30
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-29
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-28
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-29
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-26
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-26
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-26
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-22
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
 Score =  163 bits (416), Expect = 4e-47
 Identities = 52/249 (20%), Positives = 86/249 (34%), Gaps = 39/249 (15%)

Query: 74  NDTELHLAAQRGDLGAVKQILYGIDSQMVGNLS-GAEFDTEVAEIRSSVVNELLKYSTKE 132
           ++  LH A    +   V+++L           S  +             + +        
Sbjct: 2   SNYPLHQACMENEFFKVQELL----------HSKPSL------------LLQ-------- 31

Query: 133 GLTRKNRSGFDPLHIAAVQGHHAIVQVLLDH--DPSLSQTTGPSNATPLVSAATRGHTAV 190
               K++ G  PLH +     H I   LL    + +L      S  TP   A + G+  V
Sbjct: 32  ----KDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEV 87

Query: 191 VNELLSKDGGL-LEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHM 249
           V  L  +     L    + G   LH A  +   +V + L+     + R  DK  Q  LH 
Sbjct: 88  VKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASV-RIKDKFNQIPLHR 146

Query: 250 AVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTR 309
           A    S ++++LL     + V   DK G T L  A  +   +    L+       + +  
Sbjct: 147 AASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206

Query: 310 DHKTALDIA 318
               A D+A
Sbjct: 207 KGAKAEDVA 215


>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query568
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3.1e-40  Score=349.00  Aligned_cols=291  Identities=26%  Similarity=0.344  Sum_probs=156.4

Q ss_pred             hhhcCCCCChHhHHHHHcCCHHHHHHHHh-cCCccccccCCCCchHHHHHhhhhHHHHHHhhhcCcccccccCCCCCcHH
Q 008358           67 KQVTGRHNDTELHLAAQRGDLGAVKQILY-GIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPL  145 (568)
Q Consensus        67 ~~~~~~~g~t~Lh~Aa~~g~~~~v~~LL~-~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~~g~TpL  145 (568)
                      .+..+..|.||||+|+..|+.+++++|++ +.+.+..+..+.++++.|+..++.++++.|++.+  .+.+..+..|.|||
T Consensus        73 ~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~--~~~~~~~~~g~t~L  150 (437)
T 1n11_A           73 VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKE--ASQACMTKKGFTPL  150 (437)
T ss_dssp             SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTT--CCSCCCCTTSCCHH
T ss_pred             CCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCC--CCCcCCCCCCCCHH
Confidence            34455666666666666666666666665 3444444445555666666666666666665432  23344445555555


Q ss_pred             HHHHHcCCHHHHHHHHhcCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHcC---------------------------
Q 008358          146 HIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKD---------------------------  198 (568)
Q Consensus       146 h~Aa~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~Aa~~g~~~~v~~Ll~~~---------------------------  198 (568)
                      |+|+..|+.+++++|+++|+++ +..+..|.||||+|+..|+.+++++|++++                           
T Consensus       151 ~~A~~~g~~~~v~~Ll~~g~~~-~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~  229 (437)
T 1n11_A          151 HVAAKYGKVRVAELLLERDAHP-NAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVAR  229 (437)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCT-TCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHH
T ss_pred             HHHHHcCCHHHHHHHHhCCCCC-CCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHH
Confidence            5555555555555555555554 344445555555555555555555555442                           


Q ss_pred             -----CCCccccCcCCChHHHHHHHcCCHHHHHHHHcCCCccccccCCCCCCHHHHHHhCCCHHHHHHHHHcCCccccCC
Q 008358          199 -----GGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLP  273 (568)
Q Consensus       199 -----~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~  273 (568)
                           +.+++..+..|.||||+|+..|+.+++++|++++++. +..|..|+||||+|+..|+.+++++|+++|++ ++.+
T Consensus       230 ~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~~~~  307 (437)
T 1n11_A          230 SLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-VDAT  307 (437)
T ss_dssp             HHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-TTCC
T ss_pred             HHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCC-CCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc-CCCC
Confidence                 2233444445555555555555555555555555444 44455555555555555555555555555555 4555


Q ss_pred             CCCCChHHHHHHHcCcHHHHHHHhcCCCCCcccccCCCCCHHHHHhhCCCchhhHHHHHHHHHcCcccccccCCChhHHH
Q 008358          274 DKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKTALDIAEGLPSSEEASEIKDCLARCGAVRANELNQPRDELR  353 (568)
Q Consensus       274 d~~G~TpLh~A~~~g~~~iv~~Ll~~~g~~~~~~d~~G~T~L~~A~~~~~~~~~~~i~~~L~~~ga~~~~~~~~~~~~l~  353 (568)
                      |..|+||||+|+..|+.+++++|++ .|+++|.+|..|+||||+|+..++    .+++++|+++|+..+.....+.+++.
T Consensus       308 ~~~g~t~L~~A~~~g~~~~v~~Ll~-~gad~n~~~~~g~t~L~~A~~~g~----~~iv~~Ll~~ga~~~~~~~~g~t~l~  382 (437)
T 1n11_A          308 TRMGYTPLHVASHYGNIKLVKFLLQ-HQADVNAKTKLGYSPLHQAAQQGH----TDIVTLLLKNGASPNEVSSDGTTPLA  382 (437)
T ss_dssp             CSSCCCHHHHHHHSSCSHHHHHHHH-TTCCTTCCCTTSCCHHHHHHHTTC----HHHHHHHHHTTCCSCCCCSSSCCHHH
T ss_pred             CCCCCCHHHHHHHcCcHHHHHHHHh-cCCCCCCCCCCCCCHHHHHHHCCh----HHHHHHHHHCcCCCCCCCCCCCCHHH
Confidence            5555555555555555555555555 455555555555555555555443    24555555555555555555555555


Q ss_pred             HHHHhhhhhhhhhH
Q 008358          354 KTVTQIKKDVHTQL  367 (568)
Q Consensus       354 ~~~~~~~~~~~~~l  367 (568)
                      .+......++.+.+
T Consensus       383 ~A~~~g~~~~~~~l  396 (437)
T 1n11_A          383 IAKRLGYISVTDVL  396 (437)
T ss_dssp             HHHHTTCHHHHHHH
T ss_pred             HHHHcCcHHHHHHH
Confidence            55444444444333



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 568
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-25
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-21
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-25
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-24
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-18
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-15
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-06
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-04
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Pseudo ankyrin repeat-like
family: Pseudo ankyrin repeat
domain: Hypothetical protein LPG2416
species: Legionella pneumophila [TaxId: 446]
 Score =  105 bits (263), Expect = 2e-25
 Identities = 44/243 (18%), Positives = 71/243 (29%), Gaps = 30/243 (12%)

Query: 74  NDTELHLAAQRGDLGAVKQILY---GIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKY-S 129
           N     LAA+ G L  + ++          M+   +   F          V+N L +   
Sbjct: 126 NYQAFRLAAENGHLHVLNRLCELAPTEIMAMIQAENYHAFRLAAENGHLHVLNRLCELAP 185

Query: 130 TKEGLTRKNRSGFDPLHIAAVQGHHAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTA 189
           T+     +  + +     A  +GHH ++  LLD             A   +     G   
Sbjct: 186 TEATAMIQAENYYAFRWAAVGRGHHNVINFLLDC--------PVMLAYAEIHEFEYGEKY 237

Query: 190 VVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDPQLARRTDKKGQTALHM 249
           V   +      L E       +A   +   G  D+V        +            L  
Sbjct: 238 VNPFIARHVNRLKE-----MHDAFKLSNPDGVFDLVT-------KSECLQGFYMLRNLIR 285

Query: 250 AVKGQSCEVVKLLLEADAAIVMLPD----KFGNTALHVATRKKRTEIVTELLSLPDTNVN 305
                  + ++ LL       + P        N  L +A R         LLS+P   V 
Sbjct: 286 RNDEVLLDDIRFLLSIPGIKALAPTATIPGDANELLRLALRLGNQGACALLLSIPS--VL 343

Query: 306 ALT 308
           ALT
Sbjct: 344 ALT 346


>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query568
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.5e-35  Score=277.78  Aligned_cols=220  Identities=27%  Similarity=0.371  Sum_probs=198.7

Q ss_pred             CChHhHHHHHcCCHHHHHHHHhcCCccccccCCCCchHHHHHhhhhHHHHHHhhhcCcccccccCCCCCcHHHHHHHcCC
Q 008358           74 NDTELHLAAQRGDLGAVKQILYGIDSQMVGNLSGAEFDTEVAEIRSSVVNELLKYSTKEGLTRKNRSGFDPLHIAAVQGH  153 (568)
Q Consensus        74 g~t~Lh~Aa~~g~~~~v~~LL~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~~~~~~~~~~~~~g~TpLh~Aa~~g~  153 (568)
                      +++.|+.+|+.|+++.|+.+|.                                 ..+..++.+|..|+||||+|+..|+
T Consensus         3 ~~~~~~~~a~~G~~~~v~~~l~---------------------------------~~~~~~~~~D~~G~TpLh~Aa~~g~   49 (223)
T d1uoha_           3 SNLMVCNLAYSGKLEELKESIL---------------------------------ADKSLATRTDQDSRTALHWACSAGH   49 (223)
T ss_dssp             SSSHHHHHHHTTCHHHHHHHHH---------------------------------HCGGGGGCCCTTSCCHHHHHHHHTC
T ss_pred             CHHHHHHHHHhCCHHHHHHHHH---------------------------------hCCCcCcCcCCCCCCHHHHHHHhhh
Confidence            3578999999999999988885                                 2344578889999999999999999


Q ss_pred             HHHHHHHHhcCCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCccccCcCCChHHHHHHHcCCHHHHHHHHcCCC
Q 008358          154 HAIVQVLLDHDPSLSQTTGPSNATPLVSAATRGHTAVVNELLSKDGGLLEISRSNGKNALHFAARQGHVDVVKALLSKDP  233 (568)
Q Consensus       154 ~~iv~~Ll~~~~~~~~~~~~~g~tpL~~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~  233 (568)
                      .+++++|++.+... ...+..+.++++.++..|+.+++++|+++ +.+++..|.+|.||||+|+..|+.+++++|+++|.
T Consensus        50 ~e~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~-~~d~~~~d~~g~tpL~~A~~~~~~e~~~~Ll~~g~  127 (223)
T d1uoha_          50 TEIVEFLLQLGVPV-NDKDDAGWSPLHIAASAGRDEIVKALLGK-GAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGA  127 (223)
T ss_dssp             HHHHHHHHHHTCCS-CCCCTTCCCHHHHHHHHTCHHHHHHHHHT-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTC
T ss_pred             hccccccccccccc-ccccccccccccccccccccchhHHHhcc-CceeEeeCCCCCchhhHHHHcCCHHHHHHHHHCCC
Confidence            99999999999887 56677889999999999999999999998 46788999999999999999999999999999999


Q ss_pred             ccccccCCCCCCHHHHHHhCCCHHHHHHHHHcCCccccCCCCCCChHHHHHHHcCcHHHHHHHhcCCCCCcccccCCCCC
Q 008358          234 QLARRTDKKGQTALHMAVKGQSCEVVKLLLEADAAIVMLPDKFGNTALHVATRKKRTEIVTELLSLPDTNVNALTRDHKT  313 (568)
Q Consensus       234 ~~~~~~d~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~d~~G~TpLh~A~~~g~~~iv~~Ll~~~g~~~~~~d~~G~T  313 (568)
                      ++ +..|..|.||||+|+..++.+++++|++.+.+ ++.+|.+|+||||+|+..|+.+++++|++ .|+|++.+|.+|+|
T Consensus       128 d~-~~~~~~~~t~L~~a~~~~~~~~~~~L~~~~~~-i~~~d~~g~TpL~~Aa~~g~~~~v~~LL~-~Gad~~~~d~~g~t  204 (223)
T d1uoha_         128 NP-DAKDHYEATAMHRAAAKGNLKMIHILLYYKAS-TNIQDTEGNTPLHLACDEERVEEAKLLVS-QGASIYIENKEEKT  204 (223)
T ss_dssp             CT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-SCCCCTTCCCHHHHHHHTTCHHHHHHHHH-TTCCSCCCCTTSCC
T ss_pred             CC-CCcCCCCCccchhhhhcCCcchhhhhccccce-eeeccCCCCceeccccccCcHHHHHHHHH-CCCCCCCCCCCCCC
Confidence            87 78899999999999999999999999999999 89999999999999999999999999999 79999999999999


Q ss_pred             HHHHHhhCCCchhhHHHHHHHHH
Q 008358          314 ALDIAEGLPSSEEASEIKDCLAR  336 (568)
Q Consensus       314 ~L~~A~~~~~~~~~~~i~~~L~~  336 (568)
                      |||+|.. +    ..++++.|++
T Consensus       205 pl~~A~~-~----~~~i~~~Ll~  222 (223)
T d1uoha_         205 PLQVAKG-G----LGLILKRMVE  222 (223)
T ss_dssp             HHHHCCT-T----HHHHHHHHHC
T ss_pred             HHHHHHC-C----CHHHHhcccC
Confidence            9999842 2    3456666653



>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure