Citrus Sinensis ID: 008406

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------
MISIEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQFKA
cccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccHHHHcccccccccccEEEcccccccEEcccccHHHHHHHHHHcccccccccccccEEEEcccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHccccccccccc
cccHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccEcHHccccccccccEEEcccccccccccHcccccccccccccccccccccccccccccccEEccccEEEccccccccccccccccccccccccccccccEEEEccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHccccccccccEEEEEccccccccccccccccccccccccccEcccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHccccHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccHHHccEEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccHHHHcHEEEHHcccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHccc
MISIEKWRFSWTLVATVASVLTLVSVVHLFlfplvpsfdyftaRQQIQNSCVPIKESAERVTnrvwensppqlnldhrfpadlhnavvyrnapwkaEIGRWLSGCDSVAKEVDLVEMiggkscksdcsgqgvcnhelgqcrcfhgfrgkgcserihfqcnfpktpelpygrwvvsicpthcdttramcfcgegtkypnrpvaeacgfqvnlpsqpgapkstdwakadldnifttngskpgwcnvdpeeAYALKVQFKEecdckydgllgqfcevpvsstcvnqcsghghcrggfcqcdsgwygvdcsipsvmssmsewpqwlrpahidipinanitGNLVNLNAvvkkkrpllyvydlppefnslllegrhykLECVNRIYNEKNETLWTDMLYGSQMAFYESIlasphrtlngeeadfffvpvldsciitraddaphlsaqehrglrssLTLEFYKKAYEHIIEhypywnrtsgrdhiwffswdegacyapkeIWNSMMLVHwgntnskhnhsttaywadnwdrisssrrgnhscfdpekdlvlpawkapdaFVLRSKLWARQFKA
misiekwrfSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTtngskpgwcnVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRAddaphlsaqehrglrssLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQFKA
MISIEKWRFSWtlvatvasvltlvsvvHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQFKA
***IEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNL***********WAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHL****HRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISS***GNHSCFDPEKDLVLPAWKAPDAFVLRSKLWAR****
******WRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRS*********
MISIEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQFKA
*ISIEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTN*****SPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQF**
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISIEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAERVTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGGKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSGWYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDAFVLRSKLWARQFKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query567 2.2.26 [Sep-21-2011]
Q6NMM8 469 Probable glucuronoxylan g no no 0.246 0.298 0.307 2e-13
Q940Q8 415 Probable beta-1,4-xylosyl no no 0.227 0.310 0.301 2e-11
Q9FZJ1 412 Probable beta-1,4-xylosyl no no 0.227 0.313 0.308 1e-10
Q8S1X7 417 Probable glucuronosyltran no no 0.227 0.309 0.295 3e-10
Q10SX7 427 Probable glucuronosyltran no no 0.204 0.271 0.316 4e-10
Q7XLG3 420 Probable glucuronosyltran no no 0.227 0.307 0.276 1e-09
Q6H4N0 434 Probable glucuronosyltran no no 0.227 0.297 0.276 2e-09
Q8S1X8 415 Probable glucuronosyltran no no 0.227 0.310 0.283 2e-09
Q9ZUV3 448 Probable glucuronoxylan g no no 0.225 0.285 0.303 3e-09
Q33AH8 417 Probable glucuronosyltran no no 0.195 0.266 0.275 1e-08
>sp|Q6NMM8|F8H_ARATH Probable glucuronoxylan glucuronosyltransferase F8H OS=Arabidopsis thaliana GN=F8H PE=2 SV=1 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 82/166 (49%), Gaps = 26/166 (15%)

Query: 329 IPINANITGNLVNLNAVVKKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETL 388
           +P  A I  + +   ++       +YVYDLP  +N   +        C +          
Sbjct: 87  LPSRALIESSAIKTTSIGLFTGMKIYVYDLPASYNDDWVTASD---RCASH--------- 134

Query: 389 WTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLR 448
               L+ +++A + ++L+S  RTL+ +EAD+FFVPV  SC  + ++  P LS    R L 
Sbjct: 135 ----LFAAEVAIHRALLSSDVRTLDPDEADYFFVPVYVSCNFSTSNGFPSLS--HARSLL 188

Query: 449 SSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKE 494
           SS        A + + +HYP+WNR+ G DH++  S D GAC+   E
Sbjct: 189 SS--------AVDFLSDHYPFWNRSQGSDHVFVASHDFGACFHAME 226
Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls. Probably involved in the synthesis of the glycosyl sequence at the glucuronoxylan reducing end.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q940Q8|IX10L_ARATH Probable beta-1,4-xylosyltransferase IRX10L OS=Arabidopsis thaliana GN=IRX10L PE=2 SV=1 Back     alignment and function description
>sp|Q9FZJ1|IRX10_ARATH Probable beta-1,4-xylosyltransferase IRX10 OS=Arabidopsis thaliana GN=IRX10 PE=2 SV=1 Back     alignment and function description
>sp|Q8S1X7|GT15_ORYSJ Probable glucuronosyltransferase Os01g0926700 OS=Oryza sativa subsp. japonica GN=Os01g0926700 PE=2 SV=1 Back     alignment and function description
>sp|Q10SX7|GT31_ORYSJ Probable glucuronosyltransferase Os03g0107900 OS=Oryza sativa subsp. japonica GN=Os03g0107900 PE=2 SV=1 Back     alignment and function description
>sp|Q7XLG3|GT42_ORYSJ Probable glucuronosyltransferase Os04g0398600 OS=Oryza sativa subsp. japonica GN=Os04g0398600 PE=2 SV=2 Back     alignment and function description
>sp|Q6H4N0|GT21_ORYSJ Probable glucuronosyltransferase Os02g0520750 OS=Oryza sativa subsp. japonica GN=Os02g0520750 PE=2 SV=1 Back     alignment and function description
>sp|Q8S1X8|GT14_ORYSJ Probable glucuronosyltransferase Os01g0926600 OS=Oryza sativa subsp. japonica GN=Os01g0926600 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUV3|IRX7_ARATH Probable glucuronoxylan glucuronosyltransferase IRX7 OS=Arabidopsis thaliana GN=IRX7 PE=2 SV=1 Back     alignment and function description
>sp|Q33AH8|GT101_ORYSJ Probable glucuronosyltransferase GUT1 OS=Oryza sativa subsp. japonica GN=GUT1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
224090294 793 predicted protein [Populus trichocarpa] 0.994 0.711 0.757 0.0
297739695 822 unnamed protein product [Vitis vinifera] 0.984 0.678 0.758 0.0
225441752 794 PREDICTED: uncharacterized protein LOC10 0.984 0.702 0.758 0.0
42566010 793 exostosin family protein [Arabidopsis th 0.987 0.706 0.726 0.0
297820564 792 exostosin family protein [Arabidopsis ly 0.985 0.705 0.726 0.0
42572713 791 exostosin family protein [Arabidopsis th 0.984 0.705 0.724 0.0
449501885 859 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.987 0.651 0.710 0.0
449437619 791 PREDICTED: uncharacterized protein LOC10 0.987 0.707 0.710 0.0
147846684 1363 hypothetical protein VITISV_016911 [Viti 0.980 0.407 0.697 0.0
356500491 795 PREDICTED: uncharacterized protein LOC10 0.980 0.699 0.731 0.0
>gi|224090294|ref|XP_002308967.1| predicted protein [Populus trichocarpa] gi|222854943|gb|EEE92490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/566 (75%), Positives = 493/566 (87%), Gaps = 2/566 (0%)

Query: 1   MISIEKWRFSWTLVATVASVLTLVSVVHLFLFPLVPSFDYFTARQQIQNSCVPIKESAER 60
           MI+I KW+ SW+L+AT+AS++ LVSVVHLFLFP+VPSFD F+   Q+Q+SC P  ES + 
Sbjct: 1   MITISKWKCSWSLMATIASIVALVSVVHLFLFPVVPSFDPFSV-WQVQDSCGPNNESVDG 59

Query: 61  VTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGG 120
            T     N  P L+L+H+FPADLH AV YRNAPWKAEIGRWLSGCD+V KEV +VE I G
Sbjct: 60  RTGHDPGNLQPVLDLEHKFPADLHRAVFYRNAPWKAEIGRWLSGCDAVTKEVSVVETISG 119

Query: 121 KSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTH 180
           +SCK+DCSGQGVCN+ELGQCRCFHGF G+GCSER+H +CN+PK+PELPYGRWVVSIC  H
Sbjct: 120 RSCKNDCSGQGVCNYELGQCRCFHGFSGEGCSERLHLECNYPKSPELPYGRWVVSICSAH 179

Query: 181 CDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPG 240
           CD TRAMCFCGEGTKYPNRP AE CGFQ++LPS+ GAP+  DWAK DLD I+TTN SK G
Sbjct: 180 CDPTRAMCFCGEGTKYPNRPAAETCGFQLSLPSEIGAPRQVDWAKPDLD-IYTTNKSKLG 238

Query: 241 WCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSG 300
           WCNVDP E YA KV+FKEECDCKYD L G+FCEVPV  +C+NQCSGHGHCRGGFCQC +G
Sbjct: 239 WCNVDPAEGYANKVKFKEECDCKYDCLSGRFCEVPVQCSCINQCSGHGHCRGGFCQCANG 298

Query: 301 WYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPP 360
           WYG DCSIPSV SS+ EWP+WLRPA +D+P NA++TG LV+LNAVVKKKRPL+Y+YDLPP
Sbjct: 299 WYGTDCSIPSVTSSVREWPRWLRPAQLDVPDNAHLTGKLVDLNAVVKKKRPLIYIYDLPP 358

Query: 361 EFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFF 420
           +FNSLLLEGRH+K ECVNR+YN+ N T+WTD LYG+QMA YESILASP+RTLNGEEADFF
Sbjct: 359 KFNSLLLEGRHFKFECVNRLYNDNNATIWTDQLYGAQMALYESILASPYRTLNGEEADFF 418

Query: 421 FVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIW 480
           FVPVLDSCIITRADDAPHLS ++H GLRSSLTLEFY+KAY+HI+EHYP+WNR+SGRDH+W
Sbjct: 419 FVPVLDSCIITRADDAPHLSMEQHLGLRSSLTLEFYRKAYDHIVEHYPFWNRSSGRDHLW 478

Query: 481 FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPE 540
            FSWDEGACYAPKEIWNSMM+VHWGNTNSKHNHSTTAYWADNWD+ISS RRG H CFDP+
Sbjct: 479 SFSWDEGACYAPKEIWNSMMVVHWGNTNSKHNHSTTAYWADNWDKISSDRRGKHPCFDPD 538

Query: 541 KDLVLPAWKAPDAFVLRSKLWARQFK 566
           KDLVLPAWK PD   L +KLWAR  +
Sbjct: 539 KDLVLPAWKRPDVNALSTKLWARPLE 564

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739695|emb|CBI29877.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441752|ref|XP_002277596.1| PREDICTED: uncharacterized protein LOC100267584 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42566010|ref|NP_191322.3| exostosin family protein [Arabidopsis thaliana] gi|44917463|gb|AAS49056.1| At3g57630 [Arabidopsis thaliana] gi|46931284|gb|AAT06446.1| At3g57630 [Arabidopsis thaliana] gi|332646159|gb|AEE79680.1| exostosin family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297820564|ref|XP_002878165.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata] gi|297324003|gb|EFH54424.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42572713|ref|NP_974452.1| exostosin family protein [Arabidopsis thaliana] gi|110740929|dbj|BAE98560.1| hypothetical protein [Arabidopsis thaliana] gi|332646160|gb|AEE79681.1| exostosin family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449501885|ref|XP_004161484.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226446 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437619|ref|XP_004136589.1| PREDICTED: uncharacterized protein LOC101206674 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147846684|emb|CAN80640.1| hypothetical protein VITISV_016911 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500491|ref|XP_003519065.1| PREDICTED: uncharacterized protein LOC100783624 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query567
TAIR|locus:2076691 793 AT3G57630 "AT3G57630" [Arabido 0.987 0.706 0.708 5.5e-244
TAIR|locus:2172676 469 F8H "AT5G22940" [Arabidopsis t 0.246 0.298 0.307 1.7e-11
TAIR|locus:2159198 415 GUT1 "AT5G61840" [Arabidopsis 0.202 0.277 0.323 1.3e-09
UNIPROTKB|P24821 2201 TNC "Tenascin" [Homo sapiens ( 0.338 0.087 0.288 6e-08
TAIR|locus:2016004 412 GUT2 "AT1G27440" [Arabidopsis 0.185 0.254 0.333 7.4e-08
UNIPROTKB|P10039 1808 TNC "Tenascin" [Gallus gallus 0.305 0.095 0.269 2.8e-07
ZFIN|ZDB-GENE-030804-1 1350 tnr "tenascin R (restrictin, j 0.089 0.037 0.403 5.7e-07
MGI|MGI:101922 2110 Tnc "tenascin C" [Mus musculus 0.338 0.090 0.278 1.1e-06
ZFIN|ZDB-GENE-980526-104 1811 tnc "tenascin C" [Danio rerio 0.308 0.096 0.279 2.6e-06
TAIR|locus:2046163 448 FRA8 "FRAGILE FIBER 8" [Arabid 0.167 0.212 0.336 3.9e-06
TAIR|locus:2076691 AT3G57630 "AT3G57630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2351 (832.7 bits), Expect = 5.5e-244, P = 5.5e-244
 Identities = 399/563 (70%), Positives = 457/563 (81%)

Query:     1 MISIEKWRFSWXXXXXXXXXXXXXXXXHLFLFPLVPSFDYFTARQQIQNSCVPIKESAER 60
             M S +KW+FSW                HLFL P+VPSFD  T RQ  QN C P  ES  +
Sbjct:     1 MFSHQKWKFSWSQIATVASVIVLVSLVHLFLGPVVPSFDSITVRQA-QNLCGPSNESISQ 59

Query:    61 VTNRVWENSPPQLNLDHRFPADLHNAVVYRNAPWKAEIGRWLSGCDSVAKEVDLVEMIGG 120
             VT      S   +  D RFPAD H AVVYRNA WKAEIG+WLS CD+VAKEVD++E IGG
Sbjct:    60 VTKNS-SQSLVVVAFDRRFPADSHGAVVYRNASWKAEIGQWLSSCDAVAKEVDIIEPIGG 118

Query:   121 KSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTH 180
             + C SDCSGQGVCNHE G CRCFHGF G+ CS+++   CN+ KTPE+PYG+WVVSIC  H
Sbjct:   119 RKCMSDCSGQGVCNHEFGLCRCFHGFTGEDCSQKLRLDCNYEKTPEMPYGKWVVSICSRH 178

Query:   181 CDTTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPG 240
             CDTTRAMCFCGEGTKYPNRPV E+CGFQ+N P+ P  PK TDW+K DLD I TTN SK G
Sbjct:   179 CDTTRAMCFCGEGTKYPNRPVPESCGFQINSPTNPDEPKMTDWSKPDLD-ILTTNSSKQG 237

Query:   241 WCNVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVSSTCVNQCSGHGHCRGGFCQCDSG 300
             WCNVDPE+AYA+KV+ KEECDCKYD L G+FCE+PV  TCVNQCSGHG CRGGFCQCD G
Sbjct:   238 WCNVDPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQCTCVNQCSGHGKCRGGFCQCDKG 297

Query:   301 WYGVDCSIPSVMSSMSEWPQWLRPAHIDIPINANITGNLVNLNAVVKKKRPLLYVYDLPP 360
             W+G DCSIPS +S++ EWPQWLRPAH+++P   N+ GNL+NL+AVVKKKRPL+Y+YDLPP
Sbjct:   298 WFGTDCSIPSTLSTVGEWPQWLRPAHLEVPSEKNVPGNLINLSAVVKKKRPLIYIYDLPP 357

Query:   361 EFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFF 420
             +FNSLL+EGRH+K ECVNRIY+E+N T+WTD LYGSQMAFYE+ILA+ HRT+NGEEADFF
Sbjct:   358 DFNSLLIEGRHFKFECVNRIYDERNATVWTDYLYGSQMAFYENILATAHRTMNGEEADFF 417

Query:   421 FVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIW 480
             FVPVLDSCII RADDAPH++ Q H GLRSSLTLEFYK+AYEHI+E YPYWNR++GRDHIW
Sbjct:   418 FVPVLDSCIINRADDAPHINMQNHTGLRSSLTLEFYKRAYEHIVEKYPYWNRSAGRDHIW 477

Query:   481 FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPE 540
             FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAY+ DNWD IS  RRG+H CFDP 
Sbjct:   478 FFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYFGDNWDDISDERRGDHPCFDPR 537

Query:   541 KDLVLPAWKAPDAFVLRSKLWAR 563
             KDLV+PAWK PD + +R   W R
Sbjct:   538 KDLVIPAWKVPDPYSMRKNYWER 560
GO:0003824 "catalytic activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
TAIR|locus:2172676 F8H "AT5G22940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159198 GUT1 "AT5G61840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P24821 TNC "Tenascin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2016004 GUT2 "AT1G27440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P10039 TNC "Tenascin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030804-1 tnr "tenascin R (restrictin, janusin)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:101922 Tnc "tenascin C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-104 tnc "tenascin C" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2046163 FRA8 "FRAGILE FIBER 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_VI000457
hypothetical protein (793 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
pfam03016 292 pfam03016, Exostosin, Exostosin family 1e-24
pfam0797431 pfam07974, EGF_2, EGF-like domain 1e-04
>gnl|CDD|217320 pfam03016, Exostosin, Exostosin family Back     alignment and domain information 
 Score =  103 bits (259), Expect = 1e-24
 Identities = 47/206 (22%), Positives = 64/206 (31%), Gaps = 51/206 (24%)

Query: 347 KKKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILA 406
             K   +YVYDLP  FN L        L   +               Y ++   ++SIL 
Sbjct: 1   SCKGLKVYVYDLPRRFNLL-----EDVLPETSWYLTH---------QYAAESILHKSILN 46

Query: 407 SPHRTLNGEEADFFFVPVLDSCIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEH 466
           S  RTL+ +EAD FFVP   S  +                       +         +E 
Sbjct: 47  SRCRTLDPDEADLFFVPFYTSLSVGTNAVER----------------DLLPSELVEWLES 90

Query: 467 YPYWNRTSGRDHIWFFSWDEGACYAPKEIWNSMMLVHWGNTNSKHNHSTTAYWADNWDRI 526
            PYWNR+ GRDHI   S   G     +                                 
Sbjct: 91  LPYWNRSGGRDHIIVNSHPFGGSAFDRLP-ALNNNTILAVLAGG---------------- 133

Query: 527 SSSRRGNHSCFDPEKDLVLPAWKAPD 552
                 +   F P  D+ LPA+  P+
Sbjct: 134 ----GFSEDQFRPGFDVPLPAYFHPN 155

The EXT family is a family of tumour suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear. Length = 292
>gnl|CDD|219677 pfam07974, EGF_2, EGF-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 567
PF03016 302 Exostosin: Exostosin family; InterPro: IPR004263 H 99.91
KOG1021 464 consensus Acetylglucosaminyltransferase EXT1/exost 99.88
KOG1225525 consensus Teneurin-1 and related extracellular mat 99.67
KOG1225525 consensus Teneurin-1 and related extracellular mat 99.48
KOG1226783 consensus Integrin beta subunit (N-terminal portio 99.45
KOG1226783 consensus Integrin beta subunit (N-terminal portio 99.31
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 98.84
KOG0994 1758 consensus Extracellular matrix glycoprotein Lamini 98.76
KOG12194289 consensus Uncharacterized conserved protein, conta 98.76
KOG12194289 consensus Uncharacterized conserved protein, conta 98.37
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.36
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 98.27
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.98
KOG1836 1705 consensus Extracellular matrix glycoprotein Lamini 97.78
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.75
KOG1217487 consensus Fibrillins and related proteins containi 97.69
KOG1836 1705 consensus Extracellular matrix glycoprotein Lamini 97.66
KOG1217487 consensus Fibrillins and related proteins containi 97.58
KOG4260350 consensus Uncharacterized conserved protein [Funct 97.39
KOG3512592 consensus Netrin, axonal chemotropic factor [Signa 97.29
KOG1214 1289 consensus Nidogen and related basement membrane pr 97.12
KOG1214 1289 consensus Nidogen and related basement membrane pr 97.1
smart0005163 DSL delta serrate ligand. 97.05
smart0005163 DSL delta serrate ligand. 96.98
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.72
KOG1218316 consensus Proteins containing Ca2+-binding EGF-lik 96.16
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.15
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.03
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 95.85
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 95.74
PF0000832 EGF: EGF-like domain This is a sub-family of the P 95.64
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.6
KOG4260350 consensus Uncharacterized conserved protein [Funct 94.79
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.75
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 94.54
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 94.23
KOG3512592 consensus Netrin, axonal chemotropic factor [Signa 93.81
KOG1218316 consensus Proteins containing Ca2+-binding EGF-lik 93.56
cd0005336 EGF Epidermal growth factor domain, found in epide 93.45
smart0018135 EGF Epidermal growth factor-like domain. 93.16
PHA02887126 EGF-like protein; Provisional 91.94
smart0017939 EGF_CA Calcium-binding EGF-like domain. 91.34
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 90.95
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 90.65
cd0005336 EGF Epidermal growth factor domain, found in epide 90.36
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 89.89
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 89.1
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 89.09
PHA02887126 EGF-like protein; Provisional 89.04
KOG3607716 consensus Meltrins, fertilins and related Zn-depen 87.56
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 86.18
smart0018135 EGF Epidermal growth factor-like domain. 85.75
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 84.93
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 84.57
KOG3607716 consensus Meltrins, fertilins and related Zn-depen 84.47
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 83.7
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 83.43
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 83.35
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 82.61
>PF03016 Exostosin: Exostosin family; InterPro: IPR004263 Hereditary multiple exostoses (EXT) is an autosomal dominant disorder that is characterised by the appearance of multiple outgrowths of the long bones (exostoses) at their epiphyses [] Back     alignment and domain information 
Probab=99.91  E-value=4e-24  Score=219.90  Aligned_cols=161  Identities=35%  Similarity=0.652  Sum_probs=115.3

Q ss_pred             ccCceeEeecCCcccchhhhcCCCCcccCCccccCCCCccccccccccchHHHHHHhhCCCcccCCccCCcEEEEeccce
Q 008406          348 KKRPLLYVYDLPPEFNSLLLEGRHYKLECVNRIYNEKNETLWTDMLYGSQMAFYESILASPHRTLNGEEADFFFVPVLDS  427 (567)
Q Consensus       348 ~~~~~IYvYdLP~~fn~~ll~~~~~~~~c~~~~~~~~~~~~~~~~~y~~E~~f~~~ll~s~~rT~dp~eAd~FfVP~~~s  427 (567)
                      +++++|||||||++||.+|+...           .........+++|++|.+||++|++|++||.||+|||+||||+|.+
T Consensus         2 ~~~lkVYVY~lp~~~~~~~~~~~-----------~~~~~~~~~~~~~~~e~~l~~~l~~s~~~T~dp~eAdlF~vP~~~~   70 (302)
T PF03016_consen    2 HRGLKVYVYPLPPKFNKDLLDPR-----------EDEQCSWYETSQYALEVILHEALLNSPFRTDDPEEADLFFVPFYSS   70 (302)
T ss_pred             CCCCEEEEEeCCccccccceecc-----------ccccCCCcccccchHHHHHHHHHHhCCcEeCCHHHCeEEEEEcccc
Confidence            45789999999999999998322           1223334467899999999999999999999999999999999998


Q ss_pred             eeeeecCCCCcccccccccccchhHHHHHHHHHHHHHhcCchhhcCCCCCeEEEeccCCCCCCCCccc---cCceEEeec
Q 008406          428 CIITRADDAPHLSAQEHRGLRSSLTLEFYKKAYEHIIEHYPYWNRTSGRDHIWFFSWDEGACYAPKEI---WNSMMLVHW  504 (567)
Q Consensus       428 ~~~~~~~~~p~~~~~~~~~~r~~~~~~~~~~~~~~l~~~~p~W~r~~G~DH~~v~~~D~g~~~~~~~~---~~~~~l~~~  504 (567)
                      +........          .......+.+.+++..+++++|||||++|+||||+.+||+|.+......   ..++.++  
T Consensus        71 ~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~p~w~r~~G~dH~~~~~~~~g~~~~~~~~~~~~~~~~~~--  138 (302)
T PF03016_consen   71 CYFHHWWGS----------PNSGADRDSLSDALRHLLASYPYWNRSGGRDHFFVNSHDRGGCSFDRNPRLMNNSIRAV--  138 (302)
T ss_pred             cccccccCC----------ccchhhHHHHHHHHHHHHhcCchhhccCCCCeEEEeccccccccccccHhhhccchhhe--
Confidence            875111111          1111234445667778888999999999999999999999887644321   1111110  


Q ss_pred             CCCCcCCCcccccccCCCccccccCCCCCCCccCCCCcccccCCcCCcc
Q 008406          505 GNTNSKHNHSTTAYWADNWDRISSSRRGNHSCFDPEKDLVLPAWKAPDA  553 (567)
Q Consensus       505 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~f~P~kD~~ip~~~~~~~  553 (567)
                              ...     ...         ...+|+|++||+||.+.....
T Consensus       139 --------~~~-----~~~---------~~~~~~~~~Di~~P~~~~~~~  165 (302)
T PF03016_consen  139 --------VAF-----SSF---------SSSCFRPGFDIVIPPFVPPSS  165 (302)
T ss_pred             --------ecc-----CCC---------CcCcccCCCCeeccccccccc
Confidence                    000     000         145999999999999987765

Mutations in two homologous genes, EXT1 and EXT2, are responsible for the EXT syndrome. The human and mouse EXT genes have at least two homologs in the invertebrate Caenorhabditis elegans, indicating that they do not function exclusively as regulators of bone growth. EXT1 and EXT2 have both been shown to encode glycosyltransferases involved in the chain elongation step of heparan sulphate biosynthesis [].; GO: 0016020 membrane
>KOG1021 consensus Acetylglucosaminyltransferase EXT1/exostosin 1 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1225 consensus Teneurin-1 and related extracellular matrix proteins, contain EGF-like repeats [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1226 consensus Integrin beta subunit (N-terminal portion of extracellular region) [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures] Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1836 consensus Extracellular matrix glycoprotein Laminin subunits alpha and gamma [Extracellular structures] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3512 consensus Netrin, axonal chemotropic factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG3512 consensus Netrin, axonal chemotropic factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1218 consensus Proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query567
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-13
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 8e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-04
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 1e-10
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 1e-09
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 3e-09
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 6e-06
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 8e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 3e-06
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 5e-06
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 1e-05
2uvo_A171 Agglutinin isolectin 1; carbohydrate-binding prote 3e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 6e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-04
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
 Score = 70.9 bits (173), Expect = 5e-13
 Identities = 40/191 (20%), Positives = 58/191 (30%), Gaps = 36/191 (18%)

Query: 123 CKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICPTHCD 182
            +S C G+G      G CRC  G+ GK C  +   + +               IC    D
Sbjct: 433 DRSLCHGKGFLEC--GICRCDTGYIGKNCECQTQGRSSQELEGSCRKD-NNSIICSGLGD 489

Query: 183 TTRAMCFCGEGTKYPNRPVAEACGFQVNLPSQPGAPKSTDWAKADLDNIFTTNGSKPGWC 242
                C CG+   + +    +            G     D    +  N     G   G C
Sbjct: 490 -----CVCGQCLCHTSDVPGKLIY---------GQYCECDTINCERYNGQVCGGPGRGLC 535

Query: 243 NVDPEEAYALKVQFKEECDCKYDGLLGQFCEVPVS-----STCVNQCSGHGHCRGGFCQC 297
                           +C C   G  G  C+   +     +    +CSG G CR   C+C
Sbjct: 536 FCG-------------KCRCH-PGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCEC 581

Query: 298 DSGWYGVDCSI 308
            SG+    C  
Sbjct: 582 HSGYQLPLCQE 592
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Length = 472 Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 Back     alignment and structure
>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.71
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.61
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.56
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.56
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.55
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.52
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.46
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.33
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.33
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 99.31
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.26
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.21
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.19
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.06
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.93
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.89
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.82
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.78
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.78
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.73
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.65
2bou_A143 EGF-like module containing mucin-like hormone rece 98.58
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.42
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.38
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.36
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.25
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.24
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.15
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.1
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.07
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.01
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.98
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.96
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.81
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.8
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.78
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.76
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.71
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.65
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 97.63
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.61
2vh0_B134 Activated factor XA light chain; serine protease, 97.56
2bou_A143 EGF-like module containing mucin-like hormone rece 97.53
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.45
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.44
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.44
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.41
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.4
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.38
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.31
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.27
2vh0_B134 Activated factor XA light chain; serine protease, 97.27
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.26
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.23
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.21
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.2
2y38_A403 Laminin subunit alpha-5; structural protein, cell 97.11
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.09
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.99
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.99
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.95
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.91
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.88
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.87
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.71
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 96.7
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.58
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.51
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.5
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.49
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.44
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.43
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.28
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.23
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.16
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.16
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.0
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.93
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 95.9
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 95.89
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.89
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 95.88
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.65
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 95.51
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.5
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.5
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.98
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.86
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.81
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 94.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.58
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.57
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 94.28
2y38_A403 Laminin subunit alpha-5; structural protein, cell 94.25
3v65_B386 Low-density lipoprotein receptor-related protein; 94.14
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.85
2k2s_B61 Micronemal protein 6; microneme protein complex, c 93.83
3p5b_L400 Low density lipoprotein receptor variant; B-propel 93.8
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.77
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.58
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.1
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 93.1
3v65_B386 Low-density lipoprotein receptor-related protein; 92.1
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 91.63
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 91.47
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 91.41
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 91.19
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 91.05
2i9a_A145 Urokinase-type plasminogen activator; growth facto 90.94
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.89
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 90.87
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.52
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 90.24
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.14
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 89.35
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 89.09
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 88.07
2i9a_A145 Urokinase-type plasminogen activator; growth facto 86.97
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 86.15
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 85.54
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 85.44
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 82.78
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 81.66
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 80.22
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
Probab=99.71  E-value=9.1e-18  Score=173.00  Aligned_cols=156  Identities=27%  Similarity=0.600  Sum_probs=63.0

Q ss_pred             CCCCCCCCCCCCEEecCCCeEEeCCCCcCCCCCccccccCCCCCCCCCCCCCcccccCC--CcccCCCCeEecCCCcccC
Q 008406          120 GKSCKSDCSGQGVCNHELGQCRCFHGFRGKGCSERIHFQCNFPKTPELPYGRWVVSICP--THCDTTRAMCFCGEGTKYP  197 (567)
Q Consensus       120 ~~~C~~~Cs~~G~C~~~~G~C~C~~G~~G~~Ce~~~~~~C~~~~~~~~~~g~~~~~~C~--g~C~~~~g~C~C~~G~~G~  197 (567)
                      ..+|++.|+++|+|+. .++|.|++||+|+.|+..   .|..              .|.  |.|.. .+.|.|.+||.|.
T Consensus       148 ~~~C~~~C~~~G~C~~-~~~C~C~~G~~G~~C~~~---~C~~--------------~C~~~G~C~~-~~~C~C~~G~~G~  208 (324)
T 2ygq_A          148 QAECPGGCRNGGFCNE-RRICECPDGFHGPHCEKA---LCTP--------------RCMNGGLCVT-PGFCICPPGFYGV  208 (324)
T ss_dssp             CCCCSSCCCSSCEECT-TSCEECCTTEESSSSCEE---SSSS--------------CCCTTCEECS-SCCEECCTTCBTT
T ss_pred             CCCCCCCCCCCCEECC-CCeEECCCCCcCCCCCCC---CCCC--------------CCCCCCEEcC-CCEEeCCCCccCC
Confidence            3678889999999985 689999999999999974   3432              243  45543 5799999999999


Q ss_pred             CCCCCCCCCCccC-CCCC---CCCCCCCCCCCCCCCCc-cCCCCCCCcccCCCcccccccccccccccccCCCCCCCccc
Q 008406          198 NRPVAEACGFQVN-LPSQ---PGAPKSTDWAKADLDNI-FTTNGSKPGWCNVDPEEAYALKVQFKEECDCKYDGLLGQFC  272 (567)
Q Consensus       198 ~C~~~~~C~~~~~-~~~c---~~~~c~~gw~g~~c~~~-~~~~C~~~G~C~~~~~~~~~~g~c~~g~C~C~~~G~~G~~C  272 (567)
                      .|+.. .|..... ...|   ..+.|.+||.|..|+.. ...+|.++|.|..            .++|.|. +||+|..|
T Consensus       209 ~C~~~-~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~g~C~~------------~~~C~C~-~G~~G~~C  274 (324)
T 2ygq_A          209 NCDKA-NCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIG------------KSKCKCS-KGYQGDLC  274 (324)
T ss_dssp             TTCBC-CCSSCCCSSCCBSCSSCBCCCTTCCTTTTC--------------------------------------------
T ss_pred             CcccC-cCCCCCCCCCeeCCCCeeeCCCCccCCCCCcCcCCCcCCCCCEECC------------CCEEECC-CCCcCCCC
Confidence            88642 2421111 0111   12457899999999732 2356778888852            4799999 99999999


Q ss_pred             ccccCCccCCCCCCCeeee-CCeeecCCCcccCCCCCCcc
Q 008406          273 EVPVSSTCVNQCSGHGHCR-GGFCQCDSGWYGVDCSIPSV  311 (567)
Q Consensus       273 e~~~~~~C~~~Cs~~G~C~-~G~C~C~~G~~G~~C~~~~~  311 (567)
                      +.+   .|.+.|+++|+|+ .+.|.|.+||+|.+|+....
T Consensus       275 ~~~---~C~~~C~~~g~C~~~~~C~C~~G~~G~~C~~~~~  311 (324)
T 2ygq_A          275 SKP---VCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYE  311 (324)
T ss_dssp             ----------------------------------------
T ss_pred             cCC---CCCCCCCCCCEECCCCEeECCCCCcCCCCCCCCc
Confidence            965   6888999999998 78999999999999998753
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 567
d1l3ya_41 g.3.11.6 (A:) Integrin beta EGF-like domains {Huma 1e-05
d1jv2b431 g.3.11.6 (B:532-562) Integrin beta EGF-like domain 7e-05
d1jv2b543 g.3.11.6 (B:563-605) Integrin beta EGF-like domain 0.001
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Integrin beta EGF-like domains
domain: Integrin beta EGF-like domains
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.1 bits (94), Expect = 1e-05
 Identities = 9/24 (37%), Positives = 11/24 (45%)

Query: 284 CSGHGHCRGGFCQCDSGWYGVDCS 307
             G G C  G C+C  G+ G  C 
Sbjct: 17  GPGRGLCFCGKCRCHPGFEGSACQ 40
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query567
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.93
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.92
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.88
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.82
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.8
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.73
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 97.67
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.66
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.56
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.51
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 97.47
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 97.42
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.38
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.33
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.32
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.32
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.31
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.3
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.23
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.17
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.17
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.14
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 97.07
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 97.05
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.99
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.97
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.94
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.94
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.9
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 96.85
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.77
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.72
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.63
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.35
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 96.15
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.06
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.65
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.59
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.98
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 93.76
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.68
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 93.57
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 93.44
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.33
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 93.06
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 92.72
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 92.44
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 92.41
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.37
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 89.1
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.68
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.61
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 87.32
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 87.11
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 84.94
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 82.63
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 81.29
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 80.11
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.93  E-value=4.1e-06  Score=56.08  Aligned_cols=34  Identities=35%  Similarity=1.023  Sum_probs=29.4

Q ss_pred             CCCC-CCCCCCCCEEecCCC--eEEeCCCCcCCCCCc
Q 008406          120 GKSC-KSDCSGQGVCNHELG--QCRCFHGFRGKGCSE  153 (567)
Q Consensus       120 ~~~C-~~~Cs~~G~C~~~~G--~C~C~~G~~G~~Ce~  153 (567)
                      .++| +++|.++|+|....+  +|.|++||+|+.||.
T Consensus         3 ~d~C~~~PC~ngg~C~~~~~~y~C~C~~g~~G~~Cei   39 (39)
T d1edmb_           3 GDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL   39 (39)
T ss_dssp             CCTTTTCCCCTTCEEEEETTEEEEECCTTCCSTTSCC
T ss_pred             cccCCCCCCCCCcEEEcCCCCEEEECCCCCCCCCCCC
Confidence            4789 889999999986554  899999999999984
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure