Citrus Sinensis ID: 008426

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGKLRSEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGK
ccHHHHHHHHHccEEEEEEEccccHHHHHHccccccccccccEEEEEcccccccccHHHHHHHccccccEEEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHcccccccccccccEEcEEEccccccEEEEEEEEEEEccEEEccccccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEcccccccccccEEEEEccccccccccEEEcccccEEEEEEEcccccccccEEEEEEHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHcccccEEEEEEcccEEEccEEEccccEEEEccEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccEEEEEccccccEEEEcEEEEEEccccEEEEEEcccccccccccccccccccccccEEEEEEccccccccc
ccHHHHHHHHHHHHEEEEEccccHHHHHHHHHHHHHHcccccEEEHcHEEcccccccHHHHHHHcccccEEEEEEEEEccccccHHccccccccccccccccEEEEEEEEccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHccccccccccEEccEEccccccccccccEEEEEEcccccccHHccccccccccccHHHHHHHHHHHHHccccccccccccEEEccccccccEEEEEccccccccHHHHHHHHcccEEEccccccccccEEEEEEcccccccccccHEcccccEEEEEEcccccccccEEEEEEEHHHHHHHHHHHccccccccHHcccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEEccccEEEEEEEccccEEEEccEEEEccccccEccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccEEEEEEEccccccEEEccEEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEcccccccccc
MGLPEMAEFSRNFGVLVrvqgpdpkglkmrrhafhqynsgkttlsasgmllplsffdtkvaernwgvNGLIVTVASVvepfllpqyrdkdtsegqpelitgsqidflvegklrsekehedvdkgspEWVTAQLMMLVDIPVSSLALQSLMeassglpehewevgwslapynnssqplmGVVKTSIESNKIslmeshrpfameessnlslmskstSRVAILGVSsylkdlpnialtplnkrgdlllavgspfgvlspmhffnsvsmgsvancypprsttRSLLMADirclpgmeggpvfgehaHFVGILirplrqksgaeiqlvipWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHIlngaccykyehvdsrcrsplpIQKALASVCLITiddgvwasgvllndqgliltnahllepwrfgkttvsgwrngvsfqpedsassghtgvdqyqksqtlppkmpkivdssvdehrayklssfsrghrkirvrldhldpwiwcdakivyvckgpldvsllqlgyipdqlcpidadfgqpslgSAAYVIghglfgprcgk
MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYRDkdtsegqpelitgsqidflVEGKLrsekehedvdkgSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQyqksqtlppkmpKIVDSSVDEHRAyklssfsrghrkirvrldhldpwiWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGK
MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGKLRSEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAmeessnlslmskstsRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGK
***********NFGVLVRV************HAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYR************TGSQIDFLV******************EWVTAQLMMLVDIPVSSLALQSLMEA**GLPEHEWEVGWSLAPYN********************************************RVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGV**********************************************FSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFG*****
****E*A*FSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEP*******************TGSQIDFLV*******************WVTAQLMMLVDIPVSSL****************************SSQPLMGVVKTSIESNKISLME***************MSKSTSRVAILGVSSYLKDLPNIA**PLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKE*********I*****************************************KALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVS***********************************************************IRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGP****
MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYR********PELITGSQIDFLVEGKLR***********SPEWVTAQLMMLVDIPVSSLALQSLM********HEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQP******************TLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGK
*GLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGKLRSE*******KGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISL*******AMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEI**NKG*LN*VGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGW**************************TLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGKLRSEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKGNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLLNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQPEDSASSGHTGVDQYQKSQTLPPKMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query566 2.2.26 [Sep-21-2011]
Q8VZD4 709 Glyoxysomal processing pr yes no 0.918 0.733 0.508 1e-149
Q2T9J0566 Peroxisomal leader peptid yes no 0.157 0.157 0.373 3e-08
Q9DBA6568 Peroxisomal leader peptid yes no 0.127 0.126 0.412 4e-07
>sp|Q8VZD4|DEG15_ARATH Glyoxysomal processing protease, glyoxysomal OS=Arabidopsis thaliana GN=DEG15 PE=1 SV=2 Back     alignment and function desciption
 Score =  529 bits (1362), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 294/578 (50%), Positives = 382/578 (66%), Gaps = 58/578 (10%)

Query: 1   MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLS-FFDTK 59
           M + ++  FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG  TLSASG+LLP   F   +
Sbjct: 1   MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60

Query: 60  VAERNWGVNG----LIVTVASVVEPFLLPQYRDKDTSEGQP-ELITGSQIDFLVEGKLRS 114
           VA +     G    L++TVASVVEPFL   +R   +    P +LI G+ I+ +VEG+L+S
Sbjct: 61  VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSSISQDPVKLIPGAMIEIMVEGQLKS 120

Query: 115 EKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSS 174
           EKE       +P WV AQL+ LVD+PVSS ALQSL+EASSG  +  W++GWSL    N S
Sbjct: 121 EKE-------APFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGS 173

Query: 175 QPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIAL 234
           QP       +IE     LM+      ++E  N + M+KS +R+AILGV   L   P++  
Sbjct: 174 QP-----SINIEHYSKPLMQ------LDEPHNANFMAKSATRMAILGVPLSLLGQPSMNF 222

Query: 235 TPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEG 294
              + +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP  S  +SL++AD+RCLPGMEG
Sbjct: 223 ASSSSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEG 282

Query: 295 GPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINKG 353
            PVF ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP            
Sbjct: 283 APVFAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP------------ 330

Query: 354 NLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVLL 413
             +  G +  + S +L+          D+   + + I+KA+ SVCLIT++DGVWASG++L
Sbjct: 331 --SVEGKASQWGSEVLSVKS-------DASIPAQVAIEKAMESVCLITVNDGVWASGIIL 381

Query: 414 NDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQP-----EDSASSGHTGVDQYQKSQTLP 468
           N+ GLILTNAHLLEPWR+GK    G   G  F+P     E+ +S+G    +  QKSQTLP
Sbjct: 382 NEHGLILTNAHLLEPWRYGK----GGVYGEGFKPYVLGAEEFSSTGSKFWE--QKSQTLP 435

Query: 469 PKMPKIVDSSVDEH-RAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSLL 527
            K P+   SSV E+ R YK +    GHR IRVRL HLD W WC A +VY+CK  LD++LL
Sbjct: 436 RKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTWCPANVVYICKEQLDIALL 495

Query: 528 QLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCG 565
           QL Y+P +L PI A+F  P LG+ A+V+GHGLFGPRCG
Sbjct: 496 QLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCG 533
Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor. The dimeric form carries out the specific cleavages needed to remove PTS2-containing presequences, whereas the monomeric form degrades the removed presequences and misfolded proteins (Probable). Not required for degradation of glyoxylate cycle enzymes during seedling development.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q2T9J0|TYSD1_HUMAN Peroxisomal leader peptide-processing protease OS=Homo sapiens GN=TYSND1 PE=1 SV=3 Back     alignment and function description
>sp|Q9DBA6|TYSD1_MOUSE Peroxisomal leader peptide-processing protease OS=Mus musculus GN=Tysnd1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
224077082 752 predicted protein [Populus trichocarpa] 0.982 0.739 0.647 0.0
224125536 716 predicted protein [Populus trichocarpa] 0.945 0.747 0.637 0.0
359483482 753 PREDICTED: LOW QUALITY PROTEIN: glyoxyso 0.975 0.733 0.602 0.0
255536763 729 trypsin domain-containing protein, putat 0.943 0.732 0.595 1e-179
297740411 682 unnamed protein product [Vitis vinifera] 0.860 0.714 0.557 1e-171
356546634 749 PREDICTED: glyoxysomal processing protea 0.968 0.731 0.567 1e-167
111183165 753 putative protease/hydrolase [Solanum lyc 0.985 0.741 0.513 1e-159
357446685 819 Peroxisomal leader peptide-processing pr 0.978 0.676 0.503 1e-155
297851284 713 hypothetical protein ARALYDRAFT_473044 [ 0.925 0.734 0.506 1e-149
18086453 709 At1g28320/F3H9_2 [Arabidopsis thaliana] 0.918 0.733 0.510 1e-147
>gi|224077082|ref|XP_002305124.1| predicted protein [Populus trichocarpa] gi|222848088|gb|EEE85635.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/579 (64%), Positives = 450/579 (77%), Gaps = 23/579 (3%)

Query: 1   MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFFDTKV 60
           MGLPE+ +F+RNF V+VR+QGPDPKGLKMR+HAFHQYNSGKTTLSASG+LLP + +D  +
Sbjct: 1   MGLPEIVDFARNFAVMVRIQGPDPKGLKMRKHAFHQYNSGKTTLSASGLLLPDTLYDADL 60

Query: 61  AER-----NWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK--LR 113
           A R     + G+ GL+VTVASV+EPFL  ++R+   S+ +PELI G+QID + EGK  LR
Sbjct: 61  ANRILEGKSQGL-GLVVTVASVIEPFLSSKHRES-ISQSRPELIPGAQIDVMAEGKSDLR 118

Query: 114 SEKEHEDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNS 173
           +  +   +DKG+  W+ AQ++ LVD+P+SSLALQSL+EASSG   H WEVGWSLA   N 
Sbjct: 119 NGADG-GLDKGTSHWLRAQVIRLVDVPLSSLALQSLVEASSGSMNHGWEVGWSLASPENG 177

Query: 174 SQPLMGVVKTSIESNKISLMESHRPFAMEESSNLSLMSKSTSRVAILGVSSYLKDLPNIA 233
           SQ  M VV+T  E    S+ ES R  A EESSN S+M KST+RVAILGV  +LKDLPN  
Sbjct: 178 SQSFMDVVQTQTEHGNASIAESQR-RAREESSNPSIMGKSTTRVAILGVFLHLKDLPNFE 236

Query: 234 LTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGME 293
           ++  ++RGD LLAVGSPFGVLSP+HFFNS+S+GS+ANCYPPRS+  SLLMADIRCLPGME
Sbjct: 237 ISASSRRGDFLLAVGSPFGVLSPVHFFNSLSVGSIANCYPPRSSDISLLMADIRCLPGME 296

Query: 294 GGPVFGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEPQNAEKEIHINK 352
           G PVF E+++F+GILIRPLRQK SGAEIQLVIPWEAIA ACSDLLLKEPQNAEK IHINK
Sbjct: 297 GSPVFCENSNFIGILIRPLRQKSSGAEIQLVIPWEAIALACSDLLLKEPQNAEKGIHINK 356

Query: 353 GNLNAVGNSLLFNSHILNGACCYKYEHVDSRCRSPLPIQKALASVCLITIDDGVWASGVL 412
            NLNAVGN+   +S   +G    K+EH  S C SP P++KA+AS+CLITID+ VWASGVL
Sbjct: 357 ENLNAVGNAYSSSS---DGPFPLKHEHHISYCSSPPPVEKAMASICLITIDELVWASGVL 413

Query: 413 LNDQGLILTNAHLLEPWRFGKTTVSGWRNGVSFQ-----PEDSASSGHTGVDQYQKSQTL 467
           LNDQGLILTNAHLLEPWRFGKTTV+G  +G   Q     PE+     ++ VD ++K+Q L
Sbjct: 414 LNDQGLILTNAHLLEPWRFGKTTVNGGEDGTKLQDPFIPPEEFPR--YSEVDGHEKTQRL 471

Query: 468 PPKMPKIVDSSV-DEHRAYKLSSFSRGHRKIRVRLDHLDPWIWCDAKIVYVCKGPLDVSL 526
           PPK   I++SSV DE + YKLS   +G   IRVRLDH DPWIWCDAK+V+VCKGPLDV+L
Sbjct: 472 PPKTLNIMNSSVADESKGYKLSLSYKGPMNIRVRLDHADPWIWCDAKVVHVCKGPLDVAL 531

Query: 527 LQLGYIPDQLCPIDADFGQPSLGSAAYVIGHGLFGPRCG 565
           LQL ++PDQL P   DF   SLGS AYVIGHGLFGPRCG
Sbjct: 532 LQLEHVPDQLFPTKVDFECSSLGSKAYVIGHGLFGPRCG 570

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125536|ref|XP_002329829.1| predicted protein [Populus trichocarpa] gi|222870891|gb|EEF08022.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483482|ref|XP_002273997.2| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal processing protease, glyoxysomal-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255536763|ref|XP_002509448.1| trypsin domain-containing protein, putative [Ricinus communis] gi|223549347|gb|EEF50835.1| trypsin domain-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297740411|emb|CBI30593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546634|ref|XP_003541729.1| PREDICTED: glyoxysomal processing protease, glyoxysomal-like [Glycine max] Back     alignment and taxonomy information
>gi|111183165|gb|ABH07902.1| putative protease/hydrolase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|357446685|ref|XP_003593618.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] gi|355482666|gb|AES63869.1| Peroxisomal leader peptide-processing protease [Medicago truncatula] Back     alignment and taxonomy information
>gi|297851284|ref|XP_002893523.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] gi|297339365|gb|EFH69782.1| hypothetical protein ARALYDRAFT_473044 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18086453|gb|AAL57680.1| At1g28320/F3H9_2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
TAIR|locus:2032142 709 DEG15 "degradation of periplas 0.575 0.459 0.475 1.7e-124
DICTYBASE|DDB_G0279049 849 DDB_G0279049 "trypsin-like ser 0.137 0.091 0.417 1.3e-14
ZFIN|ZDB-GENE-030131-8525565 tysnd1 "trypsin domain contain 0.203 0.203 0.363 4.9e-12
UNIPROTKB|Q2T9J0566 TYSND1 "Peroxisomal leader pep 0.190 0.190 0.35 1.8e-08
UNIPROTKB|F1SUE6568 TYSND1 "Uncharacterized protei 0.174 0.174 0.366 4.7e-08
RGD|1307354567 Tysnd1 "trypsin domain contain 0.204 0.204 0.328 1.5e-07
UNIPROTKB|F1NN98332 TYSND1 "Uncharacterized protei 0.098 0.168 0.491 4.7e-07
UNIPROTKB|F1P5W4350 TYSND1 "Uncharacterized protei 0.098 0.16 0.491 5.9e-07
MGI|MGI:1919017568 Tysnd1 "trypsin domain contain 0.157 0.156 0.373 9e-07
UNIPROTKB|E1BF31565 E1BF31 "Uncharacterized protei 0.157 0.157 0.383 4.4e-06
TAIR|locus:2032142 DEG15 "degradation of periplasmic proteins 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 725 (260.3 bits), Expect = 1.7e-124, Sum P(2) = 1.7e-124
 Identities = 164/345 (47%), Positives = 213/345 (61%)

Query:     1 MGLPEMAEFSRNFGVLVRVQGPDPKGLKMRRHAFHQYNSGKTTLSASGMLLPLSFF-DTK 59
             M + ++  FSRNF VLV+V+GPDPKGLKMR+HAFHQY+SG  TLSASG+LLP   F   +
Sbjct:     1 MDVSKVVSFSRNFAVLVKVEGPDPKGLKMRKHAFHQYHSGNATLSASGILLPRDIFLSGE 60

Query:    60 VAERNWGVNGLIVTVASVVEPFLLPQYR-DKDTSEGQPELITGSQIDFLVEGKLRSEKEH 118
             VA +     G  + +   V   + P       TS      I+   +  +    +    E 
Sbjct:    61 VAAKVLFEAGQDMALVLTVASVVEPFLTLGHRTSSS----ISQDPVKLIPGAMIEIMVEG 116

Query:   119 E-DVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPEHEWEVGWSLAPYNNSSQPL 177
             +   +K +P WV AQL+ LVD+PVSS ALQSL+EASSG  +  W++GWSL    N SQP 
Sbjct:   117 QLKSEKEAPFWVPAQLLSLVDVPVSSAALQSLIEASSGSKDSGWDIGWSLVSAANGSQPS 176

Query:   178 MGVVKTSIESNKISLMESHRPFAXXXXXXXXXXXXXXXRVAILGVSSYLKDLPNIALTPL 237
             +     +IE     LM+   P                 R+AILGV   L   P++     
Sbjct:   177 I-----NIEHYSKPLMQLDEPH------NANFMAKSATRMAILGVPLSLLGQPSMNFASS 225

Query:   238 NKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMADIRCLPGMEGGPV 297
             + +GD L+A+GSPFG+LSP++FFNSVS GS+AN YP  S  +SL++AD+RCLPGMEG PV
Sbjct:   226 SSKGDTLVALGSPFGILSPVNFFNSVSTGSIANSYPSGSLKKSLMIADVRCLPGMEGAPV 285

Query:   298 FGEHAHFVGILIRPLRQK-SGAEIQLVIPWEAIATACSDLLLKEP 341
             F ++ H +GILIRPLRQK SG EIQLV+PW AI TACS LLL+EP
Sbjct:   286 FAKNGHLIGILIRPLRQKNSGVEIQLVVPWGAITTACSHLLLEEP 330
GO:0003824 "catalytic activity" evidence=IEA
GO:0004175 "endopeptidase activity" evidence=IMP
GO:0005777 "peroxisome" evidence=IDA
DICTYBASE|DDB_G0279049 DDB_G0279049 "trypsin-like serine protease family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8525 tysnd1 "trypsin domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9J0 TYSND1 "Peroxisomal leader peptide-processing protease" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUE6 TYSND1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307354 Tysnd1 "trypsin domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NN98 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5W4 TYSND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1919017 Tysnd1 "trypsin domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF31 E1BF31 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VZD4DEG15_ARATH3, ., 4, ., 2, 1, ., -0.50860.91870.7334yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00040486
hypothetical protein (752 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 0.002
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information 
 Score = 38.7 bits (90), Expect = 0.002
 Identities = 24/91 (26%), Positives = 32/91 (35%), Gaps = 2/91 (2%)

Query: 217 VAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRS 276
           +A+L V   L     +  +     G  ++ VG P G+            G V+       
Sbjct: 50  LALLKVDGPLLPAAPLLASSAAPLGGSVVVVGGPGGIGLGASGGGGGVGGLVSGSLGGVD 109

Query: 277 TTRSLLMADIRCLPGMEGGPVFGEHAHFVGI 307
               L  AD    PG  GGPVF      VGI
Sbjct: 110 GRYILTDADTS--PGSSGGPVFDADGEVVGI 138

This family includes trypsin like peptidase domains. Length = 138

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 566
PRK10139455 serine endoprotease; Provisional 99.86
PRK10942473 serine endoprotease; Provisional 99.81
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 99.81
PRK10898353 serine endoprotease; Provisional 99.8
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.78
COG0265347 DegQ Trypsin-like serine proteases, typically peri 99.75
PRK10898 353 serine endoprotease; Provisional 99.55
TIGR02038 351 protease_degS periplasmic serine pepetdase DegS. T 99.54
PRK10139 455 serine endoprotease; Provisional 99.53
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.43
PRK10942 473 serine endoprotease; Provisional 99.38
KOG1320473 consensus Serine protease [Posttranslational modif 99.25
COG0265 347 DegQ Trypsin-like serine proteases, typically peri 99.07
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 98.7
KOG1320 473 consensus Serine protease [Posttranslational modif 97.86
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 97.78
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 97.47
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 97.36
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 97.16
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 96.57
KOG1421 955 consensus Predicted signaling-associated protein ( 96.43
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 94.09
PF10459 698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 93.83
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 92.35
PF00863 235 Peptidase_C4: Peptidase family C4 This family belo 91.99
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 91.49
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 89.74
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 88.83
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 86.94
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 86.16
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 80.7
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=99.86  E-value=2.4e-21  Score=209.01  Aligned_cols=126  Identities=22%  Similarity=0.338  Sum_probs=105.8

Q ss_pred             ccccccC-CCcceEEEEEEccCCCCCC--cccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCCC---CC
Q 008426          205 SNLSLMS-KSTSRVAILGVSSYLKDLP--NIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRS---TT  278 (566)
Q Consensus       205 ~~~~~l~-~~~tdlAvLki~~~~~~~~--~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~~---~~  278 (566)
                      -+++++| +..+||||||++.. .+++  .+++|..+++||+|+|||+|||+      ..++|.||||++.+...   ..
T Consensus       127 ~~a~vvg~D~~~DlAvlkv~~~-~~l~~~~lg~s~~~~~G~~V~aiG~P~g~------~~tvt~GivS~~~r~~~~~~~~  199 (455)
T PRK10139        127 FDAKLIGSDDQSDIALLQIQNP-SKLTQIAIADSDKLRVGDFAVAVGNPFGL------GQTATSGIISALGRSGLNLEGL  199 (455)
T ss_pred             EEEEEEEEcCCCCEEEEEecCC-CCCceeEecCccccCCCCEEEEEecCCCC------CCceEEEEEccccccccCCCCc
Confidence            3478888 55599999999742 2344  56688899999999999999994      78999999999876421   23


Q ss_pred             CceEEEecCCCCCCCCcceeccCCcEEEEEeeeccCCC-CcceEEEeeHHHHHHHHHhhh
Q 008426          279 RSLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLL  337 (566)
Q Consensus       279 ~~liqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~-g~gl~faIP~~~i~~~~~~ll  337 (566)
                      ..+|||||+++||||||||||.+|+||||+++.++..+ ..|++||||++.++.++.+++
T Consensus       200 ~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~  259 (455)
T PRK10139        200 ENFIQTDASINRGNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLI  259 (455)
T ss_pred             ceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHh
Confidence            56899999999999999999999999999999887653 359999999999999888765

>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 65.6 bits (159), Expect = 2e-11
 Identities = 81/608 (13%), Positives = 184/608 (30%), Gaps = 158/608 (25%)

Query: 57  DTKVAERNWGVNGLIVTVASVVEPFLLPQYRDKDTSEGQPELITGSQIDFLVEGK----- 111
           D +  E  +    ++    SV E   +  +  KD  +    +++  +ID ++  K     
Sbjct: 8   DFETGEHQYQYKDIL----SVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63

Query: 112 -------LRSEKEH------EDVDKGSPEWVTAQLMMLVDIPVSSLALQSLMEASSGLPE 158
                  L S++E       E+V + + +++ + +      P  S+  +  +E    L  
Sbjct: 64  TLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQP--SMMTRMYIEQRDRL-- 119

Query: 159 HEWEVGWSLAPYNNSSQPLMGVVKTSIE---------------SNKISLMESHRPFAMEE 203
             +      A YN S       ++ ++                S K  +       A++ 
Sbjct: 120 --YNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWV-------ALDV 170

Query: 204 SSNLSLMSKSTSRVAILGVSSYLKDLPNIALTPLNKRGDLLLAVGSPFGVL-----SPMH 258
             +  +  K   ++  L + +     P   L  L K   LL  +   +        +   
Sbjct: 171 CLSYKVQCKMDFKIFWLNLKNCNS--PETVLEMLQK---LLYQIDPNWTSRSDHSSNIKL 225

Query: 259 FFNSVSMGSVANCYPPRSTTRSLLMAD------------IRC--------------LPGM 292
             +S+    +      +     LL+              + C              L   
Sbjct: 226 RIHSIQ-AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAA 284

Query: 293 EGGPVFGEH--------------AHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL 338
               +  +H                ++    + L +    E+    P   ++   ++ + 
Sbjct: 285 TTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPR-RLSI-IAESIR 338

Query: 339 KEPQNAEKEIHINKGNLN-AVGNSL-LFNSHILNGACCYKY-----EHVDSRCRSPLPIQ 391
                 +   H+N   L   + +SL +           +                 +P  
Sbjct: 339 DGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRK--MFDRLSVFPPSA------HIPTI 390

Query: 392 KALASVCLITIDDGVWASGVLLNDQGLILTNAH---LLEPWRFGKTTVSGWRNGVSF--- 445
                  L+++   +W   +  +D  +++   H   L+E     ++T+S     +     
Sbjct: 391 -------LLSL---IWFDVIK-SDVMVVVNKLHKYSLVEKQPK-ESTIS--IPSIYLELK 436

Query: 446 QPEDSASSGH-TGVDQYQKSQTLPP--KMPKIVDSSVDEHRAYKLSSFSRGHRKIRVRLD 502
              ++  + H + VD Y   +T      +P  +D     H  + L +     R    R+ 
Sbjct: 437 VKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMV 496

Query: 503 HLDPWIWCDAKIVYV-----CKGPLDVSLLQLGYIPDQLCPIDADFGQPSLGSAAYVIGH 557
            LD + + + KI +        G +  +L QL +    +C  D  + +        V   
Sbjct: 497 FLD-FRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYER-------LVNAI 548

Query: 558 GLFGPRCG 565
             F P+  
Sbjct: 549 LDFLPKIE 556
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.82
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.79
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.78
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.77
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.77
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.76
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 99.75
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.75
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.66
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.65
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.65
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.62
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.61
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.6
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.54
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.52
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.5
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.49
3k6y_A237 Serine protease, possible membrane-associated seri 99.47
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 99.47
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.46
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.46
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.43
3k6y_A237 Serine protease, possible membrane-associated seri 99.41
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.4
1te0_A 318 Protease DEGS; two domains, serine protease, PDZ, 99.39
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.39
1y8t_A 324 Hypothetical protein RV0983; serine protease, stru 99.39
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 99.38
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.36
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 99.34
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.27
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.22
1hpg_A187 Glutamic acid specific protease; serine protease, 99.21
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.16
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.15
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.08
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 98.98
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 98.83
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 98.83
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 98.76
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 98.73
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 98.7
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.67
2o8l_A 274 V8 protease, taphylococcal serine; serine protease 98.59
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 98.58
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 98.54
1wcz_A 268 Glutamyl endopeptidase; virulence factor, hydrolas 98.51
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 98.49
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 98.49
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 98.47
2o8l_A274 V8 protease, taphylococcal serine; serine protease 98.44
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 98.43
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 98.12
2oua_A188 Serine protease, protein NAPA; kinetic stability, 98.11
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 97.98
1hpg_A187 Glutamic acid specific protease; serine protease, 97.95
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 97.88
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 97.7
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 97.68
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 97.66
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 97.59
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 97.55
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 97.42
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 97.41
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 97.4
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 97.38
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 97.38
1si5_H 240 Scatter factor, hepatocyte growth factor, SF, hepa 97.38
4e7n_A 238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 97.38
1ao5_A237 Glandular kallikrein-13; serine protease, protein 97.36
2xw9_A228 Complement factor D; immune system, hydrolase, ser 97.36
3s69_A 234 Thrombin-like enzyme defibrase; beta-barrel, serin 97.35
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 97.35
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 97.35
1mza_A 240 Pro-granzyme K; apoptosis, serine protease, S1 fam 97.35
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 97.33
1a7s_A225 Heparin binding protein; serine protease homolog, 97.33
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 97.29
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 97.28
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 97.28
3h7t_A 235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 97.27
2asu_B 234 Hepatocyte growth factor-like protein; serine prot 97.27
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 97.27
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 97.26
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 97.25
2z7f_E218 Leukocyte elastase; serine protease, serine protea 97.25
1azz_A226 Collagenase; complex (serine protease/inhibitor), 97.22
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 97.21
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 97.2
3gov_B 251 MAsp-1; complement, serine protease, beta barrel, 97.19
2r0l_A248 Hepatocyte growth factor activator; serine proteas 97.19
2aiq_A231 Protein C activator; snake venom serine proteinase 97.17
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 97.13
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 97.13
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 97.12
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 97.11
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 97.1
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 97.09
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 97.09
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 97.08
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 97.05
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 97.05
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 97.05
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 97.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 96.98
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 96.97
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 96.91
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 96.89
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 96.88
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 96.86
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 96.85
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 96.85
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 96.85
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 96.81
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 96.79
1euf_A227 Duodenase; serine protease, dual specificity, hydr 96.73
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 96.67
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 96.65
3bg8_A238 Coagulation factor XIA light chain; protease inhib 96.65
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 96.65
2f9n_A 245 Alpha I tryptase; serine proteinase, trypsin-like, 96.62
2jde_A 276 Urokinase-type plasminogen activator; plasminogen 96.61
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 96.59
3tvj_B 242 Mannan-binding lectin serine protease 2 B chain; i 96.58
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 96.58
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 96.58
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 96.56
2jkh_A 241 Activated factor XA heavy chain; plasma, calcium, 96.47
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.47
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.46
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 96.44
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 96.42
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 96.37
1aut_C 250 Activated protein C; serine proteinase, plasma cal 96.34
1z8g_A 372 Serine protease hepsin; serine protease hepsin, pr 96.34
1rtf_B 252 (TC)-T-PA, two chain tissue plasminogen activator; 96.31
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 96.17
1fiw_A 290 Beta-acrosin heavy chain; anti-parallel beta-barre 96.07
2qy0_B242 Complement C1R subcomponent; serine protease, beta 96.0
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 95.97
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 95.86
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 95.78
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 95.74
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 95.65
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 95.51
4f4o_C 347 Haptoglobin; globin fold, serine protease fold, co 95.42
1md8_A329 C1R complement serine protease; innate immunity, a 95.23
2xrc_A565 Human complement factor I; immune system, hydrolas 95.18
2vnt_A 276 Urokinase-type plasminogen activator; UPA, inhibit 95.13
1gpz_A399 Complement C1R component; hydrolase, activation, i 95.11
2b9l_A 394 Prophenoloxidase activating factor; CLIP domain, e 95.05
2xxl_A 408 GRAM-positive specific serine protease, isoform B; 95.0
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 94.96
3rm2_H 259 Thrombin heavy chain; serine protease, kringle, hy 94.76
3mmg_A 241 Nuclear inclusion protein A; 3C-type protease, TEV 94.75
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 94.68
2bdy_A 289 Thrombin; thrombin, complex structure, hydrolase, 94.64
1lvm_A229 Catalytic domain of the nuclear inclusion protein 94.55
1elv_A 333 Complement C1S component; trypsin-like serin prote 94.47
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 93.0
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 92.98
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 92.72
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 91.77
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 91.4
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 91.38
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 91.13
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 91.12
3hrz_D741 Complement factor B; serine protease, glycosilated 91.03
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 90.82
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 90.8
1ao5_A237 Glandular kallikrein-13; serine protease, protein 90.01
3su6_A203 NS3 protease, NS4A protein; drug resistance, drug 89.18
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 89.07
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 88.73
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 88.69
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 88.69
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 88.53
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 88.3
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 88.19
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 87.97
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 87.58
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 87.42
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 87.36
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 87.23
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 87.17
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 86.94
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 86.93
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 86.59
2z7f_E218 Leukocyte elastase; serine protease, serine protea 86.2
1euf_A227 Duodenase; serine protease, dual specificity, hydr 86.18
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 86.07
1a7s_A225 Heparin binding protein; serine protease homolog, 85.6
2asu_B234 Hepatocyte growth factor-like protein; serine prot 85.29
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 85.28
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 85.2
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 84.7
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 84.6
1lvm_A229 Catalytic domain of the nuclear inclusion protein 84.48
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 84.11
2aiq_A231 Protein C activator; snake venom serine proteinase 83.76
2jde_A276 Urokinase-type plasminogen activator; plasminogen 83.7
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 83.48
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 83.38
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 82.9
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 82.87
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 82.78
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 82.75
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 82.31
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 82.12
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 81.55
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 81.55
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.82  E-value=2.4e-20  Score=203.57  Aligned_cols=127  Identities=24%  Similarity=0.312  Sum_probs=99.4

Q ss_pred             ccccC-CCcceEEEEEEccCC--CCCCcccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCC----CCCC
Q 008426          207 LSLMS-KSTSRVAILGVSSYL--KDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPR----STTR  279 (566)
Q Consensus       207 ~~~l~-~~~tdlAvLki~~~~--~~~~~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~----~~~~  279 (566)
                      +++++ +..+|||||||+...  ..++++..+...+.||+|+|||+|||.     -..|+|.||||++.+..    ....
T Consensus       112 A~vv~~D~~~DLAvLkv~~~~~~~~~~pl~~g~~~~vGd~V~aiG~P~g~-----~~~tvT~GIVSa~~r~~~~~~~~~~  186 (539)
T 4fln_A          112 AKVLVRGVDCDIALLSVESEDFWKGAEPLRLGHLPRLQDSVTVVGYPLGG-----DTISVTKGVVSRIEVTSYAHGSSDL  186 (539)
T ss_dssp             EEEEEEETTTTEEEEEECCSSSSTTCCCCCBCCCCCTTCEEEEEECCSSS-----CCCEEEEEEEEEEEEEECTTSCCEE
T ss_pred             EEEEEECCCCCEEEEEEeCCcCCcCCceeecCCcCcCCCeEEEEEcCCCC-----CCCcEEeEEECcccccccCCCCcce
Confidence            56777 445899999998532  234456666778899999999999995     23599999999885422    1223


Q ss_pred             ceEEEecCCCCCCCCcceeccCCcEEEEEeeeccCCCCcceEEEeeHHHHHHHHHhhhc
Q 008426          280 SLLMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLLL  338 (566)
Q Consensus       280 ~liqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~g~gl~faIP~~~i~~~~~~lll  338 (566)
                      .+|||||+|+||||||||||.+|+||||+++.++..++.|++||||++.++.++.+++.
T Consensus       187 ~~IQtDAaInpGnSGGPLvn~~GeVIGIntai~~~~~~~gigfAIP~~~v~~vl~~l~~  245 (539)
T 4fln_A          187 LGIQIDAAINPGNSGGPAFNDQGECIGVAFQVYRSEETENIGYVIPTTVVSHFLTDYER  245 (539)
T ss_dssp             EEEEESSCCCTTTTTSEEECSSSCEEEEECCCC-----CCCEEEEEHHHHHHHHHHHHT
T ss_pred             eEEEEEeEecCCCccchhccCCCcEEEEEEEEecCCCCCcceecccHHHHHHHHHHHHH
Confidence            46999999999999999999999999999999876667799999999999999988763
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 566
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 4e-06
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 3e-04
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 0.002
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Thermotoga maritima [TaxId: 2336]

 Score = 45.7 bits (107), Expect = 4e-06
 Identities = 21/113 (18%), Positives = 37/113 (32%), Gaps = 2/113 (1%)

Query: 227 KDLPNIALTPLN--KRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPRSTTRSLLMA 284
           K  P +     +  K G+  +A+G+P G    +      +                L+  
Sbjct: 115 KKFPYLEFGDSDKVKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIPKPDGSGYYVGLIQT 174

Query: 285 DIRCLPGMEGGPVFGEHAHFVGILIRPLRQKSGAEIQLVIPWEAIATACSDLL 337
           D    PG  GGP+   H   +GI    +  +    +   IP   +      +L
Sbjct: 175 DAAINPGNSGGPLLNIHGEVIGINTAIVNPQEAVNLGFAIPINTVKKFLDTIL 227
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.84
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.76
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.63
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.6
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 99.56
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 99.56
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.56
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.54
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 99.52
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 99.5
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.39
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.29
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.25
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.21
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.04
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 98.87
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 98.79
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 98.76
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.74
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 98.57
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.33
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 98.18
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.09
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 97.83
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 97.48
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 97.48
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 97.36
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 97.08
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 97.01
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1op0a_ 234 Venom serine protease {Hundred-pace snake (Agkistr 96.93
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 96.88
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 96.73
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 96.64
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 96.63
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 96.57
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 96.5
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 96.5
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 96.42
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 96.37
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 96.31
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 96.3
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 96.3
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 96.29
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 96.28
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 96.26
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 96.24
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 96.15
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 96.11
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 96.05
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 95.99
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 95.97
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 95.82
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 95.76
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 95.73
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 95.67
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 95.62
g1fiw.1 274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 95.59
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 95.45
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 95.27
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 95.2
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 94.95
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 94.92
d1elva1259 Complement C1S protease, catalytic domain {Human ( 94.8
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 94.78
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 94.73
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 94.68
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 94.64
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 94.62
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 94.49
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 94.48
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 94.18
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 93.73
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 93.57
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 93.34
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 93.32
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 93.02
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 92.75
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 92.67
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 92.42
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 92.42
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 92.34
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 91.98
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 91.9
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 90.94
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 90.68
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 90.39
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 88.55
g1dy9.1187 NS3 protease {Human hepatitis C virus (HCV), diffe 83.99
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 81.3
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=99.84  E-value=3.9e-21  Score=187.60  Aligned_cols=125  Identities=19%  Similarity=0.308  Sum_probs=102.7

Q ss_pred             ccccC-CCcceEEEEEEccC-CCCCCcccCCCCCCCCCeEEEEeCCCCCCCCCccCCceEEEEEecccCCC---CCCCce
Q 008426          207 LSLMS-KSTSRVAILGVSSY-LKDLPNIALTPLNKRGDLLLAVGSPFGVLSPMHFFNSVSMGSVANCYPPR---STTRSL  281 (566)
Q Consensus       207 ~~~l~-~~~tdlAvLki~~~-~~~~~~~~~S~~~~~Gd~V~aiGSPFG~lsP~~F~nsvS~GiISn~~~~~---~~~~~l  281 (566)
                      +++++ +..+|+|+||++.. ......++++..+++||+|+|||+|||+      ..++|.|+++...+..   .....+
T Consensus       115 a~~~~~d~~~dlavl~i~~~~~~~~~~l~~~~~~~~G~~v~aiG~P~g~------~~tvt~~~~~~~~~~~~~~~~~~~~  188 (249)
T d1ky9a2         115 AKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGL------GETVTSGIVSALGRSGLNAENYENF  188 (249)
T ss_dssp             EEEEEEETTTTEEEEEESSCCSCCCCCBCCGGGCCTTCEEEEEECTTSS------SCEEEEEEEEEESSCC-----CCCC
T ss_pred             ceeeEeccchhhceeeecccccceEEEcCCcCcCCcCCEEEEEeccccc------CCceeecceeecccccccCccccce
Confidence            45566 45589999999842 2233346678899999999999999995      7899999999886543   234568


Q ss_pred             EEEecCCCCCCCCcceeccCCcEEEEEeeeccCCC-CcceEEEeeHHHHHHHHHhhh
Q 008426          282 LMADIRCLPGMEGGPVFGEHAHFVGILIRPLRQKS-GAEIQLVIPWEAIATACSDLL  337 (566)
Q Consensus       282 iqTDA~ilPGnsGGpVfn~~G~lIGIv~~~l~~~~-g~gl~faIP~~~i~~~~~~ll  337 (566)
                      |||||+++||||||||||.+|+||||+++.+...+ ..|++||||++.+++++.+++
T Consensus       189 iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~~~~~gi~faIP~~~~~~~~~~l~  245 (249)
T d1ky9a2         189 IQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV  245 (249)
T ss_dssp             EEESCCCTTSCCCSEEECTTSCEEEEEECSSTTSCCCSSSEEEEEHHHHHHHHHHHH
T ss_pred             EEEeeeecCCCCCceEECCCCEEEEEEEEEeccCCCcccEEEEEEHHHHHHHHHHHH
Confidence            99999999999999999999999999999887664 459999999999999888764
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure