Citrus Sinensis ID: 008441

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-----

MATTRADADAGDDLYSVLALQRVELTAADSVESDLDFAFRLQLQEAISASLAHVPSSSSTSSLPPSTSSAPPPLPHDAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELAEIPDDEWEESGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDDDSDSSFEEEEEEDDDDDVIDEYESEFESEEEFI

cccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccccccccccEEEEEEcccHHHHHHcccccccccEEEEEEccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccccccccHHHHHHHHHHccccccHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHcccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHccc

cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccccEEEEEEEcEEEEEcccccccEEEEEEEEEEcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHHHcccccccccccccccccccccEEEccccHHHcccccccccHHHHHHHHHHHHHHHHcccEEcccccccccEccHHHHHHHccHHHHHHHHHHHHHHcccccccEEcccccccHEEEEEccccccccccccccccccEEEEccccEEEEcccccccccccHHHHHHHccccccccHHHHHHHHcccccccccccccEEccccccEEEEEEccEEEEEEcccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc

mattradadagdDLYSVLALQRVELTAADSVESDLDFAFRLQLQEAISASlahvpsssstsslppstssappplphdaasptlaslQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKelaeipddeweesgdniekplcardngdyFFKVYSKGLVIEElvngervslSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIdcfplfqfvtgrwpakqrkISVLVDQVSLLEKRfsyfkprhvarnDMKYVYELARAAINSqmtvpaeisrgktinetcvicledtdvghmfsidgcLHRYCFLCMKKHIEEKLrqgmeptcphegckskleveSCRIFLTLKLFEIWNQRMKEALipvtekvycpypkcsalmskseierdassssfvgrrlgarkctkchrrfcidckvpwhnnmtciyykrlnpnpptedvklksLASSNLWRQCVKCNHLIELaegcfhmtcrcghefcyncgaewknkkatcscplwdednildddsdssfeeeeeedddddvIDEYESEFESEEEFI

mattradadagddlYSVLALQRVELTAADSVESDLDFAFRLQLQEAISASLAHVPSSSSTSSLPPSTSSAPPPLPHDAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELaeipddeweesGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFvtgrwpakqrkisVLVDQVSLLEKrfsyfkprhvarnDMKYVYELARAAINSqmtvpaeisrgktiNETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSkseierdassssfvgrrlgarkctkchrrfcidckvpwhNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDDDSDSSFeeeeeedddddvIDEYESEFESEEEFI

MattradadagddLYSVLALQRVELTAADSVESDLDFAFRLQLQEAIsaslahvpsssstsslppstssappplphDAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELAEIPDDEWEESGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILdddsdssfeeeeeedddddvideyesefeseeefI

************DLYSVLALQRVELTAADSVESDLDFAFRLQLQEAI************************************************************************************************EKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSAL**************FVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNP******VKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNI************************************

***********DDLYSVLALQRVELT***SVESDLDFAFRLQLQEAI***********************************LASLQSEELMKLDR****************EDLQRAIHDHNFAKEL**************************YFFKVYSKGLVI********VSLSAIGVAICDQMDNLIFELKK***********AETKALIEGLNAALSMELDRVRVFIDCFPLFQFV**********ISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYE*************************CVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSS*VGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNI******************DDVIDEYESEFESEE***

*********AGDDLYSVLALQRVELTAADSVESDLDFAFRLQLQEAISAS************************PHDAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELAEIPDDEWEESGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSK***********FVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDD*****************VIDEY***********

**********GDDLYSVLALQRVELTAADSVESDLDFAFRLQLQEAISAS**************************DAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELAEIPDDEWEESGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMT**********INETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDDDSDSSFEEEEEEDDDDDVIDEYESEFESEEEFI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MATTRADADAGDDLYSVLALQRVELTAADSVESDLDFAFRLQLQEAISASLAHVPSSSSTSSLPPSTSSAPPPLPHDAASPTLASLQSEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAEIPDDEWEESGDNIEKPLCARDNGDYFFKVYSKGLVIEELVNGERVSLSAIGVAICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDDDSDSSFEEEEEEDDDDDVIDEYESEFESEEEFI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		565	2.2.26 [Sep-21-2011]
P0CE10		1787	Putative uncharacterized	no	no	0.323	0.102	0.287	7e-17
Q6T486		520	Probable E3 ubiquitin-pro	no	no	0.410	0.446	0.267	1e-14
A4IIY1		292	Probable E3 ubiquitin-pro	yes	no	0.334	0.647	0.271	3e-11
Q9SKC3		543	Probable E3 ubiquitin-pro	no	no	0.355	0.370	0.264	2e-10
Q9LVX0		537	Probable E3 ubiquitin-pro	no	no	0.350	0.368	0.253	3e-10
Q9P3U4		504	Uncharacterized RING fing	yes	no	0.449	0.503	0.244	5e-10
O76924		509	Protein ariadne-2 OS=Dros	yes	no	0.338	0.375	0.246	1e-09
P50876		292	Probable E3 ubiquitin-pro	yes	no	0.334	0.647	0.247	1e-09
B1H1E4		529	E3 ubiquitin-protein liga	no	no	0.380	0.406	0.246	2e-09
Q32NS4		529	E3 ubiquitin-protein liga	N/A	no	0.373	0.398	0.237	2e-09

>sp\|P0CE10\|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1	Back alignment and function desciption

 Score = 89.4 bits (220), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 90/202 (44%), Gaps = 19/202 (9%)

Query: 311  CVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQ--GMEPTCPHEGCKSKLEVESC 368
            C ICL + D G  +S++GC H +C  C+ +  E  +R        C H  C + + V   
Sbjct: 1561 CPICLSEVDDG--YSLEGCSHLFCKACLLEQFEASMRNFDAFPILCSHIDCGAPIVVADM 1618

Query: 369  RIFLTL-KLFEIWNQRMKEALIPVTEKV-YCPYPKCSALMSKSEIERDASSSSFVGRRLG 426
            R  L+  KL E+ +  +   +     K+ +C  P C ++   +  +   S   F+     
Sbjct: 1619 RALLSQEKLDELISASLSAFVTSSDGKLRFCSTPDCPSIYRVAGPQE--SGEPFI----- 1671

Query: 427  ARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHL 486
               C  CH   C  C + +H  +TC  YK+   NP   D+ LK  A     ++C  C   
Sbjct: 1672 ---CGACHSETCTRCHLEYHPLITCERYKKFKENP---DLSLKDWAKGKDVKECPICKST 1725

Query: 487  IELAEGCFHMTCRCGHEFCYNC 508
            IE  +GC H+ CRCG   C+ C
Sbjct: 1726 IEKTDGCNHLQCRCGKHICWTC 1747

Arabidopsis thaliana (taxid: 3702)

>sp\|Q6T486\|RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum GN=rbrA PE=3 SV=1	Back alignment and function description

>sp\|A4IIY1\|R144A_XENTR Probable E3 ubiquitin-protein ligase RNF144A OS=Xenopus tropicalis GN=rnf144a PE=2 SV=1	Back alignment and function description

>sp\|Q9SKC3\|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVX0\|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1	Back alignment and function description

>sp\|Q9P3U4\|YKX2_SCHPO Uncharacterized RING finger protein C328.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.02 PE=3 SV=1	Back alignment and function description

>sp\|O76924\|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1	Back alignment and function description

>sp\|P50876\|R144A_HUMAN Probable E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens GN=RNF144A PE=1 SV=2	Back alignment and function description

>sp\|B1H1E4\|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1	Back alignment and function description

>sp\|Q32NS4\|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		565
255570777		571	zinc finger protein, putative [Ricinus c	0.906	0.896	0.591	0.0
225435219		557	PREDICTED: uncharacterized protein LOC10	0.961	0.974	0.546	1e-166
357472415		541	IBR domain containing protein [Medicago	0.899	0.939	0.557	1e-165
356539106		557	PREDICTED: uncharacterized protein LOC10	0.915	0.928	0.563	1e-163
297746209		598	unnamed protein product [Vitis vinifera]	0.961	0.908	0.509	1e-160
113205181		596	zinc finger family protein, putative [So	0.906	0.859	0.483	1e-153
449508657		562	PREDICTED: uncharacterized LOC101214830	0.870	0.875	0.525	1e-140
449463669		562	PREDICTED: uncharacterized protein LOC10	0.870	0.875	0.525	1e-140
449459132		546	PREDICTED: uncharacterized protein LOC10	0.923	0.956	0.480	1e-139
449501259		547	PREDICTED: uncharacterized protein LOC10	0.923	0.954	0.480	1e-139

>gi\|255570777\|ref\|XP_002526341.1\| zinc finger protein, putative [Ricinus communis] gi\|223534300\|gb\|EEF36012.1\| zinc finger protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/531 (59%), Positives = 400/531 (75%), Gaps = 19/531 (3%)

Query: 14  LYSVLALQRVELTAADSVESDLDFAFRLQLQEAISASLAHVPSSSSTSSLPPSTSSAPPP 73
           L S+L+ QR EL AA S++SDLDFAF+LQLQEAI+ASL+  PSSS++        SAP  
Sbjct: 13  LQSLLSEQRRELMAAQSLDSDLDFAFQLQLQEAINASLSLHPSSSTSRQPQQQPQSAPSS 72

Query: 74  LPHDAASPTLASLQSEELMKLDRELADSRQAKLEMQKAREDLQRAIHDHNFAKELAEIPD 133
             +D  S  L SL SEE+ KL++E+ D +Q++ E QK +EDL R +HD   A+E+  IP+
Sbjct: 73  DQNDTVS--LPSLLSEEITKLEQEINDRKQSEFETQKIKEDLHRRVHDQKLAREILRIPE 130

Query: 134 DEWEESGDNIEKPLCAR----------DNGDYFFKVYSKGLVIEELVNGERVSLSAIGVA 183
            EW E GDN EKP               N D  F++Y KGL+ EE V  ++ +L+ IGVA
Sbjct: 131 PEWREWGDNFEKPYGEGSSSSGASRSVQNSDSVFRLYFKGLICEENVRDKKENLAGIGVA 190

Query: 184 ICDQMDNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFIDCFPLFQFVT 243
           ICD +DNL+FE++KPL+ +G+ +  AETKALIEGLNAAL++EL R+ ++ D +PL+QF+ 
Sbjct: 191 ICDPVDNLVFEIRKPLVGNGMGRQVAETKALIEGLNAALALELKRIVIYCDYYPLYQFII 250

Query: 244 GRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQMTVPAEISR 303
           GRWP KQRK+++LV+QVS L+K+F+Y +   V R+ +KY ++LA+ AI+SQ+  PA+ SR
Sbjct: 251 GRWPPKQRKVAMLVNQVSFLQKKFTYCRTTLVPRSSIKYAFKLAKDAIDSQVRRPADSSR 310

Query: 304 GKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKL 363
           GKT+ ETCVICLEDTDV  +FS+DGC HRYCF CMK+H+E KL   M P CPH+GCKS+L
Sbjct: 311 GKTLQETCVICLEDTDVKRIFSVDGCRHRYCFSCMKQHVEVKLLHVMLPKCPHDGCKSEL 370

Query: 364 EVESCRIFLTLKLFEIWNQRMKEALIPVTEKVYCPYPKCSALMSKSEIERDASSSSFVGR 423
            V+SCR FLT KL EI +QRMKEA IP +E++YCPYPKCSALMS++E+  D S  S    
Sbjct: 371 TVDSCRKFLTPKLIEIMSQRMKEASIPASERIYCPYPKCSALMSRNEVS-DGSERS---- 425

Query: 424 RLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKC 483
             GARKC KCH  FCI+CKVPWH+NMTC  YK LNPNPP ED KLKSLA+ NLWRQCVKC
Sbjct: 426 --GARKCLKCHALFCINCKVPWHSNMTCGIYKLLNPNPPGEDGKLKSLATKNLWRQCVKC 483

Query: 484 NHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATCSCPLWDEDNILDDDS 534
           NH+IELAEGC+HMTCRCG+EFCYNCGAEWK+KKATCSCP+WDE+ IL D +
Sbjct: 484 NHMIELAEGCYHMTCRCGYEFCYNCGAEWKDKKATCSCPIWDENYILHDQN 534

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225435219\|ref\|XP_002282087.1\| PREDICTED: uncharacterized protein LOC100241711 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357472415\|ref\|XP_003606492.1\| IBR domain containing protein [Medicago truncatula] gi\|355507547\|gb\|AES88689.1\| IBR domain containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356539106\|ref\|XP_003538041.1\| PREDICTED: uncharacterized protein LOC100790037 [Glycine max]	Back alignment and taxonomy information

>gi\|297746209\|emb\|CBI16265.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|113205181\|gb\|AAT40530.2\| zinc finger family protein, putative [Solanum demissum]	Back alignment and taxonomy information

>gi\|449508657\|ref\|XP_004163374.1\| PREDICTED: uncharacterized LOC101214830 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449463669\|ref\|XP_004149554.1\| PREDICTED: uncharacterized protein LOC101214830 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449459132\|ref\|XP_004147300.1\| PREDICTED: uncharacterized protein LOC101222498 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449501259\|ref\|XP_004161320.1\| PREDICTED: uncharacterized protein LOC101223490 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		565
TAIR\|locus:2143995		655	AT5G60250 [Arabidopsis thalian	0.669	0.577	0.507	1.3e-115
TAIR\|locus:2040025		603	AT2G25370 [Arabidopsis thalian	0.612	0.573	0.454	3.4e-84
TAIR\|locus:2151689		444	AT5G37560 [Arabidopsis thalian	0.663	0.844	0.403	1.5e-76
TAIR\|locus:2085672		408	AT3G45580 [Arabidopsis thalian	0.617	0.855	0.4	3.9e-76
TAIR\|locus:2050100		468	AT2G21420 [Arabidopsis thalian	0.371	0.448	0.5	1.2e-75
TAIR\|locus:2040065		373	AT2G25360 [Arabidopsis thalian	0.515	0.780	0.453	6.7e-72
TAIR\|locus:2057401		398	AT2G26130 [Arabidopsis thalian	0.603	0.856	0.401	3e-69
TAIR\|locus:1006230127		384	AT2G26135 [Arabidopsis thalian	0.343	0.505	0.509	3.3e-67
TAIR\|locus:2101074		346	AT3G43750 [Arabidopsis thalian	0.585	0.956	0.398	5.2e-65
TAIR\|locus:2085622		222	AT3G45470 [Arabidopsis thalian	0.364	0.927	0.518	1.1e-62

TAIR\|locus:2143995 AT5G60250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1111 (396.2 bits), Expect = 1.3e-115, Sum P(2) = 1.3e-115
 Identities = 194/382 (50%), Positives = 267/382 (69%)

Query:   152 NGDYFFKVYSKGLVIEELVNGERVSL-SAIGVAICDQMDNLIFELKKPLIKSGLNKSAAE 210
             NG+  +++Y KGLV +E   G+   + S  GVAICDQ DNL+FE+K PLI +G+++  AE
Sbjct:   140 NGNLLYRLYFKGLVSDENGKGKMTDVVSGFGVAICDQRDNLLFEMKGPLIDNGMSRQGAE 199

Query:   211 TKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYF 270
              KALI GL  AL + +  +  F D +P+FQ+VTG+W AKQ+KIS+L+D +  + + FS +
Sbjct:   200 LKALIRGLTEALKLGIKHIVFFCDSYPIFQYVTGKWMAKQKKISLLLDDLQSIMQHFSSY 259

Query:   271 KPRHVARNDMKYVYELARAAINSQMTVPAEISRGKTI-NETCVICLEDTDVGHMFSIDGC 329
             +   VARND+K+ Y+LAR +I S +T   +  + K +  E C IC  D     MFS+D C
Sbjct:   260 QHVLVARNDVKFAYKLARESILSMVTPHEDPRQAKAVLKEECAICFNDIVAEGMFSVDKC 319

Query:   330 LHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALI 389
              HR+CF C+K+H+E KL  GM P CPH+GCKS+L +++C   LT KL ++W QR++E  I
Sbjct:   320 RHRFCFQCVKQHVEVKLLHGMAPKCPHDGCKSELVIDACGKLLTPKLSKLWQQRLQENAI 379

Query:   390 PVTEKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNM 449
             PVTE+VYCPYP+CSALMSK++I   A S   +  + G R+C +C   FC+DCKVPWH N+
Sbjct:   380 PVTERVYCPYPRCSALMSKTKISESAKSLLSLYPKSGVRRCVECRGLFCVDCKVPWHGNL 439

Query:   450 TCIYYKRLNPNPPTEDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCG 509
             +C  YK+L+P PP +DVKLKSLA++ +WRQC KC H+IEL++GC H+TCRCGHEFCYNCG
Sbjct:   440 SCTEYKKLHPEPPADDVKLKSLANNKMWRQCGKCQHMIELSQGCNHITCRCGHEFCYNCG 499

Query:   510 AEWKNKKATC--SCPLWDEDNI 529
               W     TC   CP W+E+ I
Sbjct:   500 GGWNKIMGTCLNRCPTWNEEYI 521

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0008270 "zinc ion binding" evidence=IEA

TAIR\|locus:2040025 AT2G25370 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2151689 AT5G37560 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2050100 AT2G21420 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057401 AT2G26130 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2101074 AT3G43750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00024481001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (557 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		565
pfam13456		88	pfam13456, RVT_3, Reverse transcriptase-like	3e-15
smart00647		64	smart00647, IBR, In Between Ring fingers	4e-13
cd09279		128	cd09279, RNase_HI_archaeal_like, RNAse HI family t	9e-10
pfam01485		63	pfam01485, IBR, IBR domain	3e-08
smart00647		64	smart00647, IBR, In Between Ring fingers	2e-04
pfam01485		63	pfam01485, IBR, IBR domain	0.001

>gnl\|CDD\|205634 pfam13456, RVT_3, Reverse transcriptase-like	Back alignment and domain information

 Score = 70.7 bits (174), Expect = 3e-15
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 209 AETKALIEGLNAALSMELDRVRVFIDCFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFS 268
           AE +AL+EGL  AL + + R+ V  D   + Q + G + A+ R ++ L+ ++  L K+F 
Sbjct: 5   AEAEALLEGLQLALELGIRRLIVESDSQLVVQQIQGEYEARSR-LAALLREIRKLLKKFD 63

Query: 269 YFKPRHVARNDMKYVYELARAAINS 293
                HV R   +    LA+ A  S
Sbjct: 64  SVSVSHVPRECNRVADALAKLASAS 88

This domain is found in plants and appears to be part of a retrotransposon. Length = 88

>gnl\|CDD\|214763 smart00647, IBR, In Between Ring fingers	Back alignment and domain information

>gnl\|CDD\|187703 cd09279, RNase_HI_archaeal_like, RNAse HI family that includes Archaeal RNase HI	Back alignment and domain information

>gnl\|CDD\|216524 pfam01485, IBR, IBR domain	Back alignment and domain information

>gnl\|CDD\|214763 smart00647, IBR, In Between Ring fingers	Back alignment and domain information

>gnl\|CDD\|216524 pfam01485, IBR, IBR domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		565
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	100.0
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	99.97
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	99.94
KOG0006		446	consensus E3 ubiquitin-protein ligase (Parkin prot	99.92
PRK07708		219	hypothetical protein; Validated	99.89
PRK13907		128	rnhA ribonuclease H; Provisional	99.89
COG0328		154	RnhA Ribonuclease HI [DNA replication, recombinati	99.86
PRK07238		372	bifunctional RNase H/acid phosphatase; Provisional	99.86
PRK08719		147	ribonuclease H; Reviewed	99.68
cd06222		130	RnaseH RNase H (RNase HI) is an endonuclease that	99.62
PRK06548		161	ribonuclease H; Provisional	99.58
PRK00203		150	rnhA ribonuclease H; Reviewed	99.52
PF13456		87	RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH	99.47
PF00075		132	RNase_H: RNase H; InterPro: IPR002156 The RNase H	99.36
smart00647		64	IBR In Between Ring fingers. the domains occurs be	98.87
PF01485		64	IBR: IBR domain; InterPro: IPR002867 Zinc finger (	98.79
KOG3752		371	consensus Ribonuclease H [Replication, recombinati	98.75
smart00647		64	IBR In Between Ring fingers. the domains occurs be	98.3
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.15
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.09
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.09
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.04
PF01485		64	IBR: IBR domain; InterPro: IPR002867 Zinc finger (	98.03
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.01
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.99
PF14634		44	zf-RING_5: zinc-RING finger domain	97.92
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	97.85
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	97.82
PHA02926		242	zinc finger-like protein; Provisional	97.62
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	97.57
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	97.51
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.48
PHA02929		238	N1R/p28-like protein; Provisional	97.42
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.32
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	97.31
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	97.3
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	97.24
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.13
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	96.98
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	96.97
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	96.8
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	96.73
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	96.47
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.25
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	96.16
PF06524		314	NOA36: NOA36 protein; InterPro: IPR010531 This fam	96.11
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	95.99
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	95.98
KOG1002		791	consensus Nucleotide excision repair protein RAD16	95.94
KOG4367		699	consensus Predicted Zn-finger protein [Function un	95.87
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	95.6
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	95.44
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	95.4
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	95.16
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	94.94
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	94.91
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	92.82
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	92.79
KOG0006		446	consensus E3 ubiquitin-protein ligase (Parkin prot	92.57
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	92.49
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	92.33
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	91.66
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	91.65
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	91.56
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	91.42
KOG2660		331	consensus Locus-specific chromosome binding protei	91.1
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	91.06
PHA03096		284	p28-like protein; Provisional	90.49
KOG4739		233	consensus Uncharacterized protein involved in syna	89.83
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	89.5
PLN03086		567	PRLI-interacting factor K; Provisional	89.36
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	89.01
KOG0825		1134	consensus PHD Zn-finger protein [General function	88.89
KOG0297		391	consensus TNF receptor-associated factor [Signal t	88.32
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	87.81
PHA00626		59	hypothetical protein	87.04
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	86.98
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	86.83
COG5175		480	MOT2 Transcriptional repressor [Transcription]	86.82
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	86.67
COG5152		259	Uncharacterized conserved protein, contains RING a	86.4
PRK14559		645	putative protein serine/threonine phosphatase; Pro	86.06
PF13719		37	zinc_ribbon_5: zinc-ribbon domain	85.84
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	85.66
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	85.59
PRK05654		292	acetyl-CoA carboxylase subunit beta; Validated	85.57
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	85.57
smart00661		52	RPOL9 RNA polymerase subunit 9.	85.4
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	84.94
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	84.48
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	84.3
COG0777		294	AccD Acetyl-CoA carboxylase beta subunit [Lipid me	84.12
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	84.0
KOG4445		368	consensus Uncharacterized conserved protein, conta	83.85
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	83.57
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	83.2
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	83.17
PF13717		36	zinc_ribbon_4: zinc-ribbon domain	83.01
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	82.8
CHL00174		296	accD acetyl-CoA carboxylase beta subunit; Reviewed	82.78
PF13240		23	zinc_ribbon_2: zinc-ribbon domain	82.72
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	82.47
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	82.4
TIGR00515		285	accD acetyl-CoA carboxylase, carboxyl transferase,	82.0
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	81.85
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	81.82
PF13248		26	zf-ribbon_3: zinc-ribbon domain	81.35
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	80.1

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=6.1e-54  Score=452.15  Aligned_cols=351  Identities=47%  Similarity=0.924  Sum_probs=303.6

Q ss_pred             EEEEccceeecccCCCCCCCceEEEEEEeC-CCCeEEEeeeeccccC-CChHHHHHHHHHHHHHHHHhcCCCeEEeecCC
Q 008441          158 KVYSKGLVIEELVNGERVSLSAIGVAICDQ-MDNLIFELKKPLIKSG-LNKSAAETKALIEGLNAALSMELDRVRVFIDC  235 (565)
Q Consensus       158 ~vyfdGa~~~~~~~~~npg~ag~Gv~i~~~-~~~~~~~~~~~~~~~~-tn~n~AEy~Ali~gL~~al~l~~~~v~v~~DS  235 (565)
                      ++||.|.++.+.+ +. ...+|.||+|.+. +....+.+.....+.. .+.-.||++||+.||.+|+++|+.++.++.|+
T Consensus         1 ~l~~k~lv~~e~~-~~-~~~~g~~vai~d~~d~~~~f~~k~~~~~~~~~~~~~ae~~al~~~l~ea~~~~~~~~~~~~d~   78 (384)
T KOG1812|consen    1 RLYFKGLVSEESI-ND-ILLAGFGVAICDEHDDDLLFQMKASDHDSDSITPLEAELMALKRGLTEALELGLNHIVIYCDD   78 (384)
T ss_pred             CCccccchhhhhh-hh-hhcccCceeeeccccHHHHHHhhcCcccccccchhhHHHHHHhhccHHHHhhccccceEeccc
Confidence            3799999977643 22 5679999999997 4556666666664433 66689999999999999999999999999999


Q ss_pred             ccchhhccCccCCcch-hhHHHHHHHHHHhhhcccccccccccc-chHHHHHHHHHhhhcccccccccccCcccccccce
Q 008441          236 FPLFQFVTGRWPAKQR-KISVLVDQVSLLEKRFSYFKPRHVARN-DMKYVYELARAAINSQMTVPAEISRGKTINETCVI  313 (565)
Q Consensus       236 ~lv~~qv~G~w~~k~~-~l~~l~~~v~~Ll~~F~~~~~~~V~R~-~n~~Ad~LA~eal~sqi~~~~~~~~~~~~~~~C~I  313 (565)
                      .++++.+.|+..+++. ++..+++++..+..+|......++++. +.+++.+||.+++.+..       .......+|.|
T Consensus        79 ~~~~~~v~~~~~~~~~~~~~~l~~~v~~~r~~l~~~~~i~~~~~~d~~~~~~lA~e~i~s~~-------~~~~~~~~C~i  151 (384)
T KOG1812|consen   79 ELIYESVAGREKPEQHRKIVLLVELVQRIREQLTSSEPILVPKNADIKFAYKLAREAIVSQL-------PSKLPKEECGI  151 (384)
T ss_pred             HHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHhhcccceecccchhhHHHHHHHHHhhcccc-------ccccccccCcc
Confidence            9999999999999988 799999999999999999999888776 88999999999998711       23345789999


Q ss_pred             ec-cccccCCceeecCCCcccchhhHHHHHHHHHhCCCCCCCCCCCCCCccchhhHHHhhhhHHHHHHHHHHHHhcCCCC
Q 008441          314 CL-EDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEPTCPHEGCKSKLEVESCRIFLTLKLFEIWNQRMKEALIPVT  392 (565)
Q Consensus       314 C~-e~~~~~~~~~l~~C~H~fC~~Cl~~~i~~~i~~g~~~kCP~~~C~~~l~~~~i~~lL~~e~~e~y~~~~~e~~i~~~  392 (565)
                      |+ +......++.+..|+|.||.+|+++|++++..++..|+||..+|+..++.+.+..+|++++.++|.+++.+..++..
T Consensus       152 C~~e~~~~~~~f~~~~C~H~fC~~C~k~~iev~~~~~~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~~~e~~i~~~  231 (384)
T KOG1812|consen  152 CFVEDPEAEDMFSVLKCGHRFCKDCVKQHIEVKLLSGTVIRCPHDGCESRLTLESCRKLLTPKLREMWEQRLKEEVIPSL  231 (384)
T ss_pred             CccccccHhhhHHHhcccchhhhHHhHHHhhhhhccCCCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHHHHHHhhhhh
Confidence            99 55455577778899999999999999999988888999999999999999999999999999999999999999877


Q ss_pred             CcccccCCCCCCcccchhhhhccCCCcccccccCceeCCCCCCceecccCCCcCCCCChhhHhhhCCCCChhHHHHHHHH
Q 008441          393 EKVYCPYPKCSALMSKSEIERDASSSSFVGRRLGARKCTKCHRRFCIDCKVPWHNNMTCIYYKRLNPNPPTEDVKLKSLA  472 (565)
Q Consensus       393 ~~~~CP~p~C~~~i~~~~~~e~~~s~~~~~~~~~~~~C~~C~~~fC~~C~~~~H~g~tC~e~~~~~~~~~~ed~~l~~l~  472 (565)
                      +.+|||+|+|..++...++.        .........|+.|+..||.+|+.+||.+.+|++|+++.......+..++.++
T Consensus       232 ~~~ycp~~~C~~l~~~~el~--------~~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~~~~~d~~~~~~la  303 (384)
T KOG1812|consen  232 DRVYCPYPRCSSLMSKTELS--------SEVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNPEEYVDDITLKYLA  303 (384)
T ss_pred             hcccCCCCCchHhhhhhhhc--------cchhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCCcccccHHHHHHHH
Confidence            77799999999999877652        1345667889999999999999999999999999999987776677777777


Q ss_pred             hcCCccccCCCCceeEecCCcceEEeecCccccccccccccCCCCCc-CCCCCCCC
Q 008441          473 SSNLWRQCVKCNHLIELAEGCFHMTCRCGHEFCYNCGAEWKNKKATC-SCPLWDED  527 (565)
Q Consensus       473 ~~~~~k~CPkC~~~IEK~~GCnHMtC~Cg~~FCw~C~~~~~~~~~~c-~C~~~~~~  527 (565)
                        +.||+||+|++.|++.+|||||||+||++|||.|+.+|..+.+.| .|..+++.
T Consensus       304 --~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~~~~~~~~~~~~~~~r~~~~  357 (384)
T KOG1812|consen  304 --KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCGGDWKTHNGECYECCRYKES  357 (384)
T ss_pred             --HhcCcCcccceeeeecCCcceEEeeccccchhhcCcchhhCCccccCccccccc
Confidence              779999999999999999999999999999999999999888765 55544444

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07708 hypothetical protein; Validated	Back alignment and domain information

>PRK13907 rnhA ribonuclease H; Provisional	Back alignment and domain information

>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07238 bifunctional RNase H/acid phosphatase; Provisional	Back alignment and domain information

>PRK08719 ribonuclease H; Reviewed	Back alignment and domain information

>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner	Back alignment and domain information

>PRK06548 ribonuclease H; Provisional	Back alignment and domain information

>PRK00203 rnhA ribonuclease H; Reviewed	Back alignment and domain information

>PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B	Back alignment and domain information

>PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site	Back alignment and domain information

>smart00647 IBR In Between Ring fingers	Back alignment and domain information

>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG3752 consensus Ribonuclease H [Replication, recombination and repair]	Back alignment and domain information

>smart00647 IBR In Between Ring fingers	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03086 PRLI-interacting factor K; Provisional	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PHA00626 hypothetical protein	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PRK14559 putative protein serine/threonine phosphatase; Provisional	Back alignment and domain information

>PF13719 zinc_ribbon_5: zinc-ribbon domain	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PRK05654 acetyl-CoA carboxylase subunit beta; Validated	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00661 RPOL9 RNA polymerase subunit 9	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13717 zinc_ribbon_4: zinc-ribbon domain	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed	Back alignment and domain information

>PF13240 zinc_ribbon_2: zinc-ribbon domain	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PF13248 zf-ribbon_3: zinc-ribbon domain	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		565
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	2e-15
1wd2_A		60	Ariadne-1 protein homolog; ring, IBR, triad, zinc	2e-13
3hst_B		141	Protein RV2228C/MT2287; ribonuclease H1, RV2228C N	1e-12
2ehg_A		149	Ribonuclease HI; RNAse HI, hyperthermophilic archa	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	6e-06
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	1e-04
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	2e-04
2ct7_A		86	Ring finger protein 31; IBR, structural genomics,	3e-04
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	6e-04

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94	Back alignment and structure

 Score = 71.4 bits (175), Expect = 2e-15
 Identities = 21/91 (23%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 304 GKTINETCVICLEDTDVGHMFSIDGCLHRYCFLCMKKHIEEKLRQGMEP--TCPHEGCKS 361
           G + +  C +CL +  V  M +I  C   +C LC+K+++E  +++G+E   +CP   C  
Sbjct: 1   GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60

Query: 362 K--LEVESCRIFLTLKLFEIWNQRMKEALIP 390
           +  L+       +  ++ + + +   E   P
Sbjct: 61  QGHLQENEIECMVAAEIMQRYKKLQFERSGP 91

PyMOL of 1wim

>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60	Back alignment and structure

>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Length = 141	Back alignment and structure

>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A Length = 149	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		565
3hst_B		141	Protein RV2228C/MT2287; ribonuclease H1, RV2228C N	99.91
3u3g_D		140	Ribonuclease H, RNAse H1; hydrolase, cleave the RN	99.9
2ehg_A		149	Ribonuclease HI; RNAse HI, hyperthermophilic archa	99.9
2qkb_A		154	Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy	99.77
2kq2_A		147	Ribonuclease H-related protein; PSI, NESG, protein	99.76
3h08_A		146	RNH (ribonuclease H); RNAse H, 3D-structure, endon	99.74
2e4l_A		158	Ribonuclease HI, RNAse HI; hydrolase, endoribonucl	99.7
1jl1_A		155	Ribonuclease HI; RNAse HI, protein stability, ther	99.7
2lsn_A		165	Reverse transcriptase; RNAse H, viral protein; NMR	99.69
3qio_A		150	GAG-POL polyprotein; RNAse H, inhibitor, nuclease,	99.69
1ril_A		166	Ribonuclease H; hydrolase(endoribonuclease); 2.80A	99.68
3p1g_A		165	Xenotropic murine leukemia virus-related virus (X	99.67
1wd2_A		60	Ariadne-1 protein homolog; ring, IBR, triad, zinc	99.66
4htu_A		134	Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine,	99.66
1zbf_A		142	Ribonuclease H-related protein; RNAse H, RNA/DNA h	99.65
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	99.52
1mu2_A		555	HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym	99.49
2zd1_A		557	Reverse transcriptase/ribonuclease H; P51/P66, het	99.44
2ct7_A		86	Ring finger protein 31; IBR, structural genomics,	99.02
2jmo_A		80	Parkin; IBR, E3 ligase, zinc binding domain, RBR;	98.86
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.81
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.65
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.32
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.31
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.3
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.28
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.28
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.28
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.26
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.23
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.19
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.17
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.17
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.17
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.15
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.15
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.15
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.14
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.13
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.12
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.09
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.09
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.08
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.08
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.06
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.06
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.04
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.01
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.01
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.0
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	97.98
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	97.96
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.96
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	97.94
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	97.94
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	97.92
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	97.89
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	97.87
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	97.84
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	97.82
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	97.8
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	97.8
1z6u_A		150	NP95-like ring finger protein isoform B; structura	97.77
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	97.76
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	97.66
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	97.65
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	97.64
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	97.61
2ct7_A		86	Ring finger protein 31; IBR, structural genomics,	97.6
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	97.58
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	97.57
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	97.36
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	97.22
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	97.18
2jmo_A		80	Parkin; IBR, E3 ligase, zinc binding domain, RBR;	97.17
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.17
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	97.11
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	97.03
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	97.02
2ea5_A		68	Cell growth regulator with ring finger domain prot	96.95
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	96.91
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	96.8
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	96.79
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	96.76
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	96.45
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	95.74
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	95.71
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	95.69
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	95.48
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	95.07
1wd2_A		60	Ariadne-1 protein homolog; ring, IBR, triad, zinc	92.85
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	92.77
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	91.14
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	90.95
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	89.61
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	89.24
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	88.57
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	88.35
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	87.76
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	87.44
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	87.1
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	87.01
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	86.77
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	86.15
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	86.01
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	85.84
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	85.83
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	84.97
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	84.59
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	84.39
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	84.33
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	84.32
2ect_A		78	Ring finger protein 126; metal binding protein, st	84.17
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	83.69
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	83.35
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	82.99
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	82.64
3nw0_A		238	Non-structural maintenance of chromosomes element	82.12
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	82.06
1joc_A		125	EEA1, early endosomal autoantigen 1; FYVE domain,	81.62
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	81.39
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	81.19
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	81.13
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	80.98
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	80.63
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	80.5

>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

Probab=99.91  E-value=2.4e-24  Score=195.92  Aligned_cols=132  Identities=20%  Similarity=0.312  Sum_probs=120.8

Q ss_pred             eEEEEEccceeecccCCCCCCCceEEEEEEeCC-CCeEEEeeeeccccCCChHHHHHHHHHHHHHHHHhcCCCeEEeecC
Q 008441          156 FFKVYSKGLVIEELVNGERVSLSAIGVAICDQM-DNLIFELKKPLIKSGLNKSAAETKALIEGLNAALSMELDRVRVFID  234 (565)
Q Consensus       156 ~~~vyfdGa~~~~~~~~~npg~ag~Gv~i~~~~-~~~~~~~~~~~~~~~tn~n~AEy~Ali~gL~~al~l~~~~v~v~~D  234 (565)
                      .++|||||++ .+     |||++|+|++|.++. |.++...+.++ +.. +||.|||+|++.||+.|.++|+++|.|++|
T Consensus         3 ~~~iy~DGs~-~~-----~~g~~g~G~v~~~~~~~~~~~~~~~~~-~~~-tn~~aEl~A~~~aL~~a~~~~~~~v~i~tD   74 (141)
T 3hst_B            3 KVVIEADGGS-RG-----NPGPAGYGAVVWTADHSTVLAESKQAI-GRA-TNNVAEYRGLIAGLDDAVKLGATEAAVLMD   74 (141)
T ss_dssp             EEEEEEEEEE-SS-----SSEEEEEEEEEEETTSCSEEEEEEEEE-EEE-CHHHHHHHHHHHHHHHHHHHTCSEEEEEES
T ss_pred             EEEEEEecCC-CC-----CCCCcEEEEEEEeCCCCcEEEeeeccC-CCC-chHHHHHHHHHHHHHHHHHCCCceEEEEeC
Confidence            4899999999 45     999999999999986 56677788887 644 458999999999999999999999999999


Q ss_pred             CccchhhccCccCCcchhhHHHHHHHHHHhhhccccccccccccchHHHHHHHHHhhhccc
Q 008441          235 CFPLFQFVTGRWPAKQRKISVLVDQVSLLEKRFSYFKPRHVARNDMKYVYELARAAINSQM  295 (565)
Q Consensus       235 S~lv~~qv~G~w~~k~~~l~~l~~~v~~Ll~~F~~~~~~~V~R~~n~~Ad~LA~eal~sqi  295 (565)
                      |++|++++++.|+++++.+..++.++..|+++|..+.+.||+|..|+.||+||+.++....
T Consensus        75 S~~vv~~i~~~~~~~~~~l~~~~~~i~~l~~~~~~v~~~~V~~~~N~~AD~LA~~a~~~~~  135 (141)
T 3hst_B           75 SKLVVEQMSGRWKVKHPDLLKLYVQAQALASQFRRINYEWVPRARNTYADRLANDAMDAAA  135 (141)
T ss_dssp             CHHHHHHHTTSSCCCSHHHHHHHHHHHHHHTTSSEEEEEECCGGGCHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHhCCcccCCHHHHHHHHHHHHHHhcCCeEEEEEcCCcccHHHHHHHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999999999999999987653

PyMOL of 3hst

>3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism}	Back alignment and structure

>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A	Back alignment and structure

>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A*	Back alignment and structure

>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A	Back alignment and structure

>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum}	Back alignment and structure

>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A	Back alignment and structure

>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ...	Back alignment and structure

>2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus}	Back alignment and structure

>3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A	Back alignment and structure

>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A	Back alignment and structure

>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A	Back alignment and structure

>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A	Back alignment and structure

>1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A*	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B	Back alignment and structure

>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ...	Back alignment and structure

>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4	Back alignment and structure

>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		565
d2ct7a1		73	g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H	1e-14
d1wd2a_		60	g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho	1e-13
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	2e-10
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	0.002

>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: IBR domain
domain: Ring finger protein 31
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.6 bits (162), Expect = 1e-14
 Identities = 12/64 (18%), Positives = 22/64 (34%), Gaps = 1/64 (1%)

Query: 464 EDVKLKSLASSNLWRQCVKCNHLIELAEGCFHMTC-RCGHEFCYNCGAEWKNKKATCSCP 522
           + +    L     +  C +C+            TC +C   FC  C  +W+ +    SC 
Sbjct: 5   KKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCE 64

Query: 523 LWDE 526
            +  
Sbjct: 65  DFQN 68

PyMOL of d2ct7a1

>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		565
d1wd2a_		60	Ariadne-1 protein homolog {Human (Homo sapiens) [T	99.66
d1zbfa1		132	BH0863-like Ribonuclease H {Bacillus halodurans [T	99.62
d1mu2a1		126	HIV RNase H (Domain of reverse transcriptase) {Hum	99.55
d1s1ta1		110	HIV RNase H (Domain of reverse transcriptase) {Hum	99.52
d1rila_		147	RNase H (RNase HI) {Thermus thermophilus [TaxId: 2	99.51
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	99.49
d1jl1a_		152	RNase H (RNase HI) {Escherichia coli [TaxId: 562]}	99.47
d2ct7a1		73	Ring finger protein 31 {Human (Homo sapiens) [TaxI	99.1
d2ct7a1		73	Ring finger protein 31 {Human (Homo sapiens) [TaxI	98.78
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.23
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.22
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.11
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.11
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.1
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.09
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.05
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	97.96
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	97.95
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	97.93
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	97.89
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	97.82
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	97.65
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.32
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	97.19
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	97.15
d1wd2a_		60	Ariadne-1 protein homolog {Human (Homo sapiens) [T	94.31
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	92.37
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	92.06
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	90.8
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	89.42
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	88.77
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	85.65
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	85.62
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	81.86
d2f9yb1		263	Acetyl-coenzyme A carboxylase carboxyl transferase	80.28
d1wfha_		64	Zinc finger A20 and AN1 domains containing protein	80.18

>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.66  E-value=6.8e-18  Score=128.31  Aligned_cols=51  Identities=37%  Similarity=0.922  Sum_probs=46.3

Q ss_pred             CccccCCCCceeEecCCcceEEee---cCccccccccccccCCCCC-cCCCCCCC
Q 008441          476 LWRQCVKCNHLIELAEGCFHMTCR---CGHEFCYNCGAEWKNKKAT-CSCPLWDE  526 (565)
Q Consensus       476 ~~k~CPkC~~~IEK~~GCnHMtC~---Cg~~FCw~C~~~~~~~~~~-c~C~~~~~  526 (565)
                      .+|+||+|+++|||++|||||+|+   ||++|||+|+++|..++.. +.|++|++
T Consensus         5 ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~~~~~C~~~~e   59 (60)
T d1wd2a_           5 NTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNE   59 (60)
T ss_dssp             CCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCCC
T ss_pred             cCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCCCCCCCcCCcc
Confidence            469999999999999999999995   9999999999999987655 58999976

PyMOL of d1wd2a_

>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]}	Back information, alignment and structure

>d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}	Back information, alignment and structure

>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure